Hosea (Ch 5-6)

•October 8, 2021 • Leave a Comment

The Prophecy of Hosea is primarily to the house of Ephraim. Being the chief tribe of the ten tribes, often Ephraim is used in place of Israel when it is referring to northern ten tribes. Elsewhere on this site Ephraim has been established as the United States. So although Hosea may refer to situation in his time, the encoded message of Ephraim and Israel is specially meant primarily for the United States and secondarily its European allies.

Hosea 5

1 “Hear ye this, O priests! And hearken, ye house of Israel! And give ye ear, O house of the king! For judgement is against you, because ye have been a snare on Mizpah, and a net spread upon Tabor. — Hear ye this, O priests, the spiritual leaders of the people; and hearken, ye house of Israel, the family of the ten tribes as such; and give ye ear, in paying most careful attention, O house of the king, as the temporal rulers of the nation; for judgment is against you, it is intended all of them, to strike them down in due time.

And the revolters are deep in slaughter, though I have been a rebuker of them all.

I know Ephraim, and Israel is not hid from Me; for now, O Ephraim, thou committest whoredom, and Israel is defiled. — I know Ephraim, and Israel is not hid from me…. though Ephraim may cover their designs from other nations, and seek deep to hide their counsel from them, and make plausible pretenses for what they do, and put on an appearance of good democracy; yet God, who knows Ephraim and their hearts cannot be deceived.

“They will not frame their doings to turn unto their God; for the spirit of whoredoms is in the midst of them, and they have not known the Lord.

And the pride of Israel doth testify to his face; therefore shall Israel and Ephraim fall in their iniquity; Judah also shall fall with them. — the way this verse is phrased, it seems like Ephraim will fall first, then Judah will fall also; which is true with historical records: Judah also fell into idolatry, and were guilty of the same crimes as Israel, so should be involved in the same punishment, though not at the same time; for the Babylonish captivity, in which Judah was carried captive, was many years after Israel was carried captives by the Assyrians; which were about 135-150 years before Judah.

They shall go with their flocks and with their herds to seek the Lord, but they shall not find Him; He hath withdrawn Himself from them.

They have dealt treacherously against the Lord, for they have begotten strange children. Now shall a month devour them with their portions.

“Blow ye the cornet in Gibeah, and the trumpet in Ramah! Cry aloud at Bethaven! After thee, O Benjamin! — according to the Targum, the words are directed to the prophets, “O ye prophets, lift up your voice like a trumpet” to declare to the house of Israel their sins and transgressions, and the punishment that would be inflicted on them for them; or it may be, this is a call of the people to fasting, mounting, and lamentation, as in Joel 2:1.

Ephraim shall be desolate in the day of rebuke; among the tribes of Israel have I made known that which shall surely be. — the country of the ten tribes shall be laid desolate, the inhabitants of them destroyed either by the sword, or famine, or pestilence, and the rest carried captives, as they were by Shalmaneser; and again in the “days afar off” – our time, of the Lord’s rebuke and chastisement.

10 The princes of Judah were like them that remove the landmarks; therefore I will pour out My wrath upon them like water. — Judah will also go down, following Ephraim, as history recorded them.

11 Ephraim is oppressed and broken in judgment, because he willingly walked after the commandment. — as the Targum says; by the tyranny of their kings, and the injustice of their judges, who looked only for the mammon of unrighteousness.

12 Therefore will I be unto Ephraim as a moth, and to the house of Judah as rottenness. — will I be unto Ephraim as a moth…. which eats garments, penetrates into them, feeds on them quietly, secretly, and gradually consumes them; but at last utterly, they are just of no use left. 

13 “When Ephraim saw his sickness, and Judah saw his wound, then went Ephraim to the Assyrian, and sent to King Jareb. Yet could he not heal you, nor cure you of your wound. — then went Ephraim to the Assyrian, looking for assistance from the heathens instead of consulting the Lord; again, Ephraim is recorded first, Judah following behind in going down; its significance could be prophetic.

14 For I will be unto Ephraim as a lion, and as a young lion to the house of Judah; I, even I, will tear and go away; I will take away, and none shall rescue him. — I, even I, will tear and go away, as a lion withdrawing to his den; I will take away, and none shall rescue him, for with the Lord’s merciful presence removed, there is no hope of deliverance.

15 I will go and return to My place, till they acknowledge their offense and seek My face; in their affliction they will seek Me early.” — this is flashing forward, as if it is a Second Coming, where redemption becomes available again, but the house of Israel will have to go into captivity; for a period of 190 years? On reflection they were in Egypt for about 210 years, so cheers; this coming captivity is 20 years shorter.

— and those who consistently break the Law of Moses (Leviticus 26Deuteronomy 28) in their Judgement shall be more than horsewhipped! They would suffer by the sword, by famine, by pestilence and spending years in captivity to reflect; that is “till they acknowledge their offense and seek My face;” and repent (for more see Ezekiel 4 – 390/40 Years and A Sword from the South!)

Hosea 6

There is a great gap in time in between from their detestable filthy and abominable stage in chapter 5 to one where the house of Israel would be ready to accept God’s new spirits, statues and judgments in chapter 6 below; in fact in the book of Ezekiel, it flashes from chapter 2 to chapter 37.

1 Come, and let us return unto the Lord; for He hath torn, and He will heal us; He hath smitten, and He will bind us up. — it’s very prophetic, rather historical as Rashi comments; he smites, and He will bind us up: Heb. It is a present tense. He smites us, and He will bind us up.

After two days will He revive us; on the third day He will raise us up, and we shall live in His sight. — as a thousand years is to God a single day (II Peter 3:8), rising on the third day is to God rising on the third millennium; from around 740 BC when the Assyrians began taking those three tribes east of the Jordan:

And the God of Israel stirred up the spirit of Pul king of Assyria, and the spirit of Tilgathpilneser king of Assyria, and he carried them away, even the Reubenites, and the Gadites, and the halftribe of Manasseh, and brought them unto Halah, and Habor, and Hara, and to the River Gozan unto this day, I Chronicles 5:26.

Flashing forward into the third millennium will bring the scene to our time, when the house of Israel will be revived; the United States gained independence on July 4, 1776 and grew into a great united nation; but toward the end, preceded by 190 years of captivity for the house of Israel and 40 years for the house of Judah (Ezekiel 4).

Then shall we know, if we follow on to know the Lord; His going forth is prepared as the morning; and He shall come unto us as the rain, as the latter and former rain unto the earth.

“O Ephraim, what shall I do unto thee? O Judah, what shall I do unto thee? For your goodness is as a morning cloud, and as the early dew it goeth away. — O Ephraim, what shall I do unto thee? O Judah, what shall I do unto thee?…. or, the Lord having observed the effect and consequence of of his leaving his people for a long time under afflictions and in distress; namely, their thorough conversion to him in the latter day; until the third day, until the third millennium.

Therefore have I hewn them by the prophets; I have slain them by the words of My mouth; and thy judgments are as the light that goeth forth. — Rashi: Because I have hewed by the prophets: Heb. עַל-כֵּן. Because I hewed My words upon them through the prophets, but they did not take heed, therefore…

— the Targum says it clearer:,“because I admonished them by the message of my prophets, and they returned not, I will bring upon them those that slay, because they have transgressed the word of my will.”

For I desired mercy, and not sacrifice; and the knowledge of God more than burnt offerings. — a parallel verse in I Samuel 15:22 says “And Samuel said, “Hath the Lord as great delight in burnt offerings and sacrifices as in obeying the voice of the Lord? Behold, to obey is better than sacrifice, and to hearken than the fat of rams.”

— and the knowledge of God more than burnt offerings; which were reckoned the greatest and most excellent sacrifices; but knowledge of God is preferred to them; not just knowing the laws of Moses as a lawgiver, judge, and consuming fire, but how to execute them justly and at times where situations require, mercifully;

— to have a form and shell of godliness, but to deny its substance, is the essence of hypocrisy.

But they like Adam have transgressed the covenant; there have they dealt treacherously against Me. — in the covenant they entered into, and then breaking it by offering sacrifices to idols, under a pretense of offering them to God, was dealing treacherously against him.

Gilead is a city of them that work iniquity, and is polluted with blood.

And as troops of robbers wait for a man, so the company of priests murder on the way by consent; for they commit lewdness.

10 I have seen a horrible thing in the house of Israel; there is the whoredom of Ephraim, Israel is defiled. — I have seen an horrible thing in the house of Israel…. idolatry, starting with the calves set up at Dan and Bethel, which God saw with abhorrence and detestation.

11 Also, O Judah, he hath set a harvest for thee, when I returned My people from captivity.

— Israel is always mentioned first, followed by Judah, who didn’t have the wisdom to take the warning seriously, hence they, too, will go into captivity after Israel has gone into captivity for 150 years. Another 40 years to add towards 190 years in total (Ezekiel 4).

Ephraim and Manasseh

•October 7, 2021 • 2 Comments

Who is Ephraim and who is Manasseh

The Ox / Bull / Bullock

More on the Ox and the Unicorn:

Let the blessing come upon the head of Joseph, and upon the top of the head of him that was separated from his brethren. His glory is like the firstling of his ox (bullock), and his horns are like the horns of unicorns. With them he shall push the people together to the ends of the earth; and they are the ten thousands of Ephraim, and they are the thousands of Manasseh,” Deuteronomy 33:16-17.

In the above verse, the Ox and Ephraim are named first, the firstborn of his (Joseph’s) “bullock is his glory”: the reference being to Ephraim; followed by Unicorn and Manasseh.

Saolas or Asian Unicorn in the remote Mountains of Laos and Vietnam

Although Manasseh was the firstborn, Joseph the father crossed his hands and placed Ephraim as firstborn, hence Ephraim, often known as the thirteenth tribe, represents not just the house of Joseph, but more often the house of the 10-tribes Northern Kingdom.

Greater coat of arms of the United States.svg
Great Seal of the United States – thirteen Stars, thirteen Arrows, thirteen Leaves and thirteen Olives – the thirteenth tribe
A Unicorn in the Royal Coat of Arms of the United Kingdom

In Rabbinic teachings: the myriads (ten thousands) slain by Joshua, of the tribe of Ephraim: These are the myriads descended from Ephraim;

— and the thousands of Manasseh: these are the thousands slain by Gideon, who was of the tribe of Manasseh. These are the thousands descended from Manasseh.

In his blessings Jacob ascribes to Ephraim ten thousands, and to Manasseh only thousands; thus foreshowing, that Ephraim the younger was to be the more numerous of the two, as Jacob had before prophesied of them.

Hosea (Ch 3-4)

•October 6, 2021 • Leave a Comment

Chapter 3 starts with a parable expressing the love of God to Israel, but their ingratitude to him; have much reflection again upon the house of Ephraim, often flashing forward when they repent or back as as the state of Ephraim now, and concludes with a prophecy of their conversion to God in the latter days.

Hosea 3

1 Then said the Lord unto me, “Go yet, love a woman beloved of her friend yet an adulteress, according to the love of the Lord toward the children of Israel, who look to other gods and love flagons of wine.” — then said the Lord unto me…. or, as the Targum says, “the Lord said unto me again”; for the Hebrew expression shows that this is a new vision, prophecy or parable.

So I bought her for myself for fifteen pieces of silver, and for a homer of barley and a half homer of barley. — fifteen pieces of silver; an indication she’s made herself very cheap, for a slave would normally be sold for twice the number of silvers.

And I said unto her, “Thou shalt abide for me many days. Thou shalt not play the harlot, and thou shalt not be for another man. So will I also be for thee.”

For the children of Israel shall abide many days without a king, and without a prince, and without a sacrifice, and without an image, and without an ephod, and without teraphim. — for the children of Israel shall abide many days without a king, and without a prince…. without any king or prince as the ten tribes were from their captivity by Shalmaneser; but moe importantly as seen from God’s point of view, no man of character of the likes of David, Hezekiah or Josiah.

Afterward shall the children of Israel return, and seek the Lord their God and David their king, and shall fear the Lord and His goodness in the latter days. — after almost three thousand years, “in the latter days,” the house of Israel will end their abandonment and captivity with the appearance of “My servant David” in the “valley full of dry bones” scenario (Ezekiel 37) where they will dwell securely.

Hosea 4

1 Hear the word of the Lord, ye children of Israel; for the Lord hath a controversy with the inhabitants of the land, because there is no truth nor mercy nor knowledge of God in the land. — “there is no truth;” which is extremely true; a majority (99.99%) of professing “Christians” didn’t know the simplest of what constitutes the Oracles of God; and here.

“By swearing and lying, and killing and stealing and committing adultery, they break out, and blood toucheth blood. — by swearing, and lying…. false swearing, as the Targum interprets it; for it not only takes in all cursing and imprecations, profane oaths, and taking the name of God in vain. And eager to be engaged in crimes of the worst kind, and blood toucheth blood, one act of bloodshed following another.

Therefore shall the land mourn, and every one that dwelleth therein shall languish with the beasts of the field and with the fowls of heaven; yea, the fishes of the sea also shall be taken away.

Yet let no man strive with, nor reprove another; for this people are as they that strive with the priest. — yet let no man strive nor reprove another, that is, conditions being so bad as they are, all attempts to change the corruption would be vain.

Therefore shalt thou fall in the day, and the prophet also shall fall with thee in the night; and I will destroy thy mother. — and I will destroy thy mother; the northern Israelites; so that their nation and name should perish together. Is it not so with the ten tribes? who can tell at this day where to find them or whence to expect them?

My people are destroyed for lack of knowledge. Because thou hast rejected knowledge, I will also reject thee, that thou shalt be no priest to Me. Seeing thou hast forgotten the law of thy God, I will also forget thy children. — again, the Oracles of God are inferred here. To God, these lacks of knowledge are serious stuff! Hence numerous repeats and reminders; repeats and reminders.

“As they were increased, so they sinned against Me; therefore will I change their glory into shame. — therefore will I change their glory into shame, so that their greatness and prosperity would become a mockery in the eyes of the nations.

They eat up the sin of My people, and they set their heart on their iniquity. — they eat up the sin of my people…. that is, pastors and ministers today, as they eat up their sacrifices, in tithes and offerings, which the people brought for their sins: but they have no concern to instruct the people in the right way; all that they regarded are good eating and drinking, and living voluptuously; and careless about instructing the people in the nature of sacrifices, and of their duty.

And it shall be: like people, like priest; and I will punish them for their ways, and reward them their doings.

Two parallel verses reveal more details in Ezekiel:

2 “Son of man, prophesy against the shepherds of Israel, prophesy and say unto them, ‘Thus saith the Lord God unto the shepherds: Woe be to the shepherds of Israel that feed themselves! Should not the shepherds feed the flocks?

3 Ye eat the fat, and ye clothe yourselves with the wool, ye kill the ones that are fed; but ye feed not the flock. Ezekiel 34:2-3 — but ye feed not the flock; did not govern the people well by doing justice and judgment among men, as became civil magistrates; did not deliver out words of faith and sound teachings, to feed the minds of men with, which is the duty of those that preside in the church of God.

10 For they shall eat and not have enough; they shall commit whoredom and shall not increase, because they have left off taking heed of the Lord.

11 “Whoredom and wine and new wine take away the heart. — once a man turns to prostitutes and intoxicating drink for pleasure, he loses his judgment. Harlots and wine take away a man’s mind.

12 My people ask counsel from their stocks, and their staff declareth unto them; for the spirit of whoredoms hath caused them to err, and they have gone a whoring from their God.

13 They sacrifice upon the tops of the mountains, and burn incense upon the hills under oaks and poplars and elms, because the shadow thereof is good; therefore your daughters shall commit whoredom, and your spouses shall commit adultery.

14 I will not punish your daughters when they commit whoredom, nor your spouses when they commit adultery; for the men themselves consort with whores, and they sacrifice with harlots: Therefore the people that doth not understand shall fall. — I will not punish your daughters when they commit whoredoms, nor your spouses when they commit adultery…. the words are rendered interrogatively, “shall I not punish your daughters?” Verily I will; and not them only, but their parents and husbands too, who deserve more severe corrections.

15 “Though thou, Israel, play the harlot, yet let not Judah offend; and come not ye unto Gilgal, neither go ye up to Bethaven, nor swear, ‘The Lord liveth.’ — though the Ephraimites or people of the other ten tribes committed adultery, both corporeal and spiritual, in their idolatrous worship, let Judah be warned of the same crimes.

16 For Israel slideth back as a backsliding heifer; now the Lord will feed them as a lamb in a large place.

17 “Ephraim is joined to idols; leave him alone. — Ephraim is joined to idols…. that is, the ten tribes of Israel, frequently so called after their separation from the rest, because Jeroboam, by whom the revolt was made, was the top dog, and Samaria, the metropolis of their kingdom, was in it: and

so the Targum renders it, “the house of Israel are joined to idols;” to the calves at Dan and Bethel; to Baal, and other idols, they worshipped.

18 Their drink is sour; they have committed whoredom continually; her rulers with shame do love, ‘Give ye.’ — their drink is sour…. in their stomachs, having drank so much that they cannot digest it; hence nauseous eructations, with a filthy stench, are belched out; so it is a charge of drunkenness which Ephraim or the ten tribes were addicted to, and are accused of.

19 The wind hath bound her up in her wings, and they shall be ashamed because of their sacrifices. — the wind hath bound her up in her wings…. that is, the wind in its wings hath bound up Ephraim, or the ten tribes; meaning, that the wind of God’s wrath and vengeance, or the enemy, the Assyrian, should come like a whirlwind, and carry them swiftly, suddenly, and irresistibly, out of their own land, into a foreign country, into captivity.

— because of their sacrifices; the Targum says, “because of the altars of their idols.”

Hosea (Ch 1-2)

•October 5, 2021 • Leave a Comment

The Prophecy of Hosea is primarily to the house of Ephraim (mentions 32 times in Hosea, and more than in any other books of the Bible). Often, as Ephraim being the chief tribe of the ten tribes, the name is used in place of Israel (used 41 times) when it is referring to the northern kingdom. Elsewhere on this site Ephraim has been established as the United States. So although the prophet Hosea may refer to situation in his time, the encoded message of Ephraim and Israel is meant primarily for the United States and secondarily its European allies.

Elsewhere, there are more detailed parallel passages in Ezekiel:

In Ezekiel 6:2 it say: ‘Ye mountains of Israel, hear the word of the Lord God. Thus saith the Lord God to the mountains and to the hills, to the rivers and to the valleys: Behold I, even I, will bring a sword upon you, and I will destroy your high places. — this message to the “mountains of Israel” — these mountains refer to the United States, UK and France. . . . “and to the hills, to the rivers and to the valleys” — the hills: Ireland, Switzerland and the Scandinavian countries: Denmark, Norway, and Sweden, Finland, and Iceland; and the valleys, the low countries: Belgium, the Netherlands, and Luxembourg.

In Ezekiel 7:2 it says, “Also, thou son of man, thus saith the Lord God unto the land of Israel: “An end! The end is come upon the four corners of the land. — The Targum version for the above is: “the punishment of the end, or the punishment determined to come upon the four winds of the earth.” The Targum recognizes that the Israelites are all over the face of the earth, spread over the four winds!

This would include Australia, New Zealand, Canada (and perhaps South Africa?) and numerous small islands around the world.

And in this context, “the land of Israel” and “over the face of the earth” would most probably include the modern state of Israel in Palestine.

Hosea 1

1 The word of the Lord that came unto Hosea, the son of Beeri, in the days of Uzziah, Jotham, Ahaz, and Hezekiah, kings of Judah, and in the days of Jeroboam the son of Joash, king of Israel. — the word of the Lord that came unto Hosea…. whose name is the same with Joshua and Yeshua/Jesus, and signifies a savior; he was a type of a savior, to deliver their souls from going into the pit, as all true prophets are to be; so rouse and ripple up these drunkards of Ephraim with their crown of pride, Isaiah 28:1.

in the days of. . . Hezekiah: the throne of Judah had some periods of good princes: but the message was to Israel, which had none at all.

The beginning of the word of the Lord by Hosea: And the Lord said to Hosea, “Go, take unto thee a wife of whoredoms and children of whoredoms; for the land hath committed great whoredom, departing from the Lord.” — for the land hath committed great whoredoms most frequently and most filthily; Ezekiel 23:2-4; Aholah, that is, Israel, played the harlot when she was Mine, Ezekiel 23:5.

 God asks Hosea to marry a harlot, so he marries Gomer

So he went and took Gomer the daughter of Diblaim, who conceived and bore him a son.

— the Targum, whose origin in the Aramaic language could be traced to Ezra, has the following: “and he went and prophesied over them, that if they returned, it should be forgiven them: but, if not, as fig tree leaves drop off, so should they; but they added, and did evil works.”

Rabbi Rashi (1040-1105 France): that was her name by dint of her harlotry, for all would gratify their lust on her (גּוֹמְרִין) and they would tread upon her like a pressed fig (דְּבֵלָה; that is a euphemism for sexual contact). Jonathan, however, paraphrases: גֹּמֶר, that if they would return from their way, their retribution would be finished, and if not, they will be like unripe figs falling from the fig tree.

And the Lord said unto him, “Call his name Jezreel; for in yet a little while I will avenge the blood of Jezreel upon the house of Jehu, and will cause to cease the kingdom of the house of Israel. — and will cause to cease the kingdom of the house of Israel; that is, in the family of Jehu; Zachariah the son of the then reigning prince being the last, and his reign only the short reign of six months; and second, this could also has a reference to the utter cessation of this kingdom as such in the times of Hoshea by Shalmaneser king of Assyria, 2 Kings 17:6.

Rashi: name him Jezreel: Jonathan renders: Call their name the scattered ones; i.e. prophesy over them that they will be exiled, and they will be sown among the peoples.

And it shall come to pass at that day, that I will break the bow of Israel in the Valley of Jezreel.”

And she conceived again, and bore a daughter. And God said unto him, “Call her name Loruhamah [that is, Not having obtained mercy]; for I will no more have mercy upon the house of Israel, but I will utterly take them away. — and God said unto him, call her name Loruhamah; which signifies, “she hath not obtained mercy;”

the Targum explains the same sense: “and they added and did evil works; and he said unto him call their name, who obtained not mercy by their works.”

But I will have mercy upon the house of Judah, and will save them by the Lord their God, and will not save them by bow, nor by sword, nor by battle, by horses, nor by horsemen.” — but I will have mercy on the house of Judah…. the three tribes of Judah, Levi and Benjamin, which retained the true worship of God among them; see Hosea 11:12 and though they often sinned against the Lord, God showed them mercy, and spared them longer than the ten tribes; and though they suffered being carried captives into Babylon, they returned after seventy years. This is mentioned as an aggravation of the punishment of Israel that Judah was spared, when Israel were not.

Now when she had weaned Loruhamah, she conceived and bore a son. — in the times of Pekah, king of Israel, who reigned twenty years; he was too powerful for Judah, and slew multitudes of them, and even assisted Rezin king of Syria against Ahaz king of Judah; the Targum says, “and the generation of them who are carried captive among the nations are found not to have obtained mercy by their works, but they added and did evil works.”

Then said God, “Call his name Loammi [that is, Not My people], for ye are not My people, and I will not be your God. — for ye are not my people; though he had chosen them to be his people and had distinguished them from others by various blessings and privileges; but they offered back the calves at Dan and Bethel; and therefore did not deserve the designation of God’s people.

— this time lap to the next verse is so huge that some Orthodox Bibles end Chapter 1 here and push the next few verses into chapter 2.

10 Yet the number of the children of Israel shall be as the sand of the sea, which cannot be measured nor numbered; and it shall come to pass that in the place where it was said unto them, ‘Ye are not My people,’ there it shall be said unto them, ‘Ye are the sons of the living God.’ — there seems a great time gap of over two thousand years, from “Ye are not My people,” to “Ye are the sons of the living God,” and like every Bollywood movies, they end with lots of high notes – HOOPLA!

11 Then shall the children of Judah and the children of Israel be gathered together, and appoint themselves one head; and they shall come up out of the land, for great shall be the day of Jezreel. — this is time flashing forward to the appearance of “My servant David,” in the “valley full of dry bones” scenario (Ezekiel 37) where the full house of Israel would dwell securely rather than in captivity.

the Targum paraphrases it as: “one head of the house of David.”

“the day of Jezreel;” by the arm of God, by his power and grace, and that in large numbers, so great will be on that day; so the Targum paraphrases it: “for great will be the day of their [re]gathering.”

Hosea 2

1 “Say ye unto your brethren, ‘Ammi’ [that is, My people], and to your sisters, ‘Ruhamah’ [that is, Having obtained mercy]. — these words are to be considered either in connection with the latter part of the preceding chapter, and as directed to the sons of the living God, who had not been, but now were, “Ammi”, the Lord’s people; and who had not, but now have, “Ruhamah,” obtained mercy.

“Plead with your mother, plead; for she is not My wife, neither am I her Husband. Let her therefore put away her whoredoms out of her sight, and her adulteries from between her breasts, — let her therefore put away her whoredoms out of her sight, namely, the shameless idolatry which was practiced throughout Israel at the time, and her adulteries from between her breasts, for Israel, in her shamelessness, was like a public harlot, who displays her profession in her bared breasts.

Gill: the Septuagint and Arabic versions are, “I will take away her whoredoms.”

lest I strip her naked and set her as in the day that she was born, and make her as a wilderness, and set her like a dry land, and slay her with thirst. — lest I strip her naked, as a punishment for her shameless exposure of herself in the practice of her spiritual wantonness, and set her as in the day that she was born.

And I will not have mercy upon her children, for they are the children of whoredoms.

— the above verse (and probably until verse 13) is best read:

(a) as a flashback before their repentance; or

(b) in context of the first word of the previous verse, “lest,” — lest I will not have any mercy upon her children, for they are children of whoredoms, all of them being guilty of the same shameless idolatry.

For their mother hath played the harlot; she that conceived them hath done shamefully. For she said, ‘I will go after my lovers that give me my bread and my water, my wool and my flax, mine oil and my drink.’

“Therefore, behold, I will hedge up thy way with thorns and make a wall, that she shall not find her paths.

And she shall follow after her lovers, but she shall not overtake them; and she shall seek them, but shall not find them. Then shall she say, ‘I will go and return to my first husband, for then was it better with me than now.’ — I will go and return to my first husband; either the God of Israel, whom the ten tribes departed from by worshipping the calves Jeroboam set up; but in the latter day will seek the Lord their God again, who was a husband to them, and shall cleave to him again, and all Israel shall be saved:

so the Targum says, “I will go and return to the service of my first master, for it was well with me when I served him; henceforth I will not serve idols.”

For she did not know that I gave her corn and wine and oil, and multiplied her silver and gold, which they prepared for Baal.

Therefore will I return and take away My corn at the harvest thereof, and My wine in the season thereof, and will recover My wool and My flax given to cover her nakedness.

10 And now will I uncover her lewdness in the sight of her lovers, and none shall deliver her out of Mine hand.

11 I will also cause all her mirth to cease, her feast days, her new moons, and her Sabbaths, and all her solemn feasts. — her feast days; which “Christians” understand and practice are:

(a) Christmas, which honor the Mithraism – a form of nature worship based on the Sun-Goddess Mithra who on the darkest night of the year (December 20/21), gives birth to “Light” causing each day thereafter to grow longer until the Summer solstice; and

(b) Easters, a celebration of Ishtar, the Assyrian and Babylonian goddess of fertility and sex. Her symbols (like the egg and bunny) were and still are fertility and sex symbols; and to those who actually think eggs and bunnies have something to do with the resurrection; and

(c) her sabbaths which is Sundays, where the original keepers were the Samaritans, brought from Assyria: And the king of Assyria brought men from Babylon, and from Cuthah, and from Ava, and from Hamath, and from Sepharvaim, and placed them in the cities of Samaria instead of the children of Israel; and they possessed Samaria and dwelt in the cities thereof, II Kings 17:24.

12 And I will destroy her vines and her fig trees, whereof she hath said, ‘These are my rewards that my lovers have given me’; and I will make them a forest, and the beasts of the field shall eat them.

13 And I will visit upon her the days of the Baalim, wherein she burned incense to them, and she decked herself with her earrings and her jewels, and she went after her lovers, and forgot Me,” saith the Lord.

14 “Therefore, behold, I will allure her, and bring her into the wilderness, and speak comfortingly unto her.

Parallel verses are:

“And many among them shall stumble and fall and be broken, and be snared and be taken” Isaiah 8:15.

“And I will spread My net upon him, and he shall be taken in My snare, and I will bring him to Babylon and will plead with him there for his trespass that he hath trespassed against Me” Ezekiel 17:20.

15 And I will give her her vineyards from thence, and the Valley of Achor for a door of hope; and she shall sing there, as in the days of her youth, and as in the day when she came up out of the land of Egypt.

16 “And it shall be at that day,” saith the Lord, “that thou shalt call Me ‘Ishi’ [that is, My husband], and shalt call Me no more ‘Baali’ [that is, My Lord].

17 For I will take away the names of the Baalim out of her mouth, and they shall no more be remembered by their name. — the sense is, that idolatry shall be utterly abolished, even of every kind; not the worship of Baalim only, but of all other idols, Exodus 23:13,

— and so the Targum says, “and I will take away the name of the idols of the people out of their mouth.”

18 And in that day will I make a covenant for them with the beasts of the field, and with the fowls of the heavens, and with the creeping things of the ground; and I will break the bow and the sword and warfare out of the earth, and will make them to lie down safely. — and I will break the bow and the sword and the battle out of the earth; all the instruments of war shall be no more, these mentioned being put for all the rest; the Pentagon and West Point will be demolished, swords shall be beat into ploughshares, and spears into pruning hooks; people will enjoy being farmers, and lots of them; some go on learning folk songs, dancing away, like Tibetan and Mongolian folk songs and dances, practicing their vocal cords praising God;

19 And I will betroth thee unto Me for ever; yea, I will betroth thee unto Me in righteousness, and in judgment, and in lovingkindness, and in mercies.

20 I will even betroth thee unto Me in faithfulness, and thou shalt know the Lord.

21 “And it shall come to pass in that day I will hear,” saith the Lord, “I will hear the heavens, and they shall hear the earth.

22 And the earth shall hear the corn and the wine and the oil, and they shall hear Jezreel. — see, people will enjoy being farmers, and even herders, lots of them; and with plenty of good wine and time, many will go on learning folk songs, dancing away into the clouds.

23 And I will sow her unto Me in the earth; and I will have mercy upon her that had not obtained mercy; and I will say to those who were not My people, ‘Thou art My people’; and they shall say, ‘Thou art my God.’”

~~

— as said above, people will enjoy being farmers and herders, lots of them; and with plenty of time on hand and during in-between breaks along their open fields, they will go on learning and perfecting their folk songs, of their ethnic groups that had been accumulated over hundreds and even thousands of years, now singing and dancing away, like Mongolian, Pashtuni, Kashmiri among numerous other ethnic groups hills and valleys; and especially the Tibetan, among their shangri la idyllic hideaway mountains, and with good wine, their vocal cords moist and loosen further, singing and praising God with sweeter songs: “Thou art our God, too,” beaming with an even higher pitch from the roof of the world, like this one;

— and during the annual Feast of Tabernacles in Jerusalem, these ethnic groups singing and dancing with their finest ethnic colorful silk costumes from the enlarged outer court of a new Temple could pose a challenge to those Levites singing from inside the confine of the inner court; “Don’t be so loud,” some annoyed-looking officials appears from the inner court admonishing those singing too loud outside;

— but the loudest and most uncontrollable cheers comes upon the appearance of the dancing and singing Gypsies: “Beyond Our Wildest Dream” whose fortunes had greatly fallen since the great days of the great Pharaohs of Egypt; now their honor restored, displaying much renew joy and restraint cool pride than others, which greatly enlighten the whole world following some surrealistic chills running down their spines flooding their face with socking tears and more applause in response;

— and of course, the Shekinah has returned, filling the much bigger Ezekiel Temple and its precinct with nice smell incense (five hundred cubits in length with five hundred in breadth: Ezekiel 45:2 – “875 by 875 feet”); the whole idyllic atmosphere permeanting all our five senses with surreal clouds rolling overhead and moving continuously along with the Glory of God.

Ezekiel 4 – 390/40 Years

•October 3, 2021 • 3 Comments

There were much additions since the original posting of Ezekiel (Ch 3-4), hence this update and excerpt here. Just wondering if there is any thoughts to the contrary? Any other possibilities? Thanks for reading.

Ezekiel 4

Below is the Septuagint (and Arabic versions; Gill says so) and putting all together, a possible explanation to the mystery of the 390/190/150/40 years:

Ezekiel 4

4 And thou shalt lie upon thy left side, and lay the iniquities of the house of Israel upon it, according to the number of the hundred and fifty days which thou shalt lie upon it: and thou shalt bear their iniquities.  start with the ten tribes house of Israel and last for 150 years

5 For I have appointed thee their iniquities for a number of days, for a hundred and ninety days: so thou shalt bear the iniquities of the house of Israel start with the 10 tribes but end with the full house of Israel; all 12 tribes: end of the 190 years

6 And thou shalt accomplish this, and shalt lie on thy right side, and shalt bear the iniquities of the house of Juda forty days: I have appointed thee a day for a year. Ezekiel 4:4-6 Septuagint.  after the start of the 10 tribes house of Israel and last for 150 years, the house of Judah; 3 tribes join in for 40 years

Take thou also to thee wheat, and barley, and beans, and lentils, and millet, and bread-corn; and thou shalt cast them into one earthen vessel, and shalt make them into loaves for thyself; and thou shalt eat them a hundred and ninety days, according to the number of the days which thou sleepest on thy side. Ezekiel 4:4-9 Septuagint.  from the start with 10 tribes and ends with the full house of Israel: 190 years: why the difference? Perhaps Judah had undergo numerous pogroms and cleanings whereas Ephraim has none since the day when went captivity and into apparent oblivion

We’re now in the Hebrew year 5782 and we’ll need another 217 years to usher the Divine Plan into the 7th Millennium as we believe. Of course, this is on the assumption that God’s oracles have been accurately kept since the day Adam was created as the Orthodox custodians claim.

If we add 217 years to the Gregorian calendar year 2022 we’ll come to 2239 when the 7th Millennium starts. Working backward 190 years will bring us to the Gregorian year 2049. So could the year 2049 be the start of the house of Israel’s “iniquity?” — “thus shall the children of Israel eat their defiled bread among the Gentiles, whither I will drive them;” Ezekiel 4:13 in captivity to start the 190 years?

No, not really: the 190 years should end with the appearance of “My servant David,” in the “valley full of dry bones” scenario (Ezekiel 37) where the full house of Israel would dwell securely rather than in captivity. Indications are that this period is a hundred year period involving “Gog and all his multitude” to the beginning of the Millennium (Ezekiel 40). If so, the start of the 190 years would be pushed back another hundred years, which would be the Gregorian year 2048; which seems having a higher possibility than the figures offered by the Masoretic Text.

On reflection the children of Israel were in Egypt for about 210 years, so cheers; this captivity of 190 years is 20 years shorter. These analyses may run away with imaginations, but the incorporation of prophecies always has elements of uncertainties and so these predictions could be prone to errors.

Okay, one Question that comes to mind is, “Why the iniquity for Israel is much longer than Judah?” Perhaps the answer could be broken into two parts: (1) the house of Judah, the Jews, have undergone pogroms numerous times over the last two and a millenium whereas the house of Israel have remained largely unscatched since their captivity was only once by the Assyrians; to be truly qualified to be a kingdom of priests (Exodus 19:6) requiries numerous immense purifications; and that’s how the prophets of God see things. Prime examples are Daniel and his three friends, Shadrach, Meshach and Abed-Nego.

And a related second reason: (2) the house of Judah has already been restored to the Land of Promise; whereas the house of Israel are still largely intact and still in exile from its Promised Land. It would take decades for adverse conditions to build up for the whole house of Israel to want to return back into their homeland to team up with the house of Judah for the fulfilment of the prophecy of the joining of the two sticks in Ezekiel 37.

Third, forty years for the house of Judah rhymes a few parallels (a) when the children of Israel rejected Joshua’s and Caleb’s suggestion to take the land immediately, they were punished by wandering in the wilderness for forty years, Numbers 14:33; (b) when the children of Israel rejected God’s judgement under the rule of the judges, God abandoned them and subjected them under the Philistines for forty years, Judges 13:1. For the Lord had said ““You only have I known of all the families of the earth; therefore I will punish you for all your iniquities” Amos 3:2.

And finally these analyses are not written in stone and so any thoughts to the contrary are most welcome. Are there any other possibilities or factors that have been left out but could or should be considered? Thanks for your thoughts.

For more, see a possible scenario how such a scene could come about: A Sword from the South!

Ezekiel (Ch 39-40)

•September 29, 2021 • Leave a Comment

Practically fragments of all the previous chapter are repeated in chapter 39, namely, Ezekiel 39:2-4,14-17. Comments on Gog, the chief (Rosh) prince of Meshech and Tubal continues. Meshech and Tubal; these are names associated with Russia. Meshech in Hebrew is Mosoch and the Muscovites are said to descend from Meshech. Being brothers, Meschech is also closely associated with Tubal. Assyrian annals have them as Tabali and Mushki. The Russian city Tobolsk is said to derive from Tubal. Tbilisi is the Capital of the country of Georgia. A picture of a geographical area begins to be apparent with names associated with these tribes.

Ezekiel 39

1 “Therefore, thou son of man, prophesy against Gog and say, ‘Thus saith the Lord God: Behold, I am against thee, O Gog, the chief prince of Meshech and Tubal.

And I will turn thee back and leave but a sixth part of thee, and will cause thee to come up from the north parts and will bring thee upon the mountains of Israel; — Gill: I will lead thee and turn thee wheresoever I please: thou shalt not proceed any further than I shall permit thee, but shalt be driven back. And leave but a sixth part of thee; Or, as others render it, I will strike thee with six plagues, those mentioned in Ezekiel 38:22.

and I will smite thy bow out of thy left hand, and will cause thine arrows to fall out of thy right hand.

Thou shalt fall upon the mountains of Israel, thou and all thy forces and the people that are with thee. I will give thee unto the ravenous birds of every sort and to the beasts of the field to be devoured. — I will give thee to the ravenous birds of every sort, and to the beasts of the field to be devoured: a great part of his army being slain, should not be buried, but be devoured by birds of prey, and savage beasts; such as eagles and vultures of the former sort, and lions, bears, wolves. These birds of prey and savage beasts are behaving as before, so this doesn’t sound like the Millennium, is it?

One scene about the peace and tranquility of the Millennium is given by Isaiah below:

“The wolf also shall dwell with the lamb, and the leopard shall lie down with the kid; and the calf and the young lion and the fatling together; and a little child shall lead them” Isaiah 11:6.

Thou shalt fall upon the open field, for I have spoken it, saith the Lord God.

And I will send a fire on Magog and among them that dwell confidently in the isles; and they shall know that I am the Lord. — Magog and those that dwell in islands will also be called.

“‘So will I make My holy name known in the midst of My people Israel, and I will not let them pollute My holy name any more; and the nations shall know that I am the Lord, the Holy One in Israel. — and I will not let them pollute my holy name any more: either the nations round about who before blasphemed it, saying that God was not able to deliver his people from such a potent enemy; but now they will not dare to speak any more after this manner.

Behold, it is come, and it is done, saith the Lord God. This is the day whereof I have spoken.

“‘And they that dwell in the cities of Israel shall go forth, and shall set on fire and burn the weapons, both the shields and the bucklers, the bows and the arrows, and the javelins and the spears; and they shall burn them with fire seven years, — “seven years” – some consider this an hyperbolical expression, but it may be very well taken in literally, and the meaning be, that so great will be the quantity of warlike weapons that will be found and gathered, that they will serve for fuel for the space of seven years.

10 so that they shall take no wood out of the field, neither cut down any out of the forests. For they shall burn the weapons with fire, and they shall despoil those that despoiled them, and rob those that robbed them, saith the Lord God.

11 “‘And it shall come to pass on that day that I will give unto Gog a place there of graves in Israel, the valley of the passersby on the east of the sea; and it shall stop the noses of the passersby. And there shall they bury Gog and all his multitude; and they shall call it the Valley of Hamongog [that is, The multitude of Gog]. — and there shall they bury Gog, and all his multitude; all his army, such of it as the fowls and beasts had not devoured, and the bones they had left.

12 And seven months shall the house of Israel be burying them, that they may cleanse the land.

13 Yea, all the people of the land shall bury them; and it shall be to them a day of renown the day that I shall be glorified, saith the Lord God.

14 And they shall separate out men for continual employment, passing through the land, to bury with the passersby those who remain upon the face of the earth to cleanse it. At the end of seven months shall they search.

15 And the passersby who pass through the land, when any seeth a man’s bone, then shall he set up a sign by it till the buriers have buried it in the Valley of Hamongog.

16 And also the name of the city shall be Hamonah [that is, The multitude]. Thus shall they cleanse the land.’

17 “And, thou son of man, thus saith the Lord God: Speak unto every feathered fowl and to every beast of the field: ‘Assemble yourselves and come. Gather yourselves on every side to My sacrifice that I do sacrifice for you, even a great sacrifice upon the mountains of Israel, that ye may eat flesh and drink blood. — “that ye may eat flesh and drink blood” maybe taken metaphorically; perhaps just “Gather from all sides for the sacrificial feast I am preparing for you, a magnificent sacrificial feast on the mountains of Israel.”

18 Ye shall eat the flesh of the mighty and drink the blood of the princes of the earth, of rams, of lambs and of goats, of bullocks, all of them fatlings of Bashan.

19 And ye shall eat fat till ye be full and drink blood till ye be drunken of My sacrifice which I have sacrificed for you.

Temple of Heaven, Beijing Tiantan Park - History, Attractions...

The Temple of Heaven, built without nails, in Central Beijing, where the Emperor annually sacrificed a carefully selected bull to Shangdi (上帝), the Supreme Deity. The religious ritual was meant as an atonement for the nation’s sins; but the ceremony ended in 1911.

20 Thus ye shall be filled at My table with horses and chariots, with mighty men and with all men of war,’ saith the Lord God.

21 “And I will set My glory among the nations, and all the nations shall see My judgment that I have executed and My hand that I have laid upon them. — and all the nations, and there is no exception, shall see my judgment that I have executed, and my hand that I have laid upon them; his glory and greatness, his omniscience and omnipotence. Even the Chinese will come to realize He is the ShangDi (上帝) that they have some knowledge before, but that He has never fully revealed to them.

22 So the house of Israel shall know that I am the Lord their God from that day and forward.

23 And the nations shall know that the house of Israel went into captivity for their iniquity. Because they trespassed against Me, therefore hid I My face from them and gave them into the hand of their enemies; so fell they all by the sword. — Here is the reconciliation between the full house of Israel and all the nations of the world, the full 70 nations of the world under one Sovereign, one God! Hallelujah!

24 According to their uncleanness and according to their transgressions have I done unto them, and hid My face from them. therefore hid I my face from them; took no notice of them, showed them no favour, took no care of them; disregarded their prayers and cries, and removed his presence from them, and all the tokens of it.

So the Targum, “I caused my Shechaniah (or majesty) to remove from them.”

Internal structure of The Hall of Prayer for Good Harvests
Originaly known as “The Hall of Great Sacrifice” to honor ShangDi (上帝), the Hall was renamed to a man-centered “The Hall of Prayer for Good Harvests” in 1751 (when its GDP was estimated to be 35% of the world’s total), and was dedicated to praying for good harvests only, no more an atonement for the nation’s sins, setting the stage for China’s decline and eventually the “Century of Humiliation.”

25 “Therefore thus saith the Lord God: Now will I bring back the captives of Jacob, and have mercy upon the whole house of Israel, and will be jealous for My holy name

26 after they have borne their shame and all their trespasses whereby they have trespassed against Me, when they dwelt safely in their land and none made them afraid.

27 When I have brought them back from the people and gathered them out of their enemies’ lands, and am sanctified in them in the sight of many nations,

28 then shall they know that I am the Lord their God, who caused them to be led into captivity among the nations. But I have gathered them unto their own land, and have left none of them any more there;

29 neither will I hide My face any more from them, for I have poured out My Spirit upon the house of Israel, saith the Lord God.” — for I have poured out my Spirit upon the house of Israel, saith the Lord God; this refers not to the effusion of the Spirit on the day of Pentecost, but to one that is yet to come, when all nations will be converted in the latter day; after which God will no more depart from them, nor shall they depart from him; “Christians” will repent for their adoration and worship of the SUN and come to the full meaning of what full the Oracles of God are; and even the Jews will repent profusely for the One they had pierced; see Zechariah 12:10.

Ezekiel 40

Maybe here is the start for the peace and tranquility of the Millennium? What we have here is a very detailed description of a magnificent physical Temple, somewhat loosely patterned after the Temple of Solomon, only much larger, complete with special living quarters for priests, and an elaborate system of animal sacrifices and other material offerings, along with the faithful observance of New Moons and Sabbaths, the whole picture rivaling the Book of Leviticus itself.

1 In the five and twentieth year of our captivity, at the beginning of the year, on the tenth day of the month, in the fourteenth year after the city was smitten, on the selfsame day the hand of the Lord was upon me, and brought me thither. — in the self-same day the hand of the Lord was upon me, and brought me hither; which is sometimes called the finger of God, or the power of God, this fell upon him, or was laid on him, and impressed his mind and soul; the Targum interprets “the hand of the Lord” the spirit of prophecy.

In the visions of God brought He me into the land of Israel and set me upon a very high mountain, by which there was, as it were, the form of a city on the south. — by, which was as the flame of a city on the south: the prophet in the vision, and as to his view of things coming from Babylon, which lay north of Judea, has a view of the south which is the city of Jerusalem and the Temple.

And He brought me thither, and behold, there was a man whose appearance was like the appearance of brass, with a line of flax in his hand and a measuring reed; and he stood in the gate. — there was a man; one in human form; appearance of brass, a cherub?

And the man said unto me, “Son of man, behold with thine eyes and hear with thine ears, and set thine heart upon all that I shall show thee; for with the intent that I might show them unto thee art thou brought hither. Declare all that thou seest to the house of Israel.”

And behold, a wall on the outside of the house round about, and in the man’s hand a measuring reed of six cubits long by a cubit and a hand breadth. So he measured the breadth of the building, one reed; and the height, one reed. — the cubit is a cubit and a hand’s breadth; to which may be added, that such was the royal cubit at Babylon, where Ezekiel now was, “the royal cubit is larger by three fingers than that which was usually measured with, or the common cubit;”

in this way Rashi and Kimchi understand it; though they make the common cubit to be but five hands’ breadth, or fifteen inches, and this six hands’ breadth, or eighteen inches.

Several modern translation have these measurements in feet and inches: an example is Voice, CSB, CEB, CJB, CEV, EXB, GW, GNT, etc:

VOICE: I saw a wall surrounding the temple. The measuring reed in the man’s hand was about 10½ feet long. He measured the wall and found it to be about 10½ feet thick and 10½ feet high.

Then came he unto the gate which looketh toward the east, and went up the stairs thereof and measured the threshold of the gate, which was one reed broad, and the other threshold of the gate, which was one reed broad.

Ezekiel Temple

And every little chamber was one reed long and one reed broad; and between the little chambers were five cubits; and the threshold of the gate by the porch of the gate within was one reed.

He measured also the porch of the gate within, one reed.

Then measured he the porch of the gate, eight cubits; and the posts thereof, two cubits; and the porch of the gate was inward.

10 And the little chambers of the gate eastward were three on this side and three on that side; they three were of one measure, and the posts had one measure on this side and on that side.

11 And he measured the breadth of the entry of the gate, ten cubits; and the length of the gate, thirteen cubits.

12 The space also before the little chambers was one cubit on this side, and the space was one cubit on that side; and the little chambers were six cubits on this side and six cubits on that side.

13 He measured then the gate from the roof of one little chamber to the roof of another; the breadth was five and twenty cubits, door against door.

14 He made also posts of threescore cubits, even unto the post of the court round about the gate.

15 And from the face of the gate of the entrance unto the face of the porch of the inner gate were fifty cubits.

16 And there were narrow windows to the little chambers, and to their posts within the gate round about and likewise to the arches; and windows were round about within; and upon each post were palm trees.

17 Then he brought me into the outer court, and lo, there were chambers and a pavement made for the court round about; thirty chambers were upon the pavement.

18 And the pavement by the side of the gates over against the length of the gates was the lower pavement.

Ezekiel's Temple and the Christian Gospels — Ezekiel's Temple

19 Then he measured the breadth from the forefront of the lower gate unto the forefront of the inner court from outside, a hundred cubits eastward and northward.

20 And the gate of the outer court that looked toward the north, he measured the length thereof and the breadth thereof.

21 And the little chambers thereof were three on this side and three on that side; and the posts thereof and the arches thereof were the same measure as the first gate; the length thereof was fifty cubits, and the breadth five and twenty cubits.

22 And their windows and their arches and their palm trees were the same measure as the gate that looketh toward the east; and they went up unto it by seven steps, and the arches thereof were before them.

23 And the gate of the inner court was opposite the gate toward the north and toward the east; and he measured from gate to gate a hundred cubits.

24 After that he brought me toward the south, and behold, a gate toward the south; and he measured the posts thereof and the arches thereof according to these measures.

25 And there were windows in it and in the arches thereof round about like those windows; the length was fifty cubits, and the breadth five and twenty cubits.

26 And there were seven steps to go up to it, and the arches thereof were before them; and it had palm trees, one on this side and another on that side, upon the posts thereof.

27 And there was a gate in the inner court toward the south; and he measured from gate to gate toward the south a hundred cubits.

28 And he brought me to the inner court by the South Gate. And he measured the South Gate according to these measures,

29 and the little chambers thereof and the posts thereof and the arches thereof according to these measures. And there were windows in it and in the arches thereof round about; it was fifty cubits long, and five and twenty cubits broad.

30 And the arches round about were five and twenty cubits long, and five cubits broad.

31 And the arches thereof were toward the outer court, and palm trees were upon the posts thereof; and the going up to it had eight steps. — and the going up to it had eight steps, for the inner court rose higher above the outer court than the latter did above the exterior.

32 And he brought me into the inner court toward the east; and he measured the gate according to these measures.

33 And the little chambers thereof and the posts thereof and the arches thereof were according to these measures. And there were windows therein and in the arches thereof round about; it was fifty cubits long, and five and twenty cubits broad.

34 And the arches thereof were toward the outer court; and palm trees were upon the posts thereof, on this side and on that side; and the going up to it had eight steps. — it had eight steps, the symmetry of the entire structure thus being shown once more.

35 And he brought me to the North Gate and measured it according to these measures —

36 the little chambers thereof, the posts thereof and the arches thereof, and the windows to it round about. The length was fifty cubits, and the breadth five and twenty cubits.

37 And the posts thereof were toward the outer court, and palm trees were upon the posts thereof, on this side and on that side; and the going up to it had eight steps. — eight steps again! Eight signifies a new beginning.

38 And the chambers and the entries thereof were by the posts of the gates, where they washed the burnt offering.

39 And in the porch of the gate were two tables on this side and two tables on that side, to slay thereon the burnt offering and the sin offering and the trespass offering.

40 And at the side outside, as one goeth up to the entry of the North Gate, were two tables; and on the other side, which was at the porch of the gate, were two tables.

41 Four tables were on this side and four tables on that side by the side of the gate, eight tables upon which they slew their sacrifices.

42 And the four tables were of hewn stone for the burnt offering, of a cubit and a half long and a cubit and a half broad and one cubit high, upon which also they laid the instruments wherewith they slew the burnt offering and the sacrifice. burnt offering and animal sacrifices will be brought back into practice. Why brought these back for those who preached: “Christ died and the ceremonial laws are therefore obsolete”?

Planted: Ezekiel's Temple Vision

43 And within were hooks, a handbreadth wide, fastened round about; and upon the tables was the flesh of the offering.

44 And outside the inner gate were the chambers of the singers in the inner court, which was at the side of the North Gate, and their prospect was toward the south, one at the side of the East Gate having the prospect toward the north. — Rashi: the chambers of the choristers: the chambers of the Levites who sing; whose duty and privilege it is to sing psalms, hymns and spiritual songs.

Kretzmann: And without the inner gate were the chambers of the singers in the inner court, these two cells being immediately at the entrance of the court, which was at the side of the north gate, and their prospect was toward the south, that is, the one faced in that direction; one at the side of the east gate having the prospect toward the north, so that the two faced each other.

45 And he said unto me, “This chamber whose prospect is toward the south is for the priests, the keepers of the charge of the house.

46 And the chamber whose prospect is toward the north is for the priests, the keepers of the charge of the altar; these are the sons of Zadok among the sons of Levi, who come near to the Lord to minister unto Him.”

47 So he measured the court, a hundred cubits long and a hundred cubits broad, foursquare, and the altar that was before the house.

48 And he brought me to the porch of the house and measured each post of the porch, five cubits on this side and five cubits on that side; and the breadth of the gate was three cubits on this side and three cubits on that side.

49 The length of the porch was twenty cubits and the breadth eleven cubits; and he brought me by the steps by which they went up to it; and there were pillars by the posts, one on this side and another on that side. — all nine chapters 40-48 are devoted mainly to the Grand New Temple in Jerusalem; the City and the land allocation for each tribe following Israel’s return to the Promised Land.

The Laws, statutes and both the weekly and annual Sabbaths will be brought back:

“And in controversy they shall stand in judgment, and they shall judge it according to My judgments; and they shall keep My laws and My statutes in all Mine assemblies, and they shall hallow My Sabbaths,” Ezekiel 44:24.

And despite Ephraim being the birthright holder, the Lord chooses Judah to oversee His Temple ceremony and worship:

“Moreover He refused the tabernacle of Joseph and chose not the tribe of Ephraim, but chose the tribe of Judah, the Mount Zion which He loved,” Psalm 78:68-69.

This Ezekiel Temple and its courts will be five hundred cubits in length with five hundred in breadth: – “875 by 875 feet” — much enlarged compared to Solomon’s or Herod’s to reduce chances of stampedes during festivals when Jerusalem will be flooded by people from all the nations:

“Of this there shall be for the sanctuary five hundred in length with five hundred in breadth, square round about, and fifty cubits round about for the open places thereof,” Ezekiel 45:2.

Various forms of offerings and sacrifices will be reinstated:

“It shall be the prince’s duty to furnish the burnt offerings, grain offerings, and drink offerings, at the feasts, the new moons, and the Sabbaths, all the appointed feasts of the house of Israel: he shall provide the sin offerings, grain offerings, burnt offerings, and peace offerings, to make atonement on behalf of the house of Israel,” Ezekiel 45:17.

And the Ephraimites, who had been stiffed-necked all along, will no longer be quarreling with Judah pertaining as to how many days to observe Passover, a composite feast of seven days where only the unleavened is to be eaten:

“‘In the first month, on the fourteenth day of the month, ye shall have the Passover, a feast of seven days. Unleavened bread shall be eaten,” Leviticus 45:21.

And about the Law, both written and case Laws:

Judah is My lawgiver, Psalm 108:8.

Ezekiel (Ch 37-38)

•September 27, 2021 • 1 Comment

Chapter 37 contains a prophecy of both the Jews’ and Israelites’ return from captivity to their own land; of the union of the each tribes with one another; their restoration is represented by a vision of dry bones made alive. But is this the start of the Millennium?

Ezekiel 37

1 The hand of the Lord was upon me, and carried me out in the Spirit of the Lord and set me down in the midst of the valley which was full of bones, — More on Ezekiel 23:25:

And I will set My jealousy against thee, and they shall deal furiously with thee. They shall take away thy nose and thine ears, and thy remnant shall fall by the sword. They shall take thy sons and thy daughters, and thy residue shall be devoured by the fire. Ezekiel 23:25

Since Ezekiel’s message is for the endtime and meant for the house of Israel, which is the United States and its European allies and “thy remnant shall fall by the sword . . . and thy residue shall be devoured by the fire”: — if those remnant are put to the sword, and any residue be put to the fire, then no more will be left, reaffirming there is no place of safety for those hopeful to have one. Second, any living will have to be resurrected from the valley of dry bones!!!

and caused me to pass by them round about; and behold, there were very many in the open valley, and lo, they were very dry.

And He said unto me, “Son of man, can these bones live?” And I answered, “O Lord God, Thou knowest.” — and he said unto me, son of man, can these bones live?… is there any probability to believe they shall live?

Again He said unto me, “Prophesy upon these bones and say unto them, ‘O ye dry bones, hear the word of the Lord.

Thus saith the Lord God unto these bones: Behold, I will cause breath to enter into you, and ye shall live.

And I will lay sinews upon you, and will bring up flesh upon you, and cover you with skin, and put breath in you, and ye shall live; and ye shall know that I am the Lord.’” — God said of these dry bones “and ye shall know that I am the Lord” implying that they never have known God, despite many claim they were Christians. How could they? In today’s world, no less than 99.99 percent of professing Christians don’t even know the basic tenet of understanding the Oracles of God!

So I prophesied as I was commanded; and as I prophesied,there was a noise, and behold, a shaking, and the bones came together, bone to his bone.

And when I beheld, lo, the sinews and the flesh came up upon them, and the skin covered them above; but there was no breath in them.

Then said He unto me, “Prophesy unto the wind. Prophesy, son of man, and say to the wind, ‘Thus saith the Lord God: Come from the four winds, O breath, and breathe upon these slain, that they may live.’” — and breathe upon these slain, that they may live; and so looked comely and beautiful, as in the proper form of men; and yet no principle of spiritual life in them; but, like Adam’s body, of the earth, earthly, and breathless, till the Lord stirred up their spirits.

10 So I prophesied as He commanded me, and the breath came into them, and they lived and stood up upon their feet, an exceeding great army.

11 Then He said unto me, “Son of man, these bones are the whole house of Israel. Behold, they say, ‘Our bones are dried and our hope is lost. We are cut off from our parts.’ — these bones are the whole house of Israel; this phrase takes in the ten tribes, as well as the two tribes of Benjamin and Judah inclusive.

12 Therefore prophesy and say unto them, ‘Thus saith the Lord God: Behold, O My people, I will open your graves and cause you to come up out of your graves, and bring you into the land of Israel.

13 And ye shall know that I am the Lord when I have opened your graves, O My people, and brought you up out of your graves, — in God’s view, death is both unclean and an insignificant event, hence He forbid His priests to come near the dead among his people; and the high priests, not even near their parents if they died (Ezekiel 21:1-11).

14 and shall put My Spirit in you and ye shall live, and I shall place you in your own land. Then shall ye know that I, the Lord, have spoken it and performed it, saith the Lord.’”

15 The word of the Lord came again unto me, saying,

16 “Moreover, thou son of man, take thee one stick and write upon it, ‘For Judah and for the children of Israel, his companions.’ Then take another stick and write upon it, ‘For Joseph, the stick of Ephraim, and for all the house of Israel, his companions.’ — earlier in Ezekiel 36:1 these are described as “the mountain of Israel;” this prophecy is concerning the top dog, the United States and its European allies, UK and France. And in Ezekiel 36:4  “the hills, to the rivers and to the valleys;” these are the hills: Ireland, Switzerland and the Scandinavian countries: Denmark, Norway, and Sweden, Finland, and Iceland; and the valleys, the low countries: Belgium, the Netherlands, and Luxembourg.

17 And join them one to another into one stick, and they shall become one in thine hand.

18 And when the children of thy people shall speak unto thee, saying, ‘Wilt thou not show us what thou meanest by these?’

19 say unto them, ‘Thus saith the Lord God: Behold, I will take the stick of Joseph, which is in the hand of Ephraim, and the tribes of Israel, his fellows, and will put them with him, even with the stick of Judah, and make them one stick, and they shall be one in Mine hand.’ — Rashi: Behold I will take the stick, etc: that they shall no longer be two kingdoms.

20 And the sticks whereon thou writest shall be in thine hand before their eyes.

21 “And say unto them, ‘Thus saith the Lord God: Behold, I will take the children of Israel from among the nations whither they have gone, and will gather them on every side and bring them into their own land.

22 And I will make them one nation in the land upon the mountains of Israel, and one King shall be King to them all; and they shall be no more two nations, neither shall they be divided into two kingdoms any more at all. — and I will make them one nation in the land upon the mountains of Israel, as they were during the times of David and Solomon.

23 Neither shall they defile themselves any more with their idols, nor with their detestable things, nor with any of their transgressions; but I will save them out of all their dwelling places wherein they have sinned and will cleanse them. So shall they be My people, and I will be their God.

24 “‘And David My servant shall be King over them, and they all shall have one Shepherd. They shall also walk in My judgments, and observe My statutes, and do them. — is this the Millennium? Is this the same King David of ancient Israel? Or is he an equivalent? and they shall also walk in my judgments, and keep my statutes, and do them; these would definitely include the statutes and ordinances of the “ceremonial law” since the temple will be rebuilt; and which the Jews, who control Jerusalem, will be performing them for and on behalf of all the nations.

25 And they shall dwell in the land that I have given unto Jacob My servant, wherein your fathers have dwelt; and they shall dwell therein, even they and their children and their children’s children for ever. And My servant David shall be their Prince for ever. — is this the Millennium? Is this the same King David of ancient Israel? Or is he an equivalent?

26 Moreover I will make a covenant of peace with them. It shall be an everlasting covenant with them. And I will place them, and multiply them, and will set My sanctuary in the midst of them for evermore. — the Temple will be rebuilt, and the Glory of God, the Shekhinah will return.

27 My tabernacle also shall be with them. Yea, I will be their God, and they shall be My people.

28 And the nations shall know that I, the Lord, do sanctify Israel, when My sanctuary shall be in the midst of them for evermore.’” — the Temple will be filled with the Glory of God; the Shekhinah will be manifested before all the nations of the world.

The question is, is this the start of the Millennium? If so the Messiah (Christ) and His saints would rule the world, some over one city, others ten. Would these saints be given power over the nations, yet so powerless with no power to allow their subjects to go all the way to Jerusalem and mount a war against its inhabitants? And all the way from east Asia, say the Philippines? It seems inconceivable. Or, is “My servant David” a form of John the Baptist that came in the name of Elijah? Your thoughts?

“Behold, I will send you Elijah the prophet before the coming of the great and dreadful day of the Lord. Malachi 4:5

Ezekiel 38

1 And the word of the Lord came unto me, saying,

“Son of man, set thy face against Gog, in the land of Magog, the chief prince of Meshech and Tubal, and prophesy against him — these are the sons of Japheth.

The sons of Japheth: Gomer, and Magog, and Madai, and Javan, and Tubal, and Meshech, and Tiras. Genesis 10:2

and say, ‘Thus saith the Lord God: Behold, I am against thee, O Gog, the chief prince of Meshech and Tubal. — Gog is not a name among the sons of Japheth, but designated as the chief prince of Meshech and Tubal.

And I will turn thee back and put hooks into thy jaws, and I will bring thee forth and all thine army, horses and horsemen, all of them clothed with all sorts of armor, even a great company with bucklers and shields, all of them handling swords;

Persia, Ethiopia, and Libya with them, all of them with shield and helmet;

Gomer and all his bands; the house of Togarmah of the north quarters and all his bands — and many people with thee; in Revelation 20:8 Gog and Magog shall go out to deceive the nations to the four quarters of the earth, but here, Persia is from the extreme east; Ethiopia or Cush is from the south; Libya or Put represent the extreme west; and the house of Togarmah was in the extreme north.

“‘Be thou prepared and prepare for thyself, thou and all thy company that are assembled unto thee, and be thou a guard unto them. — TLB translation says “Be prepared! Stay mobilized. You are their leader, Gog!”

After many days thou shalt be visited. In the latter years thou shalt come into the land that is brought back from the sword and is gathered out of many people, against the mountains of Israel, which have been always waste; but it is brought forth out of the nations and they shall dwell safely, all of them. — led by Gog and Magog ‘in the latter years,’ numerous Gentile nations will launch an attack on Israel from all directions.

Thou shalt ascend and come like a storm. Thou shalt be like a cloud to cover the land, thou and all thy troops, and many people with thee.

10 “‘Thus saith the Lord God: It shall also come to pass that at the same time shall things come into thy mind, and thou shalt think an evil thought; — at the same time shall things come into thy mind; when the Israelites shall be in their own land, dwelling in great security; and when Gog and his companions shall make preparation to enter into their land suddenly and furiously; and thou shall think an evil thought, many schemes and devices; to do mischief, to dispossess them of their land, and plunder their substance.

11 and thou shalt say, “I will go up to the land of unwalled villages; I will go to them that are at rest, who dwell safely, all of them dwelling without walls and having neither bars nor gates”—

12 to take a spoil and to take a prey, to turn thine hand upon the desolate places that are now inhabited and upon the people who are gathered out of the nations, who have gotten cattle and goods, who dwell in the midst of the land. — this will be against Gog as the chief of numerous rebellious nations with him.

13 Sheba and Dedan and the merchants of Tarshish, with all the young lions thereof, shall say unto thee, “Art thou come to despoil us? Hast thou gathered thy company to take a prey, to carry away silver and gold, to take away cattle and goods, to take a great spoil?”’

14 “Therefore, son of man, prophesy and say unto Gog, ‘Thus saith the Lord God: On that day when My people of Israel dwelleth safely, shalt thou not know it?

15 And thou shalt come from thy place out of the north parts, thou and many people with thee, all of them riding upon horses, a great company and a mighty army. — in relation to Jerusalem, Gog is indicated as coming from the north. So who is Gog? The two major nations lying north of Jerusalem are Turkey and Russia. Joel Richardson says Gog is Turkey; whereas most CoG Communities say it’s Russia. So who is Gog? We’ll see.

16 And thou shalt come up against My people of Israel as a cloud to cover the land. It shall be in the latter days; and I will bring thee against My land, that the nations may know Me when I shall be sanctified in thee, O Gog, before their eyes.

17 “‘Thus saith the Lord God: Art thou he of whom I have spoken in old times by My servants the prophets of Israel who prophesied in those days many years that I would bring thee against them? — besides Ezekiel, there maybe other prophet/s that spoke of Gog, hence the plural form of prophet.

18 And it shall come to pass at the same time when Gog shall come against the land of Israel, saith the Lord God, that My fury shall come upon My face.

19 For in My jealousy and in the fire of My wrath have I spoken: Surely on that day there shall be a great shaking in the land of Israel,

20 so that the fishes of the sea, and the fowls of the heaven, and the beasts of the field, and all creeping things that creep upon the earth, and all the men that are upon the face of the earth, shall shake at My presence; and the mountains shall be thrown down and the steep places shall fall, and every wall shall fall to the ground. — this scene appears like when the Israelites were at the foot of Mount Sinai when the mountain quaked with thunders getting louder and louder, with Moses speaking with God in a voice also like thunders that frightened the Israelites as written in Exodus 19:18–20.

21 And I will call for a sword against him throughout all My mountains, saith the Lord God. Every man’s sword shall be against his brother. — this will be a civil war within Gog, with numerous nations warring against each other.

22 And I will plead against him with pestilence and with blood; and I will rain upon him and upon his troops and upon the many people that are with him an overflowing rain, and great hailstones, fire, and brimstone. — and I will plead against him with pestilence and with blood…. not only the sword against the confederates and the sword of Gog’s soldiers against one another; but the Lord himself would plead with him by his judgments, or take vengeance on him;

as the Targum; and send a pestilence in his army, which should destroy vast numbers of it; as the army of Sennacherib was destroyed by one when before Jerusalem; and make a great slaughter among them by that and other judgments.

23 Thus will I magnify Myself and sanctify Myself, and I will be known in the eyes of many nations; and they shall know that I am the Lord.’ — “and I will be known in the eyes of many nations” could be known by another term, “the times of the Gentiles.” Lastly, “and they shall know that I am the Lord,” (together with verse 16 “that the nations may know Me”) indicate they’ll have learned their lessons and survive at the end.

Ezekiel (Ch 35-36)

•September 26, 2021 • Leave a Comment

Chapter 35 is a prophecy of the destruction of Edom, who had threatened Israel, their hatred and slaughter of the Israelites, the cause of their downfall.

But who is Edom/Esau today? The answer lies in the book of Obadiah; and Jonathan Targum identifies Esau (Sepharad of the Southland identified) as Spain! Obadiah 1:20; the Targums identified Sepharad with Spain, hence, Spanish Jews are called Sephardim;

Wikipedia: Sepharad (/sɛfəræd/or səˈfɛərəd/ Hebrew: סְפָרַד Sp̄āraḏ; also Sefarad, Sephared, Sfard) is the Hebrew name for Spain. A place called Sepharad, probably referring to Sardis in Lydia (‘Sfard’ in Lydian), in the Book of Obadiah (Obadiah 1:20, 6th century BC) of the Hebrew Bible. The name was later applied to Spain.

Ezekiel 35

1 Moreover the word of the Lord came unto me, saying,

“Son of man, set thy face against Mount Seir, and prophesy against it — Son of man set thy face against Mount Seir…. which had its name from Seir the Horite, who first possessed it; and was succeeded in it by Esau and his posterity, the Edomites; (Genesis 36:8; Deuteronomy 2:12), so that the country of Edom or Idumea is intended here.

and say unto it, ‘Thus saith the Lord God: Behold, O Mount Seir, I am against thee, and I will stretch out Mine hand against thee, and I will make thee most desolate. — behold, O Mount Seir, I am against thee: not the face of the prophet only, but the face of God himself was against them; and a terrible thing it is for any to have God to be against them, whether a nation, or a particular person.

The Targum is, “behold, I send my fury upon thee.”

I will lay thy cities waste, and thou shalt be desolate, and thou shalt know that I am the Lord.

Because thou hast had a perpetual hatred and hast shed the blood of the children of Israel by the force of the sword in the time of their calamity, in the time that their iniquity had an end, — because thou hast had a perpetual hatred…. there was an old grudge and enmity subsisting in the posterity of Esau against the posterity of Jacob, because the latter supplanted the former, and got the birthright and blessing from him;

— it started on the part of Edom led to their refusal of permission for Israel to pass through their land (Numbers 20:14-21); to their invasion of Judah (2 Chronicles 20:10-11); to their aiding Nebuchadnezzar in the overthrow of Jerusalem (Obadiah 1:1,13); and to the outrageous conduct of the Herods and their dynasty against the purposes of God during the days of Christ and the apostles. The Herods were Idumaeans (Edomites). See much more on this in Isaiah 34-43;

(More at the end: “Rage it, rage it, even to the foundation thereof!” Psalm 137:7)

therefore, as I live, saith the Lord God, I will prepare thee for blood, and blood shall pursue thee. Since thou hast not hated blood, even blood shall pursue thee. since thou hast loved cruelty, and taken delight in shedding blood, vengeance and slaughter shall pursue thee, and thou shalt fall into the hands of those that will be as eager to shed blood.

Thus will I make Mount Seir most desolate, and cut off from it him that passeth out and him that returneth.

And I will fill his mountains with his slain men; in thy hills and in thy valleys and in all thy rivers shall they fall that are slain with the sword.

I will make thee perpetual desolations, and thy cities shall not return; and ye shall know that I am the Lord. — thy cities shall not be restored to thee again. This was exactly fulfilled; for the Nabatheans having driven the Edomites out of their ancient habitations, in the time of the Babylonish captivity, they settled themselves in the southern part of Judea, where they were afterward conquered by Hyrcanus, and obliged to embrace the Jewish religion, and so became at length incorporated with that nation. 

Petra Jordan Facts, Ancient City Of Petra Jordan, History - Journey To Egypt
The Ruins of Petra, Jordan – a “Place of Safety” for CoG Communities

10 “‘Because thou hast said, “These two nations and these two countries shall be mine and we will possess it,” though the Lord was there, — “these two nations and these two countries …” these are Israel and Judah, the covenant people after the division of the monarchy, the northern and the southern Israels, Samaria and Jerusalem.

11 therefore, as I live, saith the Lord God, I will even do according to thine anger and according to thine envy which thou hast used out of thy hatred against them; and I will make Myself known among them when I have judged thee.

— Petra, “when I have judged thee” is now described as:

“This land, once so rich in flocks and herds, so mighty in its rock-hewn cities, so extensive in its commercial activities, so renowned for the architectural splendor of its palaces, is now a desolated and deserted wilderness. Its whole population consists of three or four miserable tiny villages. No merchant would now dare to enter it; its highways are unused; its cities are in ruins.”

12 And thou shalt know that I am the Lord, and that I have heard all thy blasphemies which thou hast spoken against the mountains of Israel, saying, “They are laid desolate. They are given us to consume.” — and that I have heard all thy blasphemies which thou hast spoken against the mountains of Israel; the people of Israel and Judah literally, and the churches and people of God figuratively.

13 Thus with your mouth ye have boasted against Me and have multiplied your words against Me; I have heard them.

14 Thus saith the Lord God: When the whole earth rejoiceth, I will make thee desolate.

15 As thou didst rejoice at the inheritance of the house of Israel because it was desolate, so will I do unto thee. Thou shalt be desolate, O Mount Seir, and all Edom, even all of it; and they shall know that I am the Lord.’” — even though all Edom were made desolate, they survive at the end: “and they shall know that I am the Lord.”

and finally the remnant of Israel are not lead into “a place of safety” but are to be “scattered into all the winds.”

. . . and I will execute judgments in thee [Israel], and the whole remnant of thee will I scatter into all the winds Ezekiel 5:10.

~~~

The Lord was asked to remember in Psalms 137 against the Edomites who had asked that Jerusalem be razed to its foundations:

7 Remember, O Lord, the children of Edom in the day of Jerusalem’s fall, who said, “Raze it, raze it, even to the foundation thereof!” Psalms 137:7

To call for the razing of the Temple of God “Raze it, raze it, even to the foundation thereof!” is a heavy crime against the God of the Most High. The Most High dwelled there and these Edomites cheered the Babylonians to burn it down? Madness! Just Madness!!!

Ezekiel 36

1 “Also, thou son of man, prophesy unto the mountains of Israel and say, ‘Ye mountains of Israel, hear the word of the Lord. — “the mountain of Israel;” this prophecy is concerning the desolations of the United States, UK and France. And Israel is judged in relation to the “nations” used 15 times in this chapter alone.

Thus saith the Lord God: Because the enemy hath said against you, “Aha, even the ancient high places are ours in possession,”’ — because the enemy had said against you, aha: rejoicing at the calamity of Israel, particularly the Edomites or Idumeans, as in the preceding chapter; and who are chiefly meant; and also the Ammonites and Tyrians, Ezekiel 25:3.

therefore prophesy and say, ‘Thus saith the Lord God: Because they have made you desolate and swallowed you up on every side, that ye might be a possession unto the residue of the nations, and ye are taken up on the lips of talkers and are an infamy (gossip: the state of being well known for some bad quality or deed; or scoffing) of the people, — and swallowed you up on every side; all their neighbours, being their enemies, were like ravenous beasts of prey, gaping upon them with their mouths; and, observing the low condition into which they were brought by the king of Babylon, helped forward the destruction; and everyone shared in the spoil and plunder nearest to them they could conveniently come at.

therefore, ye mountains of Israel, hear the word of the Lord God. Thus saith the Lord God to the mountains and to the hills, to the rivers and to the valleys, to the desolate wastes and to the cities that are forsaken, which became a prey and derision to the residue of the nations that are round about” — before only the mountains are spoken to, but now, “and to the hills, to the rivers and to the valleys;” these are the hills: Ireland, Switzerland and the Scandinavian countries: Denmark, Norway, and Sweden, Finland, and Iceland; and the valleys, the low countries: Belgium, the Netherlands, and Luxembourg.

therefore thus saith the Lord God: Surely in the fire of My jealousy have I spoken against the residue of the nations and against all Edom, who have appointed My land into their possession with the joy of all their heart, with despiteful minds, to cast it out as a prey.’ — to those neighbouring nations that “have appointed My land into their possession” were Ammon, Moab and Edom.

— with the joy of all their heart, with despiteful minds, to cast it out for a prey; with the utmost joy they joined Nebuchadnezzar’s army when he invaded the land of Judea and besieged Jerusalem, out of pure malice and spite to the people of the Jews, in order to eject them from the possession of their land, that it might become a prey to them; see Psalms 137:7.

Prophesy therefore concerning the land of Israel, and say unto the mountains and to the hills, to the rivers and to the valleys, ‘Thus saith the Lord God: Behold, I have spoken in My jealousy and in My fury, because ye have borne the shame of the nations. — because ye have borne the shame of the nations; their reproaches and scoffings, their injuries and abuses; all which were resented by the Lord.

Therefore thus saith the Lord God: I have lifted up Mine hand. Surely the nations who are about you, they shall bear their shame. — Gill: surely the nations that are about you, they shall bear their shame; the punishment of their shame; that which is justly due to them for reproaching and putting to shame the people of God:

— or they shall be a laughing stock to others, and be reproached and derided themselves, and so be paid in their own coin; a just retaliation this for their treatment of the Jews.

“‘But ye, O mountains of Israel, ye shall shoot forth your branches and yield your fruit to My people of Israel, for they are at hand to come. — ye shall shoot forth your branches; that is, the trees that grew upon them should; the vines, and the olive trees, planted on hills and mountains;

— these could be their colonies: Canada, Australia, New Zealand, South Africa; American Samoa, Guam, the Northern Mariana Islands, Puerto Rico, and the Virgin Islands (US); Anguilla, Bermuda, Cayman Islands, Falkland Islands, Gibraltar, Virgin Islands (UK); Guadeloupe, Martinique, French Guiana, Mayotte, Réunion (France).

For behold, I am for you, and I will turn unto you, and ye shall be tilled and sown.

10 And I will multiply men upon you, all the house of Israel, even all of it; and the cities shall be inhabited and the wastes shall be built. — all the house of Israel, all the tribes of Israel, the ten tribes as well as the other two: for all shall return.

11 And I will multiply upon you man and beast, and they shall increase and bring fruit. And I will settle you according to your old estates, and will do better unto you than at your beginnings; and ye shall know that I am the Lord. — and I will settle you after your old estates; that is, you mountains shall be inhabited by those that formerly dwelt in you, and you shall be enjoyed by your right owners; by those who had you in possession from the beginning, from the times of Joshua; by whom you were settled on them by lot, according to their several tribes. These land to be taken back from Ammon, Moab and Edom (verse 5 above).

12 Yea, I will cause men to walk upon you, even My people Israel; and they shall possess thee and thou shalt be their inheritance, and thou shalt no more henceforth bereave them of men.

13 Thus saith the Lord God: Because they say unto you, “Thou, land, devourest up men and hast bereaved thy nations,”

14 therefore thou shalt devour men no more, neither bereave thy nations any more, saith the Lord God.

15 Neither will I cause men to hear in thee the shame of the nations any more, neither shalt thou bear the reproach of the people any more, neither shalt thou cause thy nations to fall any more, saith the Lord God.’” — neither shalt thou cause thy nations to fall any more, saith the Lord God; by famine, sword, or pestilence, or any other judgment caused by sin:

— or, “thou shalt not bereave” as the marginal reading is; and which the Targum and many versions follow: now what is here promised, in this and the preceding verse, had not its full accomplishment upon the Jews’ return from the Babylonish captivity.

CSB says: I will no longer allow the insults of the nations to be heard against you, and you will not have to endure the reproach of the peoples anymore; you will no longer cause your nation to stumble. This is the declaration of the Lord God.’”

16 Moreover the word of the Lord came unto me, saying,

17 “Son of man, when the house of Israel dwelt in their own land, they defiled it by their own way and by their doings; their way was before Me as the uncleanness of a removed woman.

18 Therefore I poured My fury upon them for the blood that they had shed upon the land and for their idols wherewith they had polluted it.

19 And I scattered them among the nations, and they were dispersed through the countries; according to their way and according to their doings I judged them.

20 And when they entered unto the nation whither they went, they profaned My holy name, when they said to them, ‘These are the people of the Lord, and are gone forth out of His land.’ — they profaned my holy name; by their pornography, sexual immorality and promiscuity, by their violation of both tables of laws; by their gun violence, family breakdown, homelessness;

— and by their use of dirty language while invoking God’s name, whereby they gave the Gentiles an occasion to reproach them, their religion, and their God, Romans 2:24; and not only do they promote LGBTQIA and other filths at home but being hubris and narcissistic they also try to promote and enforce them onto other nations; in doing so “they profaned My holy name,” so said the Lord!

21 But I had pity for Mine holy name, which the house of Israel had profaned among the nations whither they went.

22 “Therefore say unto the house of Israel, ‘Thus saith the Lord God: I do not this for your sakes, O house of Israel, but for Mine holy name’s sake, which ye have profaned among the nations whither ye went.

23 And I will sanctify My great name which was profaned among the nations, which ye have profaned in the midst of them; and the nations shall know that I am the Lord, saith the Lord God, when I shall be sanctified in you before their eyes.

24 For I will take you from among the nations and gather you out of all countries, and will bring you into your own land.

25 “‘Then will I sprinkle clean water upon you, and ye shall be clean; from all your filthiness and from all your idols will I cleanse you.

26 A new heart also will I give you and a new spirit will I put within you; and I will take away the stony heart out of your flesh, and I will give you a heart of flesh.

27 And I will put My Spirit within you and cause you to walk in My statutes, and ye shall keep My judgments and do them.

28 And ye shall dwell in the land that I gave to your fathers; and ye shall be My people, and I will be your God. and ye shall dwell in the land which I gave to your fathers…. not only shall be brought into it, but shall inhabit it, and continue there, and that in great safety and plenty; because this land between the rivers is the gift of God, and what he gave to their fathers, Abraham, Isaac, and Jacob, by promise so long ago, and to their seed.

29 “‘I will also save you from all your uncleannesses; and I will call for the corn and will increase it, and lay no famine upon you.

30 And I will multiply the fruit of the tree and the increase of the field, that ye shall receive no more reproach of famine among the nations.

31 Then shall ye remember your own evil ways and your doings that were not good, and shall loathe yourselves in your own sight for your iniquities and for your abominations.

32 Not for your sakes do I this, saith the Lord God, be it known unto you: be ashamed and confounded for your own ways, O house of Israel!

33 “‘Thus saith the Lord God: In the day that I shall have cleansed you from all your iniquities I will also cause you to dwell in the cities, and the wastes shall be rebuilt.

34 And the desolate land shall be tilled, whereas it lay desolate in the sight of all that passed by.

35 And they shall say, “This land that was desolate has become like the Garden of Eden, and the waste and desolate and ruined cities have become fortified and are inhabited.”

36 Then the nations that are left round about you shall know that I, the Lord, build the ruined places and plant that which was desolate. I, the Lord, have spoken it, and I will do it.’

37 “Thus saith the Lord God: I will yet for this be inquired of by the house of Israel to do it for them. I will increase them with men like a flock.

38 As the holy flock, as the flock of Jerusalem in her solemn feasts, so shall the waste cities be filled with flocks of men; and they shall know that I am the Lord.” — God said of the house of Israel that “they shall know that I am the Lord” this implies that they do not know God at this time, despite many claim they are Christians, a few pretentious at best. How could they? In today’s world of professing Christians, no less than 99.99 percent of them don’t even know the Oracles of God!

Ezekiel (Ch 33-34)

•September 25, 2021 • Leave a Comment

Chapter 33 specifies the duty of watchman, and the people’s sins; contains a vindication of the justice of God; a threatening of destruction to those who remained in the land after the taking of the city; and in chapter 34, a hypocrisy of the prophets who choose to feed themselves than feed the flock. Earlier, we have established that although Ezekiel has his face set toward Jerusalem, this prophecy is meant for the house of Israel at the endtime “for many years to come” (Ezekiel 12:27). And, here, remember, the house of Israel is primarily the United States of America, and secondarily its European allies. . .

Ezekiel 33

1 Again the word of the Lord came unto me, saying,

“Son of man, speak to the children of thy people and say unto them: ‘When I bring the sword upon a land, if the people of the land take a man from their borders and set him as their watchman, and

if when he seeth the sword come upon the land, he blow the trumpet and warn the people, — if what he seeth the sword come upon the land…. or those that kill with the sword, as the Targum; as soon as he observes a body of armed men, more or less, marching towards the borders of the land with a manifest intention to enter and invade it;

he blow the trumpet, and warn the people; warn the people by blowing the trumpet, the signal agreed on; by which they would understand that an enemy was at hand, or danger near; or warn them by word of mouth, as well as by the trumpet, where he could do it, and when it was necessary.

then whosoever heareth the sound of the trumpet and taketh not warning, if the sword come and take him away, his blood shall be upon his own head.

He heard the sound of the trumpet and took not warning: his blood shall be upon him. But he that taketh warning shall deliver his soul.

But if the watchman see the sword come and blow not the trumpet, and the people be not warned, if the sword come and take any person from among them, he is taken away in his iniquity; but his blood will I require at the watchman’s hand.’ — but his blood will I require at the watchman’s hands; he shall be punished for not doing his duty, for not giving the due warning of danger, on which account the man was surprised with the enemy, and taken away unawares; and therefore his death shall be laid to the watchman, and he must be answerable for it.

“So thou, O son of man, I have set thee as a watchman unto the house of Israel. Therefore thou shalt hear the word at My mouth and warn them from Me. — this prophecy is meant for the house of Israel which is primarily the United States of America, and secondarily its European allies.

When I say unto the wicked, ‘O wicked man, thou shalt surely die,’ if thou dost not speak to warn the wicked from his way, that wicked man shall die in his iniquity; but his blood will I require at thine hand

Nevertheless, if thou warn the wicked of his way to turn from it, if he do not turn from his way, he shall die in his iniquity; but thou hast delivered thy soul.

10 “Therefore, O thou son of man, speak unto the house of Israel: ‘Thus ye speak, saying, “If our transgressions and our sins be upon us and we pine away in them, how should we then live?”’ — “the house of Israel” reemphasizing a prophecy which is meant for the United States and its European allies.

11 Say unto them: ‘As I live, saith the Lord God, I have no pleasure in the death of the wicked, but that the wicked turn from his way and live. Turn ye, turn ye from your evil ways; for why will ye die, O house of Israel?’

12 Therefore, thou son of man, say unto the children of thy people: ‘The righteousness of the righteous shall not deliver him in the day of his transgression. As for the wickedness of the wicked, he shall not fall thereby in the day that he turneth from his wickedness, neither shall the righteous be able to live for his righteousness in the day that he sinneth.’

13 When I shall say to the righteous that he shall surely live, if he trust to his own righteousness and commit iniquity, all his righteousnesses shall not be remembered; but for his iniquity that he hath committed, he shall die for it.

14 Again, when I say unto the wicked, ‘Thou shalt surely die,’ if he turn from his sin and do that which is lawful and right,

15 if the wicked restore the pledge, give back that which he had robbed, walk in the statutes of life without committing iniquity, he shall surely live; he shall not die.

16 None of his sins that he hath committed shall be mentioned unto him. He hath done that which is lawful and right: he shall surely live.

17 “Yet the children of thy people say, ‘The way of the Lord is not equal.’ But as for them, their way is not equal. — instead of turning away and by repenting, the house of Israel complains even further; that His way is not according to the rules of justice and equity.

18 When the righteous turneth from his righteousness and committeth iniquity, he shall even die thereby.

19 But if the wicked turn from his wickedness and do that which is lawful and right, he shall live thereby.

20 Yet ye say, ‘The way of the Lord is not equal.’ O ye house of Israel, I will judge you every one according to his ways.” — still obstinately persisting in their false charges as their complaint repeated: “The way of the Lord is not equal.”

21 And it came to pass in the twelfth year of our captivity, in the tenth month, on the fifth day of the month, that one who had escaped out of Jerusalem came unto me, saying, “The city is smitten!” — that one that had escaped out of Jerusalem came unto me; as it was foretold and promised he should, Ezekiel 24:26;

saying, the city is smitten; the city of Jerusalem; the walls were broken down, the houses burnt, and the whole destroyed.

22 Now the hand of the Lord was upon me in the evening before he that had escaped came, and He had opened my mouth until he came to me in the morning; and my mouth was opened, and I was no more dumb. — and had opened my mouth, until he came to me in the morning; the hand of the Lord, or the power of the Lord, had done it, as he promised he would, Ezekiel 3:26-27 so that he spoke freely and boldly.

23 Then the word of the Lord came unto me, saying,

24 “Son of man, they that inhabit those wastes in the land of Israel speak, saying, ‘Abraham was one, and he inherited the land. But we are many; the land is given us for inheritance.’ — ‘if Abraham, being only a single person, had the whole region of Judea and Samaria (and more) given him, there is much greater reason to conclude, that God will preserve the possession of more to us, who are a numerous part of Abraham’s posterity.’

25 Therefore say unto them, ‘Thus saith the Lord God: Ye eat meat with the blood, and lift up your eyes toward your idols, and shed blood. And shall ye possess the land?

26 Ye stand upon your sword, ye work abomination, and ye defile every one his neighbor’s wife. And shall ye possess the land?’

27 Say thou thus unto them, ‘Thus saith the Lord God: As I live, surely they that are in the wastes shall fall by the sword, and him that is in the open field will I give to the beasts to be devoured, and they that are in the forts and in the caves shall die of the pestilence. — and him that is in the open field will I give to the beasts to be devoured; a reminder of “so will I send upon you famine and evil beasts” Ezekiel 5:17.

Ezekiel 14:21“For thus saith the Lord God: How much more when I send My four sore judgments upon Jerusalem — the sword and the famine and the noisome beast and the pestilence — to cut off from it man and beast?

28 For I will lay the land most desolate, and the pomp of her strength shall cease; and the mountains of Israel shall be desolate, that none shall pass through.

29 Then shall they know that I am the Lord, when I have laid the land most desolate because of all their abominations which they have committed.’

30 “Also, thou son of man, the children of thy people still are talking against thee by the walls and in the doors of the houses, and speak one to another, every one to his brother, saying, ‘Come, I pray you, and hear what is the word that cometh forth from the Lord.’ — every man to his brother, saying, come, l pray you, and hear what is the word that cometh forth from the Lord; let us go perhaps we shall hear some new thing, which may be pleasing.

31 And they come unto thee as the people cometh, and they sit before thee as My people, and they hear thy words, but they will not do them; for with their mouth they show much love, but their heart goeth after their covetousness.

32 And lo, thou art unto them as a very lovely song of one that hath a pleasant voice and can play well on an instrument; for they hear thy words, but they do them not.

33 And when this cometh to pass — lo, it will come — then shall they know that a prophet hath been among them.” — and when this cometh to pass…. the prophecy before delivered out, concerning the desolations in the land of Israel, by the sword, pestilence, and wild beasts;

lo, it will come; whatever is predicted by the Lord; in the mouth of his prophets, certainly comes to pass: then shall they know that a prophet hath been among them; that Ezekiel was one such prophet by the exact accomplishment of his predictions.

Ezekiel 34

In this chapter, God is against the shepherds of Israel, that is, their rulers, both in church and state, are called to an account, as having been very much accessory to the sin and ruin of Israel, by their neglect of the duties of their station.

1 And the word of the Lord came unto me, saying,

“Son of man, prophesy against the shepherds of Israel, prophesy and say unto them, ‘Thus saith the Lord God unto the shepherds: Woe be to the shepherds of Israel that feed themselves! Should not the shepherds feed the flocks?

Ye eat the fat, and ye clothe yourselves with the wool, ye kill the ones that are fed; but ye feed not the flock. — but ye feed not the flock; did not govern the people well, by doing justice and judgment among men, as became civil magistrates; did not deliver out words of faith and sound teachings, to feed the minds of men with, which is the duty of those that preside in the church of God.

The diseased have ye not strengthened, neither have ye healed that which was sick, neither have ye bound up that which was broken, neither have ye brought again that which was driven away, neither have ye sought that which was lost; but with force and with cruelty have ye ruled them.

And they were scattered because there is no shepherd, and they became meat to all the beasts of the field when they were scattered. — and they became meat to all beasts of the field when they were scattered; the Targum says, “and they were delivered to all the kingdoms of the people to be consumed;”

— such as the Assyrians, Babylonians, Ammonites, Moabites, and others; and may be applied to false teachers, those grievous wolves, which spare not the flock, into whose hands members of churches, professors of religion, fall, when neglected by their shepherds.

My sheep wandered through all the mountains and upon every high hill; yea, My flock was scattered upon all the face of the earth, and none did search or seek after them.

“‘Therefore, ye shepherds, hear the word of the Lord:

As I live, saith the Lord God, surely because My flock became a prey and My flock became meat to every beast of the field because there was no shepherd, neither did My shepherds search for My flock, but the shepherds fed themselves and fed not My flock,

therefore, O ye shepherds, hear the word of the Lord.

10 Thus saith the Lord God: Behold, I am against the shepherds; and I will require My flock at their hand and cause them to cease from feeding the flock, neither shall the shepherds feed themselves any more. For I will deliver My flock from their mouth, that they may not be meat for them. — thus saith the Lord, Behold, I am against the shepherds; they have made me their enemy by their negligence and abuse of their power, and I will appear and act as such; they have been enemies to my sheep, though pretending to be their shepherds;

— I will be an open enemy to them; and will require my flock at their hands; I will require a severe account from their kings and princes, their priests and prophets.

11 “‘For thus saith the Lord God: Behold I, even I, will both search My sheep and seek them out.

12 As a shepherd seeketh out his flock on the day that he is among his sheep that are scattered, so will I seek out My sheep and will deliver them out of all places where they have been scattered on the cloudy and dark day.

13 And I will bring them out from the people and gather them from the countries, and will bring them to their own land, and feed them upon the mountains of Israel by the rivers and in all the inhabited places of the country.

14 I will feed them in a good pasture, and upon the high mountains of Israel shall their fold be; there shall they lie in a good fold, and in a fat pasture shall they feed upon the mountains of Israel.

15 I will feed My flock, and I will cause them to lie down, saith the Lord God.

16 I will seek that which was lost and bring back that which was driven away, and will bind up that which was broken and will strengthen that which was sick. But I will destroy the fat and the strong: I will feed them with judgment. — I will feed them with judgment; I will judge, chastise, and punish them.

17 “‘And as for you, O My flock, thus saith the Lord God: Behold, I judge between cattle and cattle, between the rams and the hegoats. — behold, I judge between cattle and cattle, between the rams and the he goats: between the smaller and weaker cattle, the sheep and the lambs; now, the Lord, as he observed a difference between them, he would make this manifest, and take the part of the one against the other; even the part of the weaker against the stronger.

— the Targum says, “behold, judge between man and man, sinners and the ungodly.”

18 Seemeth it a small thing unto you to have eaten up the good pasture, but ye must tread down with your feet the residue of your pastures? And to have drunk of the deep waters, but ye must foul the residue with your feet?

19 And as for My flock, they eat that which ye have trodden with your feet, and they drink that which ye have fouled with your feet.

20 “‘Therefore thus saith the Lord God unto them: Behold I, even I, will judge between the fat cattle and between the lean cattle. — behold, I, even I, will judge between the fat cattle and between the lean cattle. The Targum says, “between the rich man and the poor man.”

21 Because ye have thrust with side and with shoulder, and pushed all the diseased with your horns till ye have scattered them abroad,

22 therefore will I save My flock, and they shall no more be a prey; and I will judge between cattle and cattle.

23 And I will set up one Shepherd over them, and He shall feed them, even My servant David. He shall feed them, and He shall be their Shepherd. — perhaps this indicates the reunion of the Northern and Southern kingdoms of the old and new Israel.

24 And I, the Lord, will be their God, and My servant David a prince among them. I, the Lord, have spoken it.

25 “‘And I will make with them a covenant of peace, and will cause the evil beasts to cease out of the land; and they shall dwell safely in the wilderness and sleep in the woods.

26 And I will make them and the places round about My hill a blessing, and I will cause the shower to come down in his season; there shall be showers of blessing.

27 And the tree of the field shall yield her fruit and the earth shall yield her increase, and they shall be safe in their land and shall know that I am the Lord, when I have broken the bands of their yoke and delivered them out of the hand of those that served themselves by them.

28 And they shall no more be a prey to the nations, neither shall the beast of the land devour them; but they shall dwell safely, and none shall make them afraid.

29 And I will raise up for them a plant of renown, and they shall be no more consumed with hunger in the land, neither bear the shame of the nations any more.

30 Thus shall they know that I, the Lord their God, am with them, and that they, even the house of Israel, are My people, saith the Lord God.

31 And ye My flock, the flock of My pasture, are men, and I am your God, saith the Lord God.’” — these words at the conclusion of the chapter, explain the metaphor which runs through the whole of it; namely, that what was said of a flock and its shepherds, is to be understood of men and their governors;

— and of God’s people, whom their ecclesiastical ministers misled and oppressed, but whom God watches over, provides for, and takes care as a shepherd does. This too lays an obligation upon civil princes and magistrates, to govern faithfully and justly the people committing their trust.

Ezekiel (Ch 31-32)

•September 24, 2021 • Leave a Comment

Chapter 31 opens with the Lord speaking to the Pharaoh of Egypt, giving him an example of Assyria, and to anyone else, as a warning of what could happen to them (or us) too.

Ezekiel 31

1 And it came to pass in the eleventh year, in the third month, on the first day of the month, that the word of the Lord came unto me, saying,

“Son of man, speak unto Pharaoh king of Egypt and to his multitude: “‘Whom art thou like in thy greatness?

Behold, the Assyrian was a cedar in Lebanon with fair branches, and with a shadowing shroud, and of a high stature; and his top was among the thick boughs. — behold, the Assyrian was a cedar in Lebanon…. the king of Assyria is compared to a large and flourishing cedar, for the extent of his dominions, the prosperous state of his empire, and his exaltation above all other princes, which drew upon him their envy. Here grew the tallest, most stately, broad and flourishing ones.

The waters made him great, the deep set him up on high with her rivers running round about his plants, and sent out her little rivers unto all the trees of the field. — the waters made him great…. the waters of the river Tigris, near to which stood the city of Nineveh, the metropolis of the Assyrian monarchy; the traffic brought by which river made it rich and great, and the whole empire, and the king of it.

Therefore his height was exalted above all the trees of the field, and his boughs were multiplied, and his branches became long because of the multitude of waters when he shot forth.

All the fowls of heaven made their nests in his boughs, and under his branches did all the beasts of the field bring forth their young; and under his shadow dwelt all great nations. — and under his shadow dwelt all great nations; under his protection, care, and government, many large kingdoms and states were; yea, all were either subject to him, or sought to be his friends and allies: this explains the above figurative expressions;

— the Targum says, “by his army he subdued all the strong towers; and under his governors he subjected all the provinces of the earth; and in the shadow of his kingdom dwelt all the numerous people.”

Thus was he fair in his greatness, in the length of his branches, for his root was by great waters.

The cedars in the garden of God could not hide him; the fir trees were not like his boughs, and the chestnut trees were not like his branches, nor any tree in the garden of God was like unto him in his beauty.

I have made him fair by the multitude of his branches, so that all the trees of Eden that were in the garden of God envied him. — so that all the trees of Eden, that were in the garden of God, envied him; all the kings of the earth, though they dared not openly speak against him, or oppose him; yet they inwardly grieved at and secretly grudged his grandeur and majesty, superior to theirs;

— the Targum says, “I have made him beautiful by the multitude of his mighty ones; and all the kings of the east trembled before him, because of the strength of his power, which he had from the Lord.”

10 “‘Therefore thus saith the Lord God: Because thou hast lifted up thyself in height, and he hath shot up his top among the thick boughs, and his heart is lifted up in his height,

11 I have therefore delivered him into the hand of the mightiest of the nations. He shall surely deal with him. I have driven him out for his wickedness.

12 And strangers, the terrible of the nations, have cut him off and have left him. Upon the mountains and in all the valleys his branches are fallen, and his boughs are broken by all the rivers of the land; and all the people of the earth are gone down from his shadow and have left him.

13 Upon his ruin shall all the fowls of the heaven remain, and all the beasts of the field shall be upon his branches,

14 to the end that none of all the trees by the waters exalt themselves for their height, neither shoot up their top among the thick boughs, neither their trees stand up in their height—all that drink water. For they are all delivered unto death, to the nether parts of the earth, in the midst of the children of men, with them that go down to the pit. — for they are delivered unto death in the nether parts of the earth; they are mortal by nature, as other men; they are appointed to die, and will be delivered into the hands of death, when the time is come, who will not spare them because of their crowns and sceptres; and when they will be laid in the grave, in the lowest parts of the earth, who used to sit upon elevated thrones of state.

15 “‘Thus saith the Lord God: In the day when he went down to the grave I caused a mourning. I covered the deep for him, and I restrained the floods thereof, and the great waters were stayed; and I caused Lebanon to mourn for him, and all the trees of the field fainted for him.

16 I made the nations to shake at the sound of his fall, when I cast him down to hell with them that descend into the pit; and all the trees of Eden, the choice and best of Lebanon, all that drink water, shall be comforted in the nether parts of the earth. — and all the trees of Eden, the choice and best of Lebanon, all that drink water; the greatest kings and potentates of the world, the chief and principal of the Assyrian empire; all that ruled over multitudes of people, and partook of their wealth and riches, and were supported in grandeur and dignity; who had been in the state of the dead before this time.

17 They also went down into hell with him unto them that are slain with the sword, and they that were his arm, that dwelt under his shadow in the midst of the nations.

18 To whom art thou thus like in glory and in greatness among the trees of Eden? Yet shalt thou be brought down with the trees of Eden unto the nether parts of the earth. Thou shalt lie in the midst of the uncircumcised with them that are slain by the sword. “‘This is Pharaoh and all his multitude, saith the Lord God.’” — this is Pharaoh, and all his multitude, saith the Lord God; this account represents Pharaoh, his grandeur, his pride, and his ruin; this shows what will be the end of him, and of his numerous subjects. The Septuagint renders it, “so will be Pharaoh” in like manner will he fall, and all his people with him for the Lord God has said it, and it shall assuredly come to pass.

the Targum says, “to whom art thou like now in glory and greatness among the kings of the east? and thou shall be brought down with the kings of the east into the lower part of the earth; in the midst of sinners thou shalt sleep, with those that are slain by the sword; this is Pharaoh, and all his multitude, saith the Lord God.”

Ezekiel 32

Chapter 32 opens with a lamentation for the Pharaoh of Egypt, giving him a warning of being carried away by Babylon.

1 And it came to pass in the twelfth year, in the twelfth month, on the first day of the month, that the word of the Lord came unto me, saying,

“Son of man, take up a lamentation for Pharaoh king of Egypt and say unto him, “‘Thou art like a young lion of the nations, and thou art as a whale in the seas; and thou camest forth with thy rivers, and troubled the waters with thy feet and fouled their rivers. — thou art like a young lion of the nations; for strength and fierceness, for cruelty and tyranny.

“‘Thus saith the Lord God: I will therefore spread out My net over thee with a company of many people; and they shall bring thee up in My net. — the king of Egypt is compared to a large fish taken in a net, and brought to land, and left on it, to be the prey of the fowls of the air and beasts of the field.

Then will I leave thee upon the land; I will cast thee forth upon the open field and will cause all the fowls of the heaven to remain upon thee, and I will fill the beasts of the whole earth with thee.

And I will lay thy flesh upon the mountains, and fill the valleys with thy height.

I will also water with thy blood the land wherein thou swimmest, even to the mountains; and the rivers shall be full of thee.

And when I shall put thee out, I will cover the heaven and make the stars thereof dark; I will cover the sun with a cloud, and the moon shall not give her light.

All the bright lights of heaven will I make dark over thee, and set darkness upon thy land, saith the Lord God.

“‘I will also vex the hearts of many people when I shall bring thy destruction among the nations, into the countries which thou hast not known. — and the ruin of that kingdom is further amplified by the casting of it on the mountains and valleys; by the land flowing with its blood; by the darkness of the heavens; by the vexation in the hearts of many people; and by the amazement of kings and nations.

10 Yea, I will make many people amazed at thee, and their kings shall be horribly afraid for thee when I shall brandish My sword before them; and they shall tremble at every moment, every man for his own life, in the day of thy fall.

11 “‘For thus saith the Lord God: The sword of the king of Babylon shall come upon thee;

12 by the swords of the mighty will I cause thy multitude to fall, the terrible of the nations, all of them. And they shall despoil the pomp of Egypt, and all the multitude thereof shall be destroyed. — “thy multitude” this is not talking of the Pharaoh but its people.

13 I will destroy also all the beasts thereof from beside the great waters; neither shall the foot of man trouble them any more, nor the hoofs of beasts trouble them.

14 Then will I make their waters deep, and cause their rivers to run like oil, saith the Lord God.

15 When I shall make the land of Egypt desolate, and the country shall be destitute of that whereof it was full, when I shall smite all them that dwell therein, then shall they know that I am the Lord.’ — “then shall they know that I am the Lord” indicates they wouldn’t be put an end to, but come to know that God is known for his omnipotence, omniscience, holiness, justice, and by the judgments He executes.

16 “This is the lamentation wherewith they shall lament her. The daughters of the nations shall lament her; they shall lament for her, even for Egypt, and for all her multitude, saith the Lord God.”

— scatter or scattered the Egyptians; found 4 times in Ezekiel 29:12,13; 30:23,26; disperse/d: found 3 times in Ezekiel 29:12, 30:23,26.

17 It came to pass also in the twelfth year, on the fifteenth day of the month, that the word of the Lord came unto me, saying,

18 “Son of man, wail for the multitude of Egypt and cast them down, even her and the daughters of the famous nations, unto the nether parts of the earth with them that go down into the pit. — “wail for the multitude of Egypt and cast them down. . . unto the nether parts of the earth” — the Gypsies, an ethnic group of traditionally itinerant people now living in various parts of central Europe and the Balkans (Romania, Bulgaria, Serbia, Montenegro, Macedonia, Croatia, Bosnia and Herzegovina, Slovenia, the Czech and Slovak republics, and Hungary) and Southern France, as well as Turkey;

but allegedly to have originated from northern India, yet only scanty evidence are given and none seems to be living there today. In fact all evidence point to the fact that they have originated from Egypt, and scattered around various countries (Ezekiel 29:12 “And I will make the land of Egypt desolate in the midst of the countries that are desolate, and her cities among the cities that are laid waste shall be desolate forty years; and I will scatter the Egyptians among the nations and will disperse them through the countries”).

Wiki: Distribution of Egipciens in Europe (about 10 million)

today, Gypsies are known as Roma, but in Hebrew, their name is derived from the Egyptian city of Zoan, known as “the royal city of the Pharaohs” or Tanis (as the Targum says), at one time the royal and capital of the country; and this is from Wikipedia (Romani people):

Hebrew: צוענים‎, romanized: Tzoanim. Derives either from the biblical Egyptian city of Zoan, or from the linguistic root צ־ע־נ‎, meaning “wander”

The English term Gypsy (or Gipsy) originates from the Middle English gypcian, short for Egipcien.

— and from the French entry:

French: gitan/tsigane, English gypsygipsy / dʒɪpsiː/, Irish: giofóg, Spanish/Catalan/Italian gitano, Basque: ijito, Turkish: çingene, all from Greek: Αἰγύπτιος, romanized: Aigýptios “Egyptian” (corrupted form: Γύφτος, Gýftos), and Hungarian: fáraónépe from Greek: φαραώ, romanized: pharaó “pharaoh” – referring to their allegedly Egyptian provenance.

19 ‘Whom dost thou pass in beauty? Go down, and be thou laid with the uncircumcised.’ — instead of “the nations” it’s the uncircumcised used 10 times with a pejorative connotation in this chapter alone;

go down, and be thou laid with the uncircumcised; go down to the grave, and take thy place, and lie there among the wicked and most profligate of mankind, and such as might be most despised by the Egyptians, since they used circumcision.

the Targum says, “go down and sleep with sinners.”

20 They shall fall in the midst of them that are slain by the sword. She is delivered to the sword; draw her and all her multitudes.

21 The strong among the mighty shall speak to him out of the midst of hell with them that help him: ‘They are gone down; they lie uncircumcised, slain by the sword.’

22 “Assyria is there and all her company; his graves are about him, all of them slain, fallen by the sword, — Ashur is there, and all her company…. in the state of the dead, or in a most desolate and ruinous condition; the great Assyrian monarchy, the kings of it, the princes, nobles, generals, soldiers, and the vast number of subjects in all the dominions of it; all his army.

23 whose graves are set in the sides of the pit and her company is round about her grave; all of them slain, fallen by the sword, which caused terror in the land of the living.

24 “There is Elam and all her multitude round about her grave, all of them slain, fallen by the sword, who are gone down uncircumcised into the nether parts of the earth, who caused their terror in the land of the living; yet have they borne their shame with them that go down to the pit.

25 They have set her a bed in the midst of the slain with all her multitude. Her graves are round about him, all of them uncircumcised, slain by the sword. Though their terror was caused in the land of the living, yet have they borne their shame with them that go down to the pit. He is put in the midst of them that are slain.

26 “There is Meshech, Tubal, and all her multitude. Her graves are round about him, all of them uncircumcised, slain by the sword, though they caused their terror in the land of the living.

27 And they shall not lie with the mighty that are fallen of the uncircumcised, who are gone down to hell with their weapons of war; and they have laid their swords under their heads, but their iniquities shall be upon their bones, though they were the terror of the mighty in the land of the living.

28 Yea, thou shalt be broken in the midst of the uncircumcised, and shalt lie with them that are slain with the sword. — the word “sword” is used 16 times, mostly about being slain or fell by the sword in this chapter along, showing much emphasis about how their fate lies.

29 “There is Edom, her kings and all her princes, who with their might are laid by them that were slain by the sword. They shall lie with the uncircumcised and with them that go down to the pit.

30 “There are the princes of the north, all of them, and all the Sidonians, who are gone down with the slain. With their terror they are ashamed of their might, and they lie uncircumcised with them that are slain by the sword, and bear their shame with them that go down to the pit.

31 “Pharaoh shall see them, and shall be comforted over all his multitude, even Pharaoh and all his army slain by the sword, saith the Lord God.

32 For I have caused My terror in the land of the living; and he shall be laid in the midst of the uncircumcised with them that are slain with the sword, even Pharaoh and all his multitude, saith the Lord God.” — Egypt was described as “the great dragon that lieth in the midst of his river” (Ezekiel 29:3) are now being “are slain with the sword, even Pharaoh and all his multitude.” What a drastic fall!

Under “Romani people” from Wikipedia:

The English term Gypsy (or Gipsy) originates from the Middle English gypcian, short for Egipcien. The Spanish term Gitano and French Gitan have similar etymologies. They are ultimately derived from the Greek Αιγύπτιοι (Aigyptioi), meaning Egyptian, via Latin. This designation owes its existence to the belief, common in the Middle Ages, that the Romani, or some related group (such as the Middle Eastern Dom people), were itinerant Egyptians. This belief appears to be derived from verses in the Biblical Book of Ezekiel (29:6 and 12–13) which refer to the Egyptians being scattered among the nations by an angry God.  In his book The Zincali: an account of the Gypsies of Spain, George Borrow notes that when they first appeared in Germany, it was under the character of Egyptians doing penance for their having refused hospitality to Mary and her son. As described in Victor Hugo’s novel The Hunchback of Notre Dame, the medieval French referred to the Romanies as Egyptiens.

Ezekiel (Ch 29-30)

•September 23, 2021 • Leave a Comment

Chapters 29-30 contain a prophecy against the Pharaoh of Egypt and of its destruction and restoration and show how the God of Israel will be manifested to them and to all the rest of the nations.

Ezekiel 29

1 In the tenth year, in the tenth month, on the twelfth day of the month, the word of the Lord came unto me, saying,

“Son of man, set thy face against Pharaoh king of Egypt, and prophesy against him and against all Egypt. — to prophesy against indicates something bad is to happen.

Speak, and say, ‘Thus saith the Lord God: “‘Behold, I am against thee, Pharaoh king of Egypt, the great dragon that lieth in the midst of his rivers, which hath said, “My river is mine own, and I have made it for myself.” — the great dragon that lieth in the midst of his rivers; the chief river of Egypt was the Nile, which opened in seven mouths or gates into the sea, and out of which canals were made to water the whole land; and which abounding with rivers and watery places, hence the king of it is compared to a great fish, a dragon.

But I will put hooks in thy jaws, and I will cause the fish of thy rivers to stick unto thy scales; and I will bring thee up out of the midst of thy rivers, and all the fish of thy rivers shall stick unto thy scales.

And I will leave thee thrown into the wilderness, thee and all the fish of thy rivers; thou shalt fall upon the open fields. Thou shalt not be brought together, nor gathered. I have given thee for meat to the beasts of the field and to the fowls of the heaven.

And all the inhabitants of Egypt shall know that I am the Lord, because they have been a staff of reed to the house of Israel. “And all the inhabitants of Egypt shall know that I am the Lord,” indicates they survive at the end.

When they took hold of thee by thy hand, thou didst break and rend all their shoulder; and when they leaned upon thee, thou brokest and madest all their loins to be at a halt.

“‘Therefore thus saith the Lord God: Behold, I will bring a sword upon thee, and cut off man and beast out of thee.

And the land of Egypt shall be desolate and waste; and they shall know that I am the Lord, because he hath said, “The river is mine, and I have made it.” — and the land of Egypt shall be desolate and waste…. men few or none being left in it, to till it, nor cattle found upon it.

10 “‘Behold, therefore I am against thee and against thy rivers, and I will make the land of Egypt utterly waste and desolate, from the tower of Syene even unto the border of Ethiopia.

11 No foot of man shall pass through it, nor foot of beast shall pass through it, neither shall it be inhabited forty years.

12 And I will make the land of Egypt desolate in the midst of the countries that are desolate, and her cities among the cities that are laid waste shall be desolate forty years; and I will scatter the Egyptians among the nations and will disperse them through the countries. — and I will scatter the Egyptians among the nations, and will disperse them through the countries; such as were not carried captive into Babylon fled into other countries, as Arabia, Ethiopia, Romania, Bulgaria, and other places. Are these scattered Egyptians the Egyptiens, the Egipcien, who later are better known as Gypsies? More evidence and comments in Ezekiel 32.

Wiki: Distribution of Egipciens in Europe (about 10 million)

13 “‘Yet thus saith the Lord God: At the end of forty years will I gather the Egyptians from the people whither they were scattered. — yet thus saith the Lord God, at the end of forty years…whither they were scattered. Reckoning from its devastation by Nebuchadnezzar to the taking of Babylon by Cyrus and scattered around various countries.

14 And I will bring back the captives of Egypt and will cause them to return into the land of Pathros, into the land of their habitation, and they shall be there a base kingdom. — and they shall be there a base kingdom; Egypt throughout all subsequent history has continued to remain a nation of secondary strength and importance: Babylon dominated her; then Persia dominated her; then the Greeks under Alexander the Great were her masters; after them came the Seleucids, and still later the Romans, the Ottomans, the British; the Egyptians never had a strong king of their own to reign over them.

15 It shall be the least of the kingdoms, neither shall it exalt itself any more above the nations; for I will diminish them, that they shall no more rule over the nations. — for I will demolish them, that they shall no more rule over the nations; for though they made war upon other nations yet they did not subdue them, nor annex them, being much weakened both as to men and money.

16 And it shall be no more the confidence of the house of Israel which bringeth their iniquity to remembrance when they shall look after them; but they shall know that I am the Lord God.’ — Rashi: and it will no longer be: [i.e.] Egypt [will no longer be] a source of confidence for the House of Israel, bringing iniquity into remembrance for them, since the Holy One, blessed be he, said to them (Exod. 14: 13): “You shall no longer continue to see them.” — the house of Israel will no longer see Egypt as a great nation.

“but they shall know that I am the Lord God,” reaffirms they survive at the end.

17 And it came to pass in the seven and twentieth year, in the first month, on the first day of the month, the word of the Lord came unto me, saying,

18 “Son of man, Nebuchadnezzar king of Babylon caused his army to serve a hard service against Tyre: every head was made bald and every shoulder was peeled; yet had he no wages, nor his army, from Tyre for the service that he had served against it.

19 Therefore thus saith the Lord God: Behold, I will give the land of Egypt unto Nebuchadnezzar king of Babylon; and he shall take her multitude, and take her spoil, and take her prey; and it shall be the wages for his army.

Coffman: Despite the fall of Tyre and its subsequent domination under a high commissioner from Babylon, Nebuchadnezzar received no significant spoil from its capture. Many have suggested that perhaps Tyre had had sufficient time to ship all of their treasures elsewhere.

— Egypt may well have been a cooperating partner with Tyre in such a project, giving credence to suggestion that such actions on Egypt’s part would have been a sufficient “casus belli” to result in Nebuchadnezzar’s immediate declaration of war against Egypt.

20 I have given him the land of Egypt for his labor for which he served against it, because they wrought for Me, saith the Lord God. — and while the Babylonians besieged Tyre, the Egyptians came to Tyre’s aid. Thus God deemed it right for the Babylonians to ravage, plunder and subdue Egypt: they were doing Lord’s will and executing his righteous judgments on these enemies for their offenses.

21 “In that day will I cause the horn of the house of Israel to bud forth, and I will give thee the opening of the mouth in the midst of them; and they shall know that I am the Lord.”

“and they shall know that I am the Lord,” repeated four times (verses 6, 9, 16, 21) reaffirms they survive at the end.

Ezekiel 30

1 The word of the Lord came again unto me, saying,

“Son of man, prophesy and say, ‘Thus saith the Lord God: “‘Howl ye, “Woe be the day!”

For the day is near; even the day of the Lord is near, a cloudy day; it shall be the time of the nations. — this is also called the “the time of the Gentile [H1471 gō·w·yim],” but what does it mean?

And the sword shall come upon Egypt, and great pain shall be in Ethiopia when the slain shall fall in Egypt; and they shall take away her multitude, and her foundations shall be broken down. — great pain shall be upon Ethiopia; great trouble and distress; when the slain shall fall in Egypt.

Ethiopia, and Libya, and Lydia, and all the mingled people, and Chub, and the men of the land that is in league, shall fall with them by the sword.

“‘Thus saith the Lord: They also that uphold Egypt shall fall, and the pride of her power shall come down; from the tower of Syene shall they fall in it by the sword, saith the Lord God. — thus saith the Lord, they also that uphold Egypt shall fall…. that is, by the sword; either their allies and auxiliaries without, that supported the Egyptians with men and money; or their principal people within, their nobles that supported their state with their estates, their counsellors with their wisdom, their soldiers with their valour and courage.

And they shall be desolate in the midst of the countries that are desolate, and her cities shall be in the midst of the cities that are wasted.

And they shall know that I am the Lord, when I have set a fire in Egypt, and when all her helpers shall be destroyed. “and they shall know that I am the Lord,” reaffirms they survive at the end.

“‘In that day shall messengers go forth from Me in ships to make the careless Ethiopians afraid, and great pain shall come upon them, as in the day of Egypt; for lo, it cometh.

10 “‘Thus saith the Lord God: I will also make the multitude of Egypt to cease by the hand of Nebuchadnezzar king of Babylon.

11 He and his people with him, the terrible of the nations, shall be brought to destroy the land; and they shall draw their swords against Egypt and fill the land with the slain. — the terrible of the nations shall be brought to destroy the land; the Chaldeans, the most fierce, cruel, and terrible of all people, and others the most terrible that could be collected out of all nations under the yoke of the king of Babylon; and all of them terrible to the nations against whom they came, as now against Egypt to destroy it; see Habakkuk 1:6.

12 And I will make the rivers dry, and sell the land into the hand of the wicked; and I will make the land waste and all that is therein, by the hand of strangers. I, the Lord, have spoken it.” — and I will make the rivers dry …” we have no historical record of such a drought falling upon the Nile; so if the Lord had spoken it, this could only refer to a time into the future, that is, a prophecy. The forty years of desolation that has been mentioned again and again with reference to God’s judgment upon Egypt would indeed have included such a disaster as the drying up of the Nile. There is also the possibility that the language here may be allegorical or figurative;

— and I will make the rivers dry up; the waters from the Nile shall be wasted and dried up, perhaps none flow from the Grand Ethiopian Renaissance Dam; this drying up would be a calamity for Egypt since the country depended entirely upon the Nile for drinking and irrigation (see also Isaiah 19:5 and Zechariah 10:11).

13 “‘Thus saith the Lord God: I will also destroy the idols, and I will cause their images to cease out of Noph; and there shall be no more a prince of the land of Egypt, and I will put a fear in the land of Egypt. — and there shall be no more a prince of the land of Egypt; that is, a native of that country; or that should rule over the whole of it; and in that grandeur the kings of Egypt had before; will be no more

— Egypt was conquered by Nebuchadnezzar, under the Babylonians; then the Persians; the Greeks; the Romans; the Saracens and Mamalucks; the Turks; the British so that it never recovered its former glory; and indeed, it never really had a king: “no more a prince of the land of Egypt.”

14 And I will make Pathros desolate, and will set fire in Zoan, and will execute judgments in No. — today, Gypsies are known as Roma, but in Hebrew, their name is derived from the Egyptian city of Zoan; and this is from Wikipedia (Romani people);

Hebrew: צוענים‎, romanized: Tzoanim. Derives either from the biblical Egyptian city of Zoan, or from the linguistic root צ־ע־נ‎, meaning “wander”.

— for more, see a study commentary in Ezekiel 32.

15 And I will pour My fury upon Sin, the strength of Egypt, and I will cut off the multitude of No.

16 And I will set fire in Egypt; Sin shall have great pain, and No shall be rent asunder, and Noph shall have distresses daily.

17 The young men of Aven and of Pibeseth shall fall by the sword; and these cities shall go into captivity.

18 At Tehaphnehes also the day shall be darkened when I shall break there the yokes of Egypt, and the pomp of her strength shall cease in her. As for her, a cloud shall cover her, and her daughters shall go into captivity.

19 Thus will I execute judgments in Egypt; and they shall know that I am the Lord.’” — “and they shall know that I am the Lord,” repeated four times (verses 8, 19, 25, 26) reaffirms they survive at the end.

20 And it came to pass in the eleventh year, in the first month, on the seventh day of the month, that the word of the Lord came unto me, saying,

21 “Son of man, I have broken the arm of Pharaoh king of Egypt; and lo, it shall not be bound up to be healed, to put on a bandage to bind it, to make it strong to hold the sword.

22 Therefore thus saith the Lord God: Behold, I am against Pharaoh king of Egypt, and will break his arms, the strong and that which was broken; and I will cause the sword to fall out of his hand.

23 And I will scatter the Egyptians among the nations and will disperse them through the countries.

24 And I will strengthen the arms of the king of Babylon and put My sword in his hand; but I will break Pharaoh’s arms, and he shall groan before him with the groanings of a deadly wounded man.

25 But I will strengthen the arms of the king of Babylon, and the arms of Pharaoh shall fall down. And they shall know that I am the Lord when I shall put My sword into the hand of the king of Babylon, and he shall stretch it out upon the land of Egypt. “And they shall know that I am the Lord,” affirms they will survive, despite being dispersed through the nations.

26 And I will scatter the Egyptians among the nations and disperse them among the countries; and they shall know that I am the Lord.”

— “and they shall know that I am the Lord,” reaffirms their survival at the end, by then knowing that the God of Israel is both omniscient and omnipotent.

Ezekiel (Ch 27-28)

•September 22, 2021 • Leave a Comment

Chapter 27 and 28 continue with the same prophecy and lamentation against Tyre that started in Chapter 26. Why three chapters? Something must be rather significant. Whereas Chapter 26 centers on Tyre, chapter 27 branches out to surrounding territories and many trading outposts. And chapter 28 goes beyond the temporal.

Ezekiel 27

1 The word of the Lord came again unto me, saying,

“Now, thou son of man, take up a lamentation for Tyre, — take up a lamentation for Tyre; this alludes to the mournful lamentations as practiced at funerals.

and say unto Tyre, ‘O thou that art situate at the entry of the sea, who art a merchant of the people for many isles, thus saith the Lord God: “‘O Tyre, thou hast said, “I am of perfect beauty.” — which art a merchant of the people for many isles; the inhabitants of many isles brought the produce of them to her; who took them off their hands, or sold them for them to others; these came from several quarters to trade with her in her markets; and who supplied other isles and countries with all sorts of commodities, for which they either resorted to her, or she sent by ships unto them.

Thy borders are in the midst of the seas; thy builders have perfected thy beauty. — thy borders are in the midst of the seas, fixed by the Lord himself, and which could never be removed. Tyre stood about half a mile from the continent, surrounded with the waters of the sea, till it was made a peninsula by Alexander;

thy builders have perfected thy beauty. The Sidonians were the first builders of the city.

They have made all thy ship boards of fir trees of Senir; they have taken cedars from Lebanon to make masts for thee. they have taken cedars from Lebanon, to make masts for thee; large poles for the yards and sails to be fastened to, for receiving the wind necessary in navigation; all these are only in large vessels; most were made from the cedars of Lebanon; the Tyrians are said to be the first inventors of navigation.

Of the oaks of Bashan have they made thine oars; the company of the Ashurites have made thy benches of ivory, brought out of the isles of Cyprus.

Fine linen with embroidered work from Egypt was that which thou spreadest forth to be thy sail; blue and purple from the isles of Elishah was that which covered thee.

The inhabitants of Sidon and Arvad were thy mariners; thy wise men, O Tyre, that were in thee, were thy pilots.

The ancients of Gebal and the wise men thereof were in thee thy caulkers; all the ships of the sea with their mariners were in thee to trade for thy merchandise. all the ships of the sea with their mariners were in thee to occupy thy merchandise; ships from all parts were in her harbours, which brought goods into her, and carried goods out of her, by way of merchandise.

— so the Targum, “all that go down into the sea, and the ships; they were rowers, and they brought merchandise into the midst of thee.”

10 “‘They of Persia and of Lud and of Phut were in thine army, thy men of war. They hanged the shield and helmet in thee; they set forth thy comeliness.

11 The men of Arvad with thine army were upon thy walls round about, and the Gammadims were in thy towers. They hanged their shields upon thy walls round about; they have made thy beauty perfect.

12 “‘Tarshish was thy merchant by reason of the multitude of all kinds of riches; with silver, iron, tin, and lead, they traded in thy fairs.

13 Javan, Tubal, and Meshech, they were thy merchants; they traded the persons of men and vessels of brass in thy market. — these are Japhet’s sons as documented in Genesis 10:2; so Tyre was even trading with people from east Asia.

14 Those of the house of Togarmah traded in thy fairs with horses and horsemen and and mules is listed in Genesis 10:3 as the third son of Gomer, and grandson of Japheth, brother of Ashkenaz and Riphath.

the name is again mentioned in the Book of Ezekiel as a nation from the “far north.” Ezekiel 38:6 mentions Togarmah together with Tubal as supplying soldiers to the army of Gog. Ezekiel 27:14 mentions Togarmah together with Tubal, Javan and Meshech as supplying horses to the Tyrians.

15 The men of Dedan were thy merchants; many isles were the merchandise of thine hand; they brought thee for a present horns of ivory and Dedan (now part of Al-‘Ula, Saudi Arabia) was an oasis and city-state of north-western Arabia.

16 Syria was thy merchant by reason of the multitude of the wares of thy making; they traded in thy fairs with emeralds, purple, and embroidered work, and fine linen, and coral, and agate.

17 Judah and the land of Israel, they were thy merchants; they traded in thy market wheat of Minnith, and pannag, and honey, and oil, and balm.

18 Damascus was thy merchant in the multitude of the wares of thy making, for the multitude of all riches, in the wine of Helbon and white wool.

19 Dan also and Javan, going to and fro, traded in thy fairs; bright iron, cassia, and calamus were in thy market.

20 Dedan was thy merchant in precious clothes for chariots.

21 Arabia, and all the princes of Kedar, they traded with thee in lambs and rams and goats; in these were they thy merchants.

22 The merchants of Sheba and Raamah, they were thy merchants; they traded in thy fairs with chief of all spices, and with all precious stones, and gold. according to Josephus Sheba was also the home of the biblical “Princess Tharbis” said to have been the first wife of Moses when he was still Prince of Egypt.

Raamah or Rama is a name found in the Bible (Hebrew: רעמה, Ra‛mâh), means “lofty” or “exalted” and also may mean “thunder”. The name is first mentioned as the fourth son of Cush, who is the son of Ham, who is the son of Noah in Genesis 10:7.

23 Haran, and Canneh, and Eden, the merchants of Sheba, Asshur, and Chilmad were thy merchants.

24 These were thy merchants in all sorts of things—in blue clothes, and embroidered work, and in chests of rich apparel, bound with cords and made of cedar, among thy merchandise.

25 The ships of Tarshish did sing of thee in thy market, and thou wast replenished and made very glorious in the midst of the seas. even the ships of Tarshish sung or spake great things of Tyre’s riches, like sing praises.

26 Thy rowers have brought thee into great waters; the east wind hath broken thee in the midst of the seas.

27 Thy riches and thy fairs, thy merchandise, thy mariners, and thy pilots, thy caulkers, and the traders of thy merchandise, and all thy men of war that are in thee, and in all thy company which is in the midst of thee shall fall into the midst of the seas in the day of thy ruin. thy riches and all thy company, shall fall into the midst of the seas; shall be as utterly ruined and destroyed as if they were sunk in the sea by a shipwreck.

28 The suburbs shall shake at the sound of the cry of thy pilots.

29 And all that handle the oar, the mariners, and all the pilots of the sea shall come down from their ships; they shall stand upon the land,

30 and shall cause their voice to be heard against thee, and shall cry bitterly and shall cast up dust upon their heads; they shall wallow themselves in the ashes.

31 And they shall make themselves utterly bald for thee, and gird themselves with sackcloth, and they shall weep for thee with bitterness of heart and bitter wailing.

32 And in their wailing they shall take up a lamentation for thee and lament over thee, saying, “What city is like Tyre, like the destroyed in the midst of the sea?”

33 When thy wares went forth out of the seas, thou filled many people; thou didst enrich the kings of the earth with the multitude of thy riches and of thy merchandise.

34 In the time when thou shalt be broken by the seas in the depths of the waters, thy merchandise and all thy company in the midst of thee shall fall.

35 All the inhabitants of the isles shall be astonished at thee, and their kings shall be sore afraid; they shall be troubled in their countenance.

36 The merchants among the people shall hiss at thee; thou shalt be a terror, and never shalt be any more.’”” the merchants of the peoples hiss at thee …” how fickle are the people of mankind! Tyre was then the most popular nation on earth; but the very merchants who were delighted to be “her traffickers” are here revealed as “hissing at their former leader.”

“They totally disowned her; they hissed at her in a derogatory manner, perhaps thinking thereby to gain favor with the Babylonians.

— and never shalt be any more — historically Tyre was still an important city centuries later during the times of Alexander the Great, so this must be for the endtime; and is this a prophecy against Tyre that has no promise of restoration? Seems so as the end of chapter 26 says the same thing that Tyre “shalt be no more.”

Other concluding versions for Tyre:

— from now on you are nothing;

— and you will never exist again;

— and you are gone forever;

— for you are gone, never to return.

Ezekiel 28

Chapter 28 is still a prophecy of the destruction and a lamentation of Tyre, starting as the “prince of Tyre,” but ends up as the “king of Tyre.”

1 The word of the Lord came again unto me, saying,

“Son of man, say unto the prince of Tyre, ‘Thus saith the Lord God: “‘Because thine heart is lifted up and thou hast said, “I am a god, I sit in the seat of God in the midst of the seas,” yet thou art a man, and not God, though thou set thine heart as the heart of God. because thy heart is lifted up In pride and self-conceit; and thou hast said: Namely, in thy heart; I am a god I am like a god. I sit in the seat of God Inaccessible by mortals.

Behold, thou art wiser than Daniel; there is no secret that they can hide from thee. — the Septuagint render it by way of interrogation, “art thou not wiser than Daniel?

it is just like Nebuchadnezzar’s pride but under God who said of him Daniel 4:30-31. Yet thou art man, and not God 

With thy wisdom and with thine understanding thou hast gotten thee riches, and hast gotten gold and silver into thy treasuries. — with thy wisdom and with thy understanding thou hast gotten thee riches…. through skill in navigation and trade, for which the Tyrians and their princes were famous, they acquired great wealth: by carnal policy has amassed vast treasures through the sale of pardons and indulgences has brought immense riches into the pope’s coffers, and the paying of three tithes among the CoG Communities when temple services had been abolished long ago.

By thy great wisdom and by thy traffic hast thou increased thy riches, and thine heart is lifted up because of thy riches. and thine heart is lifted up because of thy riches; which are apt to puff up and swell with a vain opinion of themselves, and to make haughty, insolent, and scornful, in their behaviour to others; the whore of Rome is represented as proud, vain, and haughty, Revelation 18:7.

“‘Therefore thus saith the Lord God: Because thou hast set thine heart as the heart of God, because thou hast set thine heart as the heart of God; seeking thine own glory; setting up thyself above all others; assuming that to thyself which belongs to God; and making thyself equal to him, or showing thyself as if thou wast God.

behold, therefore I will bring strangers upon thee, the terrible of the nations; and they shall draw their swords against the beauty of thy wisdom, and they shall defile thy brightness. — “strangers” refugees — Afghans, Syrians, Iraqis, Palestinians, Sudanese, Moroccans, Algerians, Mexicans, Haitians; are coming;

“the terrible of the nations”; the most heinous and depraved of the nations: al-Qaeda, ISIS and their affiliates; and they shall draw their swords against the beauty of thy wisdom”;

— their beautiful city and spacious buildings, the palaces of their king and nobles, their walls and towers erected and warriors so well skilled in military affairs.

They shall bring thee down to the pit, and thou shalt die the deaths of them that are slain in the midst of the seas. — “and thou shalt die the deaths of them that are slain in the midst of the seas”; that die in a sea battles, whose carcasses are thrown overboard, and devoured by fishes.

Wilt thou yet say before him that slayeth thee, “I am God”? But thou shalt be a man, and no god in the hand of him that slayeth thee.

10 Thou shalt die the deaths of the uncircumcised by the hand of strangers; for I have spoken it, saith the Lord God.’” thou shalt die the deaths of the uncircumcised…. or the death of the wicked.

11 Moreover the word of the Lord came unto me, saying, — here is a new scene, a change of scene.

12 “Son of man, take up a lamentation over the king of Tyre, and say unto him, ‘Thus saith the Lord God: “‘Thou sealest up the sum, full of wisdom and perfect in beauty. — take up a lamentation upon the king of Tyrus…. who is before called the prince of Tyre (Ezekiel 28:2); and who he was. Note a subtle change of scene, from, “the prince” to here, “the king.”

13 Thou hast been in Eden the garden of God; every precious stone was thy covering: the sardius, topaz, and the diamond, the beryl, the onyx, and the jasper, the sapphire, the emerald, and the carbuncle, and gold; the workmanship of thy taborets and of thy pipes was prepared in thee in the day that thou wast created. — now this prophecy of Tyre has again moved beyond the temporal, for none in the modern days has been to the Garden of Eden.

14 Thou art the anointed cherub that covereth, and I have set thee so; thou wast upon the holy mountain of God; thou hast walked up and down in the midst of the stones of fire.

15 Thou wast perfect in thy ways from the day that thou wast created, till iniquity was found in thee. — this being, the adversary, was created; till iniquity was found in thee; pride, blasphemy against God, and contempt of his people, as well as violence and deceit;

all this was found in “the king of Tyre.”

16 By the multitude of thy merchandise they have filled the midst of thee with violence, and thou hast sinned; therefore I will cast thee as profane out of the mountain of God; and I will destroy thee, O covering cherub, from the midst of the stones of fire. and I will destroy thee, O covering cherub, from the midst of the stones of fire; from among the creation (people, angels) of God.

17 Thine heart was lifted up because of thy beauty; thou hast corrupted thy wisdom by reason of thy brightness. I will cast thee to the ground; I will lay thee before kings, that they may behold thee. — thine heart was lifted up because of thy beauty…. riches, wealth, power and authority.

thou hast corrupted thy wisdom by reason of thy brightness; outward lustre and glory, which dazzled his eyes.

18 Thou hast defiled thy sanctuaries by the multitude of thine iniquities, by the iniquity of thy traffic. Therefore will I bring forth a fire from the midst of thee; it shall devour thee; and I will bring thee to ashes upon the earth in the sight of all them that behold thee. and I will bring thee to ashes upon the earth, in the sight of all them that behold thee; the kings and merchants of the earth, who shall stand and look on the city as it is burning, and when reduced to ashes; which denotes the utter destruction of it, Revelation 18:9.

The Targum is, “I will give thee as ashes on the earth,’ and shall be no more.

19 All they that know thee among the people shall be astonished at thee; thou shalt be a terror, and never shalt thou be any more.’” — and never shalt thou be any moresimilar to Ammon, this prophecy against the king of Tyre has no promise of restoration.

20 Again the word of the Lord came unto me, saying,

21 “Son of man, set thy face against Sidon, and prophesy against it — Sidon is a city in Lebanon, but further north of Tyre.

22 and say, ‘Thus saith the Lord God: “‘Behold, I am against thee, O Sidon, and I will be glorified in the midst of thee; and they shall know that I am the Lord, when I shall have executed judgments in her and shall be sanctified in her.

23 For I will send into her pestilence, and blood into her streets; and the wounded shall be judged in the midst of her by the sword upon her on every side; and they shall know that I am the Lord. “and they shall know that I am the Lord” repeated four times (verses 22, 23, 24, 26) — Sidon survives, unlike Tyre, which perished and be remembered no more: Ezekiel 26:21.

24 And there shall be no more a pricking brier unto the house of Israel, nor any grieving thorn of all who are round about them, who despised them; and they shall know that I am the Lord God.

25 “‘Thus saith the Lord God: When I shall have gathered the house of Israel from the people among whom they are scattered, and shall be sanctified in them in the sight of the heathen, then shall they dwell in their land that I have given to My servant Jacob.

26 And they shall dwell safely therein, and shall build houses and plant vineyards; yea, they shall dwell with confidence when I have executed judgments upon all those that despise them round about them; and they shall know that I am the Lord their God.’” and they shall know that I am the Lord their God; Sidon survives, after they could see the hand of God in it, acknowledge his justice, and confess that their gods were idols, and that the God of Israel is the only true God.

Ezekiel (Ch 25-26)

•September 20, 2021 • Leave a Comment

Chapter 25 continues with the same prophecy against the Ammonites which started in Chapter 21. Just a recap: We might speculate why the Ammonites were singled out here for this special oracle; but it might have pertained to the share they had in the murder of Gedaliah, by the hand of Ishmael and the Ammonites gave these killers refuge.

Second, in historic time, when Nebuchadnezzar took his route to Jerusalem, and destroyed the city, returned to Babylon, he went about without making any attempt upon the Ammonites; which so flushed the Ammonites that they insulted the Jews and laughed at their destruction, as if their God couldn’t save them.

And perhaps thirdly, the Ammonites are modern Jordan, sitting on land allocated to three of the tribes of Israel, and they are taking their ancestral land back, land that could even stretch to the Euphrates River.

Ezekiel 25

1 The word of the Lord came again unto me, saying,

“Son of man, set thy face against the Ammonites and prophesy against them;

and say unto the Ammonites, ‘Hear the word of the Lord God. Thus saith the Lord God: Because thou saidst, “Aha,” against My sanctuary when it was profaned, and against the land of Israel when it was desolate, and against the house of Judah when they went into captivity, — Gill: and against the house of Judah, when they went into captivity; the two tribes of Judah and Benjamin, who were carried captives by Nebuchadnezzar;

— under Jehoiakim (succeeded Jehoahaz, who replaced Josiah but reigned only 3 months); began giving tribute to Nebuchadnezzar in 605 BC; first deportation, purportedly including Daniel;

— another captives under Jeconiah, (Reign: 598 – 597 BC);

— and the rest would be under Zedekiah (Reign 597–586 BC); which completed the destruction of Israel and Judah;

— and gave the utmost pleasure to their enemies the Ammonites; who were so impious as to rejoice at the destruction of God’s temple: “’Aha,’ against My sanctuary” which they abhorred; this brutish and barbarous behaviour of theirs is resented by the Lord.

behold, therefore I will deliver thee to the men of the East as a possession; and they shall set their palaces in thee and make their dwellings in thee. They shall eat thy fruit, and they shall drink thy milk. the men of the east for a possession…. the Chaldeans, the Medes and Persians, they lay eastward of Jerusalem; and/or it may be the Arabians, who are often called the men of the east.

And I will make Rabbah a stable for camels and Ammon a couching place for flocks; and ye shall know that I am the Lord. Rabbah is the capital of Ammon;

— and I will make Rabbath a stable for camels…. creatures much used by the eastern nations, especially the Arabians; who pitching their tents about Rabbath, the royal city,

For thus saith the Lord God: Because thou hast clapped thine hands and stamped with the feet and rejoiced in heart with all thy contemptuous hate against the land of Israel, because thou hast clapped thine hands, and stamped with thy feet: gestures expressive of joy and gladness;

— the Ammonites clapped their hands together, and leaped and skipped for joy, when they heard of the calamities of the Jews; who yet had more reason to be sorrowful, since they might expect their turn would be next; for the king of Babylon had a design against them, at the same time he came against Jerusalem, and was in doubt for a while which he should attack first; see Ezekiel 21:20.

behold, therefore I will stretch out Mine hand upon thee and will deliver thee as spoil to the nations; and I will cut thee off from the people, and I will cause thee to perish out of the countries. I will destroy thee, and thou shalt know that I am the Lord.’ and I will cut thee off from the people, and I will cause thee to perish out of the countries; so as to be no more a people and a country; or be reckoned among the people and countries; or have any alliance with them, or help from them.

“Thus saith the Lord God: ‘Because Moab and Seir do say, “Behold, the house of Judah is like unto all the heathen,” — the Moabites are first prophesied of, and then the Edomites who both joined in saying, behold, the house of Judah is like unto all the heathens;

— it fares no better with them than with the rest of the nations, who do not profess and serve the same God they do; they are fallen into the hands of the king of Babylon;

— and yet are brought into the same miserable circumstances, and left in them, as others are; where is their God they boast of, and their superior excellence to the rest of the world?

thus blasphemously, as well as wickedly, did they insult them, which was provoking to the Lord.

the Targum renders it interrogatively, “in what do the house of Judah differ from all people?”

the Septuagint, “behold, are not the house of Israel and Judah in like manner as all nations?”

therefore, behold, I will open the side of Moab from the cities, from his cities which are on his frontiers, the glory of the country — Bethjeshimoth, Baalmeon, and Kiriathaim—

10 unto the men of the East with the Ammonites, and will give them in possession, that the Ammonites may not be remembered among the nations. — this prophecy against Ammon and the Ammonites has no promise of restoration; for the Lord have spoken it.

11 And I will execute judgments upon Moab, and they shall know that I am the Lord.’ — and Moab, too, would suffer the same fate, no, not quite, as “and they shall know that I am the Lord,” indicates they will survive and come to acknowledge God.

12 “Thus saith the Lord God: ‘Because Edom hath dealt against the house of Judah by taking vengeance, and hath greatly offended and revenged himself upon them, because Edom hath dealt against the house of Judah by taking vengeance: the Edomites bore an old grudge against the Jews, not only because their father Jacob had got the birthright and blessing from their father Esau; but because they were made tributaries to them in David’s time, and afterwards severely chastised by Amaziah; these things they laid up in their minds, and vowed revenge whenever they had an opportunity; and now one offered at the destruction of Jerusalem, which they took;

Edom dwelt to the South of the house of Israel in ancient history; the book of Obadiah incorporates the prophecy of Edom in more details; but briefly here, it’s Spain and the Latinos, who live South of the children of Israel today.

13 therefore thus saith the Lord God: I will also stretch out Mine hand upon Edom and will cut off man and beast from it, and I will make it desolate from Teman; and they of Dedan shall fall by the sword.

— One other theory is that the Ottoman Turks (or today’s Turkey) are the sons of Teman. Perhaps they could be another branch.

14 And I will lay My vengeance upon Edom by the hand of My people Israel, and they shall do in Edom according to Mine anger and according to My fury; and they shall know My vengeance, saith the Lord God.’

Some nations that “clap thine hands and stamp your feet” when these happen again will get a Spanking so bad that their names will be remembered no more!

15 “Thus saith the Lord God: ‘Because the Philistines have dealt by revenge and have taken vengeance with a scornful heart to destroy it for the old hatred,

16 therefore thus saith the Lord God: Behold, I will stretch out Mine hand upon the Philistines, and I will cut off the Cherethites and destroy the remnant of the seacoast.

17 And I will execute great vengeance upon them with furious rebukes; and they shall know that I am the Lord, when I shall lay My vengeance upon them.’” — “and they shall know that I am the Lord,” indicates they will survive and come to acknowledge God; “when I shall lay my vengeance upon them”

they will see the hand of God in it, acknowledge his justice, and confess that their gods were idols, and that the God of Israel is the only true God.

Ezekiel 26

Coffman: Tyre, and its sister city Sidon, both in Lebanon, were pagan to the center of their existence. It was Jezebel, the daughter of Eth-Baal, king of the Sidonians, who brought the whole pagan institution into Israel in the days of Ahab, precipitating the contest with Elijah on Mount Carmel.

Incidentally, that development demonstrated the godless influence of Israel’s apostate kings and their foreign wives. Jezebel was the wife of Ahab.

1 And it came to pass in the eleventh year, on the first day of the month, that the word of the Lord came unto me, saying,

“Son of man, because Tyre hath said against Jerusalem, ‘Aha, she is broken that was the gates of the people; she is turned unto me; I shall be replenished, now she is laid waste,’ Son of man, because that Tyrus hath said against Jerusalem, aha…. as rejoicing at her destruction, and insulting over her in it; which was barbarous and inhuman, and resented by the Lord.

therefore thus saith the Lord God: Behold, I am against thee, O Tyre, and will cause many nations to come up against thee, as the sea causeth his waves to come up. and will cause many nations to come up against thee, as the sea causeth his waves to come up; the Chaldean army, consisting of soldiers of many nations; who for their number, noise, and fury, are compared to the raging waves of the sea;

— so the Targum says, “I will bring up against thee an army of many people, as the sea ascendeth in the raging of its waves.”

And they shall destroy the walls of Tyre and break down her towers. I will also scrape her dust from her, and make her like the top of a rock. Tyre, at that time the most famous city for trade and commerce in the world; and make her like the top of a rock means Tyre will be made barren.

It shall be a place for the spreading of nets in the midst of the sea, for I have spoken it, saith the Lord God; and it shall become a spoil to the nations.

And her daughters who are in the field shall be slain by the sword; and they shall know that I am the Lord. and they shall know that I am the Lord: and when they shall see all these things exactly accomplished, that the omniscient God could foretell events and come to their senses, thus they survive rather having their names remember no more.

“For thus saith the Lord God: Behold, I will bring upon Tyre Nebuchadnezzar king of Babylon, a king of kings from the north, with horses and with chariots and with horsemen and companies, and many people.

He shall slay with the sword thy daughters in the field; and he shall make a fort against thee, and cast a siege mound against thee, and lift up the buckler against thee.

And he shall set engines of war against thy walls, and with his axes he shall break down thy towers.

10 By reason of the abundance of his horses, their dust shall cover thee. Thy walls shall shake at the noise of the horsemen and of the wheels and of the chariots when he shall enter into thy gates, as men enter into a city wherein is made a breach.

11 With the hoofs of his horses shall he tread down all thy streets. He shall slay thy people by the sword, and thy strong garrisons shall go down to the ground. — Josephus wrote: “that Nebuchadnezzar besieged Tyre thirteen years,” before the fruits fell onto the ground. Tyre had a large fleet and were very rich with merchandise.

12 And they shall make a spoil of thy riches and make a prey of thy merchandise; and they shall break down thy walls and destroy thy pleasant houses; and they shall lay thy stones and thy timber and thy dust in the midst of the water. — and they shall make a spoil of thy riches…. the Chaldean army, when they entered the city, and got possession of it, would plunder it, and divide the riches of it among them.

13 And I will cause the noise of thy songs to cease, and the sound of thy harps shall be no more heard.

14 And I will make thee like the top of a rock; thou shalt be a place to spread nets upon. Thou shalt be built no more; for I the Lord have spoken it, saith the Lord God.

15 “Thus saith the Lord God to Tyre: Shall not the isles shake at the sound of thy fall, when the wounded cry, when the slaughter is made in the midst of thee?

16 Then all the princes of the sea shall come down from their thrones, and lay away their robes and put off their embroidered garments. They shall clothe themselves with trembling; they shall sit upon the ground, and shall tremble at every moment and be astonished at thee.

17 And they shall take up a lamentation for thee and say to thee: “‘How art thou destroyed, that wast inhabited by seafaring men, the renowned city, which wast strong in the sea, she and her inhabitants, who cause their terror to be on all that haunt it!

18 Now shall the isles tremble in the day of thy fall; yea, the isles that are in the sea shall be troubled at thy departure.’ Benson: shall not the isles shake at the sound of thy fall? all those that dwell upon the sea-coast near thee shall be thrown into a consternation at the news of thy being taken and destroyed;

— All the princes of the sea shall come down from their thrones All the princes and rich merchants (or the merchants who are as princes, as Isaiah speaks) of Zidon, Carthage, and other maritime cities that maintained a trade with Tyre, and got great wealth by that means, shall express a deep grief and concern for the fall of it;

— They shall clothe themselves with trembling With fear productive of trembling; or, they shall be afraid on every side, and full of fear and trembling;

— And they shall take up a lamentation for thee Shall bitterly bewail thy fall.

19 “For thus saith the Lord God: When I shall make thee a desolate city like the cities that are not inhabited, when I shall bring up the deep upon thee and great waters shall cover thee,

20 when I shall bring thee down with them that descend into the pit with the people of olden times, and shall set thee in the low parts of the earth, in places desolate of old with them that go down to the pit, that thou be not inhabited, and I shall set glory in the land of the living”

21 I will make thee a terror, and thou shalt be no more. Though thou be sought for, yet shalt thou never be found again, saith the Lord God.” — Oops, it seems here that Tyre “shalt be no more,” contrary to what verse 6 says. Perhaps verse 6 was meant for the time of Nebuchadnezzar, but here it’s the endtime? Any other possibilities?

Ezekiel (Ch 23-24)

•September 19, 2021 • Leave a Comment

Chapter 23 exposes the idolatries of Israel, or the ten tribes, under the name of Aholah, which they committed with the Assyrians, of whom they had learned them, are exposed, and their punishment for them is declared, then the idolatries of Judah, or the two tribes, under the name of Aholibah, are represented as greater than those of the ten tribes.

Ezekiel 23

1 The word of the Lord came again unto me, saying,

“Son of man, there were two women, the daughters of one mother,

and they committed whoredoms in Egypt; they committed whoredoms in their youth. There were their breasts pressed, and there they bruised the teats of their virginity. — “they played the harlot in Egypt …”; the proof of this is their apostasy with their reverence and worship of the Golden Calf which started in Egypt.

And the names of them were Oholah the elder and Oholibah her sister; and they were Mine, and they bore sons and daughters. Thus were their names: Samaria is Oholah, and Jerusalem, Oholibah. in allegory, Samaria is Israel or the ten tribes, under the name of Aholah, which they committed with the Assyrians, and their punishment for them is declared; and Aholibah represents the idolatries of Judah or the two tribes.

“And Oholah played the harlot when she was Mine; and she doted on her lovers, on the Assyrians her neighbors,

who were clothed with blue, captains and rulers, all of them desirable young men, horsemen riding upon horses.

Thus she committed her whoredoms with them, with all them that were the chosen men of Assyria and with all on whom she doted. With all their idols she defiled herself.

Neither left she her whoredoms brought from Egypt; for in her youth they lay with her, and they bruised the breasts of her virginity and poured their whoredom upon her.

Therefore I have delivered her into the hand of her lovers, into the hand of the Assyrians, upon whom she doted.

10 These uncovered her nakedness. They took her sons and her daughters and slew her with the sword; and she became notorious among women, for they had executed judgment upon her. for they had executed judgment upon her; that is, the Assyrians, who were the instruments in God’s hand in doing justice and inflicting judgments on her. God is the true executor in their Assyrian captivity, same as in 70 AD during the Jerusalem inferno.

11 “And when her sister Oholibah saw this, she was more corrupt in her inordinate love than she, and in her whoredoms more than her sister in her and in her whoredoms more than her sister in her whoredoms; guilty of more idolatries than the ten tribes, as in the times of Manasseh.

12 She doted upon the Assyrians her neighbors, captains and rulers clothed most gorgeously, horsemen riding upon horses, all of them desirable young men.

13 Then I saw that she was defiled, that they both took one way,

14 and that she increased her whoredoms. For when she saw men portrayed upon the wall, the images of the Chaldeans portrayed with vermilion,

15 girded with girdles upon their loins, exceeding in dyed attire upon their heads, all of them princes to look to, in the manner of the Babylonians of Chaldea, the land of their nativity—

16 and as soon as she saw them with her eyes, she doted upon them and sent messengers unto them into Chaldea.

17 And the Babylonians came to her into the bed of love, and they defiled her with their whoredom, and she was polluted with them, and her mind was alienated from them.

18 So she uncovered her whoredoms and uncovered her nakedness. Then My mind was alienated from her, as My mind was alienated from her sister.

19 Yet she multiplied her whoredoms in calling to remembrance the days of her youth, wherein she had played the harlot in the land of Egypt.

20 For she doted upon their paramours, whose flesh is as the flesh of asses and whose issue is like the issue of horses.

21 Thus thou called to remembrance the lewdness of thy youth, in bruising thy teats by the Egyptians for the paps of thy youth.”

22 “Therefore, O Oholibah, thus saith the Lord God: Behold, I will raise up thy lovers against thee from whom thy mind is alienated, and I will bring them against thee on every side:

23 the Babylonians, and all the Chaldeans, Pekod, and Shoa, and Koa, and all the Assyrians with them, all of them desirable young men, captains and rulers, great lords and renowned, all of them riding upon horses.

24 And they shall come against thee with chariots, wagons, and wheels, and with an assembly of people, who shall set against thee buckler and shield and helmet round about; and I will set judgment before them, and they shall judge thee according to their judgments. — and I will set judgment before them, and they (your enemies) shall judge thee according to their judgments;

— that is, I will deliver you into their hands, and they shall judge and condemn you; not according to my laws and yours, but according to their own laws, according to the customs and usages among them, according to the law of nations;

they shall deal with you as rebels and covenant breakers, such Zedekiah was: he broke the covenant with the king of Babylon, and rebelled against him: and this was fulfilled when he fell into his hands, and when he slew his children before his face, and then put out his eyes.

25 And I will set My jealousy against thee, and they shall deal furiously with thee. They shall take away thy nose and thine ears, and thy remnant shall fall by the sword. They shall take thy sons and thy daughters, and thy residue shall be devoured by the fire. Gill: they shall take away thy nose and thine ears, and thy remnant shall fall by the sword; as gallants use their harlots when they leave them, or jealous husbands their adulterous wives, disfiguring them, that they may be marked and known what they are, and be despised by others;

— as has been the custom in some countries, particularly with the Egyptians, to cut off the noses of adulterous persons; here it is to be understood figuratively: by the “nose”, is meant the king, who is higher than his people, as the nose is the highest part in a man’s face;

— and by the “ears” the priest, who caused a noise to be heard when he entered into the temple with his bells; or rather because it was the priest’s office to attend to the word of God, and teach it the people; in general, these denote everything that was excellent among the Jews, their city, temple, king, kingdom, princes, priests, and prophets, which should be demolished and removed;

— and by the remnant is meant the common people, that should come into the hands of the Chaldeans, and fall by their sword.

— so the Targum paraphrases it, “thy princes and thy nobles shall go into captivity, and thy people shall be killed with the sword:” they shall take thy sons and thy daughters, and thy residue shall be devoured by the fire; take and carry their sons and daughters captive, and burn with fire the city left by them.

that is, the city of Jerusalem, the temple, the king’s palaces, the houses of the great men, and others in it, which were all burnt with fire when taken by the Chaldeans, Jeremiah 52:13;

— and thy residue shall be devoured by the fire; so would all be consumed? No remnant at all? (more details at the end of this chapter).

26 They shall also strip thee out of thy clothes and take away thy fair jewels.

27 Thus will I make thy lewdness to cease from thee and thy whoredom brought from the land of Egypt, so that thou shalt not lift up thine eyes unto them, nor remember Egypt any more.

28 For thus saith the Lord God: Behold, I will deliver thee into the hand of those whom thou hatest, into the hand of those from whom thy mind is alienated, for thus saith the Lord God, I will deliver thee into the hand of them whom thou hatest…. historically the the Chaldeans and Babylonians, before loved by her, and doted upon, but now hated and rebelled against;

— but who are those enemies of the future? where they are to fall into similar hands; and this the Lord threatens to bring upon them for their sins; and he having said it, it might be performed; and it is to be repeated in the endtime.

29 And they shall deal with thee hatefully, and shall take away all thy labor and shall leave thee naked and bare; and the nakedness of thy whoredoms shall be uncovered, both thy lewdness and thy whoredoms.

30 I will do these things unto thee, because thou hast gone a whoring after the nations, and because thou art polluted with their idols.

31 Thou hast walked in the way of thy sister; therefore will I give her cup into thine hand.

32 “Thus saith the Lord God: “Thou shalt drink of thy sister’s cup deep and large; thou shalt be laughed to scorn and held in derision; it containeth much.

33 Thou shalt be filled with drunkenness and sorrow, with the cup of dismay and desolation, with the cup of thy sister Samaria.

34 Thou shalt even drink it and suck it out, and thou shalt break the shards thereof, and pluck off thine own breasts. For I have spoken it, saith the Lord God.

35 “Therefore thus saith the Lord God: Because thou hast forgotten Me and cast Me behind thy back, therefore bear thou also thy lewdness and thy whoredoms.”

36 The Lord said moreover unto me: “Son of man, wilt thou judge Oholah and Oholibah? Yea, declare unto them their abominations,

37 that they have committed adultery, and blood is on their hands; and with their idols have they committed adultery and have also caused their sons, whom they bore unto Me, to pass for them through the fire, to devour them.

38 Moreover this they have done unto Me: They have defiled My sanctuary on the same day and have profaned My Sabbaths. — notice the plural, Sabbaths; and instead of observing the Sabbaths, they observe by following the sun-worshipping Samaritans, where they observe the SUN; on SUNday; facing the East; their backs against the Temple;

39 For when they had slain their children to their idols, then they came the same day into My sanctuary to profane it; and lo, thus have they done in the midst of Mine house.

And He brought me into the inner court of the Lord’S house, and behold, at the door of the temple of the Lord, between the porch and the altar, were about five and twenty men with their backs toward the temple of the Lord and their faces toward the east; and they worshiped the sun toward the east. Ezekiel 8:16

Others, the Church of God Communities would always have their “wavesheaf offering” and Pentecost on a SUNday, Whitsundays.

40 And furthermore, ye have sent for men to come from far, unto whom a messenger was sent; and lo, they came, for whom thou didst wash thyself, painted thy eyes, and decked thyself with ornaments, Gill: for whom thou didst wash thyself, paintedst thy eyes, and deckedst thyself with ornaments; just as harlots do to make themselves agreeable to their lovers;

who use washes and paint, as Jezebel did, and dress themselves in their best clothes, and adorn themselves in the best manner they can. Harlots had their particular attire, by which they were known, Proverbs 7:10

41 and sattest upon a stately bed, and a table prepared before it, whereupon thou hast set Mine incense and Mine oil.

42 And a voice of a multitude being at ease was with her; and with the men of the common sort were brought Sabeans from the wilderness, who put bracelets upon their hands and beautiful crowns upon their heads.

43 “Then said I unto her that was old in adulteries: ‘Will they now commit whoredoms with her, and she with them?’

44 Yet they went in unto her, as they go in unto a woman that playeth the harlot; so went they in unto Oholah and unto Oholibah, the lewd women.

45 And the righteous men, they shall judge them after the manner of adulteresses and after the manner of women that shed blood, because they are adulteresses and blood is in their hands.

46 “For thus saith the Lord God: I will bring up a company upon them, and will give them to be removed and despoiled.

47 And the company shall stone them with stones and dispatch them with their swords. They shall slay their sons and their daughters, and burn up their houses with fire. they shall slay their sons and their daughters; when they broke into the city, and took it; or when they found them making their escape, and hiding themselves in secret places;

and burn up their houses with fire; as they did; the temple, the king’s palace, the houses of noblemen, and all the houses in Jerusalem; see Jeremiah 52:13.

48 Thus will I cause lewdness to cease out of the land, that all women may be taught not to do according to your lewdness.

49 And they shall recompense your lewdness upon you, and ye shall bear the sins of your idols; and ye shall know that I am the Lord God.”

~~~

More on verse 25. Since Ezekiel’s message is for the endtime and meant for the house of Israel, which is the United States and its European allies and “thy remnant shall fall by the sword.” — if those remnant are put to the sword, then no more will be left, reaffirming there is no place of safety for those hopeful to have one.

But wait, this apparently contradicts Ezekiel 23:25, where “I will leave a few men of them from the sword . . . that they may declare all their abominations among the nations.

Or, after testifying all their abominations to the nations, then they are put down by the sword? A remnant of martyrs?

Your thoughts for this apparent contraction, please; thanks. Or indeed a remnant of martyrs is on its way?

Ezekiel 24

This chapter of destruction of the city and temple of Jerusalem is prophesied here; but as said before, it is meant for the house of Israel at the endtime. By the sign of flesh boiling in a pot are shown the miseries that would come; and by the sign of Ezekiel’s being forbidden to mourn for the sudden death of his wife is that the calamities coming on the captives would be so astonishing as to exceed all expressions of sorrow.

1 Again, in the ninth year, in the tenth month, on the tenth day of the month, the word of the Lord came unto me, saying,

“Son of man, write thee the name of the day, even of this same day: The king of Babylon set himself against Jerusalem this same day. — although this parable is set “against Jerusalem,” this message is meant for the house of Israel which is the United States and its European allies.

And utter a parable unto the rebellious house, and say unto them, ‘Thus saith the Lord God: Set on a pot, set it on, and also pour water into it.

Gather the pieces thereof into it, even every good piece — the thigh and the shoulder. Fill it with the choice bones.

Take the choice of the flock, and burn also the bones under it; and make it boil well, and let them boil the bones of it therein. — Coffman: analogies clearly visible in this parable: the cauldron is the city; the flesh in it is the people; the immense fire under it is the fire of war; the setting of the cauldron on the fire is the beginning of the siege;

the rust in the pot (introduced later) is the inherent wickedness of the people; the “choice bones (Ezekiel 24:4)” are the bones with meat attached to them; their being “choice” bones indicates that the nobility and the landed gentry will also be ruined by the war; the “bones under the caudron (Ezekiel 24:5)” are the large bones used, along with the logs for fuel;

the removal of the flesh from the cauldron indicates the destruction of the whole city, rich and poor alike, high and low, indiscriminately, whether by sword, by pestilence, by famine, or by deportation;

the emptying of the cauldron indicated the removal of Jerusalem’s population; the cauldron’s still being rusted indicated Jerusalem’s worthlessness, at that time, as regarded God’s eternal purpose, entailing, of course, the necessity for its complete destruction;

the severe burning of the cauldron in intense fire after it was emptied speaks of the burning and destruction of the city itself and the Temple of God.

“‘Therefore thus saith the Lord God: Woe to the bloody city, to the pot whose scum is therein and whose scum is not gone out of it! Bring it out piece by piece; let no lot fall upon it. scum is extraneous matter or impurities risen to or formed on the surface of a liquid often as a foul filmy covering.

— Gill: to the pot whose scum is therein, and whose scum is not gone out of it; when a pot boils, a scum arises, and appears upon the top of the water, which the cook usually takes off:

this denotes the filthiness and wickedness of the people, which would work up and be seen by the judgments of God upon them; yet should not be removed, but continue on them, unrepented of, and unpardoned. It signifies that they would remain hardened in their sins;

and that the judgments of God would have no effect upon them to bring them to repentance; and that God would have no mercy on them, or pardon their sins.

For her blood is in the midst of her; she set it upon the top of a rock; she poured it not upon the ground, to cover it with dust. she set it upon the top of a rock; where it could not soak in, as when spilled upon soft earth: this denotes her openness and impudence in shedding blood, as not being ashamed of it, or afraid of punishment for it,

but as rather glorying in it; perhaps there may be some allusion to the tops of hills and mountains, where idolatry was committed, attended with shedding human blood:

she poured it not upon the ground, to cover it with dust; she did not take any methods to hide her sin; having no sense of the heinousness of it, nor any consciousness of guilt, or any remorse or repentance; respect is had to a law which obliged to cover blood shed with dust, Leviticus 17:13;

— the Targum of the whole is, “because innocent blood which is shed in the midst of her; with pride and with a high arm she shed it; she shed it not through ignorance, that she might repent of it.”

That it might cause fury to come up to take vengeance, I have set her blood upon the top of a rock, that it should not be covered.

“‘Therefore thus saith the Lord God: Woe to the bloody city! I will even make the pile for fire great.

10 Heap on wood, kindle the fire, consume the flesh, and spice it well, and let the bones be burned.

11 Then set it empty upon the coals thereof, that the brass of it may be hot and may burn, and that the filthiness of it may be molten in it, that the scum of it may be consumed.

12 She hath wearied herself with lies, and her great scum went not forth out of her; her scum shall be in the fire.

13 In thy filthiness is lewdness. Because I have purged thee and thou wast not purged, thou shalt not be purged from thy filthiness any more, till I have caused My fury to rest upon thee.

14 I, the Lord, have spoken it: it shall come to pass, and I will do it. I will not go back, neither will I spare, neither will I repent. According to thy ways and according to thy doings shall they judge thee, saith the Lord God.’”

15 Also the word of the Lord came unto me, saying,

16 “Son of man, behold, I take away from thee the desire of thine eyes with a stroke; yet neither shalt thou mourn nor weep, neither shall thy tears run down. I take away from thee the desire of thine eyes with a stroke; meaning his wife; who very probably was of a beautiful countenance;

— this lovely object of his affection the Lord signifies he would take away from him by death unto himself; that is, suddenly and at once;

and so the Syriac and Arabic versions render it, “with a sudden stroke”; as sometimes persons are struck with death at once with an apoplexy or palsy;

the Targum renders it, with the pestilence; it was what the Jews call death by the hand of heaven, by the immediate hand of God; and, it may be, without any intervening disease; or, however, without any train of disorders which lead on to death.

17 Forbear to cry. Make no mourning for the dead. Bind the attire of thine head upon thee, and put on thy shoes upon thy feet, and cover not thy lips, and eat not the bread of men.”

18 So I spoke unto the people in the morning, and at evening my wife died; and I did in the morning as I was commanded. and at even my wife died; suddenly, as it was said she should; this shows who is meant by the desire of his eyes, and what by the taking it away;

— and I did in the morning as I was commanded; neither moaned, nor sighed, nor wept, nor shed a tear, nor used any of the common ceremonies of mourning, but dressed and ate as at other times, as he was ordered to do; this was the next morning after his wife died.

19 And the people said unto me, “Wilt thou not tell us what these things are to us, that thou doest so?”

20 Then I answered them, “The word of the Lord came unto me, saying,

21 Speak unto the house of Israel, ‘Thus saith the Lord God: Behold, I will profane My sanctuary, the excellency of your strength, the desire of your eyes, and that which your soul pitieth; and your sons and your daughters whom ye have left shall fall by the sword. — thus saith the Lord of hosts, behold, I will profane my sanctuary; the temple, built for him, and where he dwelt, and was worshipped; where duties performed and holy sacrifices offered up formerly;

this he says he would profane, that is, would bring the Chaldeans against Jerusalem, who should take and enter the temple, and so profane it, and make it common, yea, utterly destroy it;

but how would this parallel in the future? New York city? London? Paris?

22 And ye shall do as I have done: Ye shall not cover your lips, nor eat the bread of men.

23 And your attires shall be upon your heads and your shoes upon your feet. Ye shall not mourn nor weep, but ye shall pine away [meaning: to become thin and weak because of sadness or loss] for your iniquities and mourn one toward another.

24 Thus Ezekiel is unto you a sign: according to all that he hath done shall ye do. And when this cometh, ye shall know that I am the Lord God.’

25 “Also, thou son of man, shall it not be on the day when I take from them their strength, the joy of their glory, the desire of their eyes, and that whereupon they set their minds, their sons and their daughters,

26 that he that escapeth on that day shall come unto thee to cause thee to hear it with thine ears? — Rashi: on that day, it is impossible for the fugitive to come on the day of the destruction. Therefore this is the meaning: On that day that the fugitive will come to you to let you hear [of the destruction] with your own ears, on that day, your mouth will be opened;

to let you hear with your own ears: to announce the news that the city has been struck.

27 On that day shall thy mouth be opened to him who has escaped, and thou shalt speak and be no more dumb. And thou shalt be a sign unto them, and they shall know that I am the Lord.” — Peake: Ezekiel 3:22:  A Period of Silence — the Divine voice seems to decree for Ezekiel a period of temporary silence and inactivity. Perhaps Ezekiel 3:25 should read, “ I will lay bands on thee and bind thee”: at any rate, he is restrained in some way, whether, as some suppose, by some physical disability (e.g. catalepsy) or merely by the angry incredulity of his hearers, from proclaiming his message in public. He does not open his mouth, except in his own house to those who consult him privately (cf. Ezekiel 8:1), until his message is confirmed by the fall of Jerusalem (Ezekiel 33:21).

— Benson: In that day shall thy mouth be opened to him that is escaped; this implied, that the prophet was to prophesy no more about the affairs of Jerusalem and Judah till after the destruction of the city and temple; when the fulfilling of this part of his predictions, so contrary to the expectations of those who despised his prophecies, would give him more credit with them, and make them pay a higher regard to what other things he should prophesy of. According to this we find, that the spirit of prophecy, in regard to the affairs of Judea, did not come on him again till the news of the taking of Jerusalem was brought to him. See Ezekiel 3:21-27;

— Kretzmann: and I will make thy tongue cleave to the roof of thy mouth, before the very eyes of the rebellious people, that thou shalt be dumb and shalt not be to them a reprover [someone who finds fault or imputes blame], lest the words of his reproof might win the self-hardened sinners back; for they are a rebellious house, confirming themselves in their apostasy and obstinacy;

— v 27: But when I speak with thee, I will open thy mouth, in revealing the judgment of God upon his countrymen, and thou shalt say unto them, Thus saith the Lord God, He that heareth, let him hear, and he that forbeareth, let him forbear; for they are a rebellious house, and therefore would have only themselves to blame for the calamity which would surely strike them.

— every watchman in the midst of his congregation has a tremendous responsibility resting upon him, both in calling sinners to repentance and in warning believers against the ways of unrighteousness. One negligent in this duty is a murderer of fellow human beings.

Ezekiel (Ch 21-22)

•September 18, 2021 • Leave a Comment

Earlier, we have established that although Ezekiel has his face set toward Jerusalem, this prophecy is meant for the house of Israel at the endtime “for many years to come” (Ezekiel 12:27). Here, he is re-emphasizing the “Sword.” in fact, the word “Sword” occurs fourteen times in this chapter alone, being repeated over and over again, doubled and thrice for its significance. And remember, this prophecy is meant for the house of Israel which is primarily the United States of America, and secondarily its European allies. . .

Ezekiel 21

1 And the word of the Lord came unto me, saying,

“Son of man, set thy face toward Jerusalem, and drop thy word toward the holy places, and prophesy against the land of Israel; — “against the land of Israel”; this message for the house of Israel is meant for the United States and its European allies.

and say to the land of Israel, ‘Thus saith the Lord: Behold, I am against thee, and will draw forth My sword out of his sheath and will cut off from thee the righteous and the wicked. — and will draw forth my sword out of his sheath; a similar situation occurred to ancient Judah when the Chaldean army rushed out of Babylon into Judea and made the inhabitants captives. Poor thing, the righteous will also be “cut off” among the wicked; there is no place of safety that many among the endtime pretentious are hoping for.

Seeing then that I will cut off from thee the righteous and the wicked, therefore shall My sword go forth out of his sheath against all flesh from the south to the north, — his sheath against all flesh from the South to the North; oh, okay, this might give us a clue what “toward the South” and “kindle a fire in thee. . . from the South” are meant at the end of the preceding chapter.

— this Sword will come from the South! This is serious! It’s not just unwanted immigrants, these are warriors, conquering warriors set to slaughter!! For those in Europe, they might come from the whole of Africa; and for the United States, they might come from the whole South, all the Latinos of South America! And “against all flesh;”

— (and flaming flame in chapter 20:47) but in this chapter a subtle change: “My Sword go forth out of his sheath against all flesh from the South to the North.”

— all will die? Okay I might be taken away and over the top, but then again, why so much emphasis of the Sword in this chapter?

— Jonathan renders: Spain (Rashi quoting the Targum: Sepharad shall inherit the cities of the Southland as Spain); the Targums identified Sepharad with Spain, hence, Spanish Jews are called Sephardim;

— Wikipedia: Sepharad (/sɛfəræd/or səˈfɛərəd/ Hebrew: סְפָרַד Sp̄āraḏ; also Sefarad, Sephared, Sfard) is the Hebrew name for Spain. A place called Sepharad, probably referring to Sardis in Lydia (‘Sfard’ in Lydian), in the Book of Obadiah (Obadiah 1:20, 6th century BC) of the Hebrew Bible. The name was later applied to Spain.

that all flesh may know that I, the Lord, have drawn forth My sword out of his sheath. It shall not return any more.’ — see, more about the Sword! it shall not return any more; that is, into its sheath, until it has done all its work; meaning that the invading army should not return to their own land until they had executed the whole will of God upon the endtime house of Israel; this is the fire that should not be quenched.

— one Report by McKinsey says of the 60 millions Latinos in US that had migrated from the South; they often live in ‘deserts’ where adequate housing, groceries are hard to find. “Nearly 9 in 10 of the Latino residents in such communities lived in five states: California, Florida, New Jersey, New York and Texas.”

McKinsey: Latinos are projected to make up 22.4 percent of the US labor force by 2030 and more than 30 percent by 2060 (Latinos population to 111.2 million by ’60); is this analysis wrong? Am I mistaken? Do feel free to present your opinion; thanks.

Sigh therefore, thou son of man, with the breaking of thy loins [‘hearts’ in other versions], and with bitterness sigh before their eyes. — sigh, therefore, thou son of man, with the breaking of thy loins…. as if thy loins were broke, and go as if they were, and sigh as thou goest; or as a woman in travail, having her hands upon her loins as ready to break, and in the utmost distress; or heave, and groan, and sigh, till the girdle of the loins is broke, and by these motions and gesture show the miserable state of this people, and how much thou art affected with it.

And it shall be, when they say unto thee, ‘Why sighest thou?’ that thou shalt answer, ‘For the tidings, because it cometh; and every heart shall melt, and all hands shall be feeble, and every spirit shall faint, and all knees shall be weak as water.’ Behold, it cometh, and shall be brought to pass, saith the Lord God.” — ‘why sighest thou?’ . . . because it cometh”; the report of an invading army, approaching and besieging their land, the land of Israel, which Ezekiel had from the Lord; and the thing itself was just at hand, and would certainly be so bad; that was the issues that affected him, and caused so much sorrow and sighing.

Again the word of the Lord came unto me, saying,

“Son of man, prophesy and say, ‘Thus saith the Lord. Say: “‘A sword, a sword is sharpened and also furbished! — a sword, a sword, it is sharpened, and also furbished; it is sharpened that it may make a slaughter; it is furbished that it may be as lightning: the rod for the house of Israel. And it is given to be furbished, that it may be handled: the sword, it is sharpened, yea, it is furbished, to give it into the hand of the slayer.

10 It is sharpened to make a sore slaughter; it is furbished that it may glitter. Should we then make mirth? It contemneth the rod of My son, as every tree.

11 “‘And he hath given it to be furbished, that it may be handled; this sword is sharpened, and it is furbished to give it into the hand of the slayer.

12 Cry and howl, son of man! For it shall be upon My people; it shall be upon all the princes of Israel. Terrors by reason of the sword shall be upon My people; smite therefore upon thy thigh. — cry and wail, son of man; for it is upon my people, it is upon all the princes of Israel: they are delivered over to the sword with my people; smite therefore upon thy thigh;

smite therefore upon thy thigh; as one grieved in spirit, in great distress and anguish, as experienced by Jeremiah:

Surely after I was turned, I repented; and after I was instructed, I smote upon my thigh. I was ashamed, yea, even confounded, because I bore the reproach of my youth.’ Jeremiah 31:19.

13 Because it is a trial, and what if the sword contemn even the rod? It shall be no more, saith the Lord God.’ — and what if the sword contemn even the rod?; here God foretels, that if the house of Israel should despise, or not accept the correction or punishment brought upon them by the trial, the house of Israel would be entirely broken, and be no more. Serious stuff!

14 “Thou therefore, son of man, prophesy, and smite thine hands together; and let the sword be doubled the third time, the sword of the slain. It is the sword of the great men that are slain, which entereth into their secret chambers. — and smite thine hands together; the meaning of the clapping of the hands, smiting the hands together is an indication of violent grief; normally accompanied by the loud crying and wailing.

— “Let the sword be doubled the third time…”; this shows the tremendous size and power of the sword coming against the house of Israel. All hope of escape are gone.

— which entereth into their privy chambers; where they should endeavour to hide themselves from it, but in vain, none should escape; their privy chambers could not secrete nor secure them: or “which remains with them”; as that which is laid up, and reserved in a privy chamber.

15 I have set the point of the sword against all their gates, that their heart may faint and their ruins be multiplied. Ah! It is made bright; it is sharpened for the slaughter. Gill: I have set the point of the sword against all their gates…. the word rendered “point” is nowhere else used, and is differently translated: by some the “fear” of the sword; by others the “cry” of the sword, or of those that are slain with it, as the Targum paraphrases it, “those that slay with the sword.”

16 Go thee one way or other, either on the right hand or on the left, whithersoever thy face is set.

17 I will also smite Mine hands together, and I will cause My fury to rest. I, the Lord, have said it.” — I will also smite my hands together In token of my encouragement. I will animate and encourage the slayers to go on. God even said He needs to express His fury so He could find rest; the Targum says, “and even I will bring vengeance upon vengeance.”

18 The word of the Lord came unto me again, saying,

19 “Also, thou son of man, appoint thee two ways that the sword of the king of Babylon may come; both shall come forth out of one land. And choose thou a place; choose it at the head of the way to the city.

20 Appoint a way, that the sword may come to Rabbah of the Ammonites and to Judah in Jerusalem, the fortified.

21 For the king of Babylon stood at the parting of the way, at the head of the two ways, to use divination: he made his arrows bright, he consulted with images, he looked at the liver.

22 At his right hand was the divination for Jerusalem: to appoint captains, to open the mouth in the slaughter, to lift up the voice with shouting, to appoint battering rams against the gates, to cast a siege mound, and to build a fort.

23 And it shall be unto them as a false divination in their sight, to them that have sworn oaths; but he will call to remembrance the iniquity, that they may be taken.

24 “Therefore thus saith the Lord God: ‘Because ye have made your iniquity to be remembered, in that your transgressions are discovered, so that in all your doings your sins do appear — because, I say, that ye have come to remembrance, ye shall be taken with the hand.

25 And thou, profane, wicked prince of Israel, whose day is come when iniquity shall have an end, — the details given in the above few verses were about ancient Judah and its invasion, but Ezekiel’s message is for the endtime. Such details are written in coded language and only God knows what all these messages are to play out; so we may have to observe how world events eventuates in the next couple of years;

— which means these comments will need to be updated every now and then. Be patient, we’ll all get there.

26 thus saith the Lord God: “‘Remove the diadem and take off the crown; this shall not be the same. Exalt him that is low, and abase him that is high; thus saith the Lord God, remove the diadem, and take off the crown…. that is, from Zedekiah; and as these are the regalia and ensigns of royal dignity, taking them off signifies the deposition of him as a king;

— “exalt him that is low” is to exalt the Zarah line (from Pharez line). For more details, see “Judah’s Sceptre and Joseph’s Birthright” by J.H. Allen.

27 I will overturn, overturn, overturn it. And it shall be no more, until He come whose right it is; and I will give it to Him.’ — Jerusalem to Ireland, to Scotland and then finally to England; until he come whose right it is; the right of the crown and final king of Israel as scepter holder; also the Messiah, being descended from a race of kings of the house of Judah, and of the seed of David.

28 “And thou, son of man, prophesy and say, ‘Thus saith the Lord God concerning the Ammonites and concerning their reproach; even say thou: “‘The sword, the sword is drawn; for the slaughter it is furbished to consume because of the glittering” — this prophecy against Ammon has no promise of restoration. Why? We might speculate why the Ammonites were singled out here for this special oracle; but it might have pertained to the share they had in the murder of Gedaliah, by the hand of Ishmael and the Ammonites gave these killers refuge;

— second, in historic time, when Nebuchadnezzar took his route to Jerusalem, and destroyed the city, returned to Babylon, he went about without making any attempt upon the Ammonites; which so flushed the Ammonites that they insulted the Jews and laughed at their destruction, as if their God whom they served could not save them;

— and perhaps thirdly, the Ammonites are modern Jordan, sitting on land allocated to three of the tribes of Israel, and they maybe taking their ancestral land back, land that could even stretch to the Euphrates River.

29 while they see vanity unto thee, while they divine a lie unto thee, to bring thee upon the necks of them that are slain, of the wicked whose day is come when their iniquity shall have an end.

30 Shall I cause it to return into his sheath? I will judge thee in the place where thou wast created, in the land of thy nativity.

31 And I will pour out Mine indignation upon thee; I will blow against thee in the fire of My wrath, and deliver thee into the hand of brutish men, and skillful to destroy.

32 Thou shalt be for fuel to the fire; thy blood shall be in the midst of the land. Thou shalt be no more remembered; for I the Lord have spoken it.’” — thy blood shall be in the midst of the land; such large numbers shall be slain everywhere, that the land shall flow with the blood of them; who shall lie unburied, and rot, and putrefy upon the ground:

— and thou shalt be remembered no more. This prophecy against Ammon and the Ammonites has no promise of restoration; for the Lord have spoken it.

Ezekiel 22

In Chapter 10, God’s four judgments — SWORD, war. FAMINE, occasioned by drought. PESTILENCE, epidemic diseases which sweep off a great part of the inhabitants of a land. And in this chapter it is BLOOD! BLOOD is used 8 times.

1 Moreover the word of the Lord came unto me, saying,

“Now, thou son of man, wilt thou judge, wilt thou judge the bloody city? Yea, thou shalt show her all her abominations. the bloody city?… or, “city of blood” or “cities of blood” as in the United States with so much gun violence.

Then say thou, ‘Thus saith the Lord God: The city sheddeth blood in the midst of it, that her time may come, and maketh idols against herself to defile herself.

Thou art become guilty in thy blood that thou hast shed, and hast defiled thyself in thine idols which thou hast made; and thou hast caused thy days to draw near, and art come even unto thy years. Therefore have I made thee a reproach unto the nations and a mocking to all countries. — “I have made thee a reproach among the nations …” this is a prophecy of what will soon happen, as indicated in the future tense used in the next verse, “Those that are near, and those that are far from thee, shall mock thee.”

Those that are near and those that are far from thee shall mock thee, who art infamous and much vexed.

“‘Behold, the princes of Israel, every one was in thee to their power to shed blood. — behold, the princes of Israel…. those that belonged to the royal family, the rich and nobles of the land, members of Parliament of Congress of a nation.

In thee have they made light of father and mother. In the midst of thee have they dealt by oppression with the stranger. In thee have they vexed the fatherless and the widow. — in thee have they vexed the fatherless and the widow; that were weak and helpless, and had none to protect them, father and husband being dead; when, according to their first rank and station as princes, they ought to have been the defenders of them; but, instead of that, distressed, afflicted, and grieved them.

Thou hast despised Mine holy things and hast profaned My Sabbaths. thou hast despised mine holy thing…. the holy place, the temple, and the worship of it; holy persons, the priests that officiated there; holy sacrifices offered up by them; the holy word of God read and explained; and all holy ordinances there administered. These words are directed to Jerusalem, the holy city, and to the inhabitants of it, who ought to have been holy men;

and hast profaned my sabbaths; by doing their own work, and neglecting the service of God; and which was an inlet, as it usually is, to all manner of sin.

In thee are men that carry tales to shed blood, and in thee they eat upon the mountains. In the midst of thee they commit lewdness [indecency or obscenity]. in the midst of thee they commit lewdness; a general word for all manner of uncleanness, as adultery, fornication, incest, etc.

10 In thee have they uncovered their fathers’ nakedness. In thee have they humbled her that was set apart for pollution.

11 And one hath committed abomination with his neighbor’s wife, and another hath lewdly defiled his daughter-in-law, and another in thee hath humbled his sister, his father’s daughter.

12 In thee have they taken gifts to shed blood. Thou hast taken usury and increase, and thou hast greedily gained from thy neighbors by extortion, and hast forgotten Me, saith the Lord God. Gill: In thee have they taken gifts to shed blood….

— innocent blood, as the Targum says; judges upon the bench, whose office it is to take the part of the innocent, and clear him from unjust charges; and protect him from the violence of wicked and unreasonable men; that lay things to his charge, which, if true, would require blood;

and yet men in such offices took bribes to bring in the innocent guilty, and pass sentence of death on him; which is a most shocking iniquity indeed: to take bribes in pecuniary matters is very wicked; but to do it in cases which affect life is most dreadfully cruel: or if it is to be understood of such persons who take bribes to bear false witness against a man, to the taking away of his life, it is a very heinous and detestable sin; for, as for a set of jurymen bribed to bring in a wrong verdict, which would be equally a most enormous crime.

13 “‘Behold, therefore I have smitten Mine hand at thy dishonest gain which thou hast made and at thy blood which hath been in the midst of thee. behold, therefore, I have smitten mine hand at thy dishonest gain which thou hast made…. as one amazed at it; or as filled with indignation against it; or as grieved and distressed at it; or else as rejoicing at the punishment going to be inflicted on them for it;

— so the Septuagint renders it, “I will bring my hand upon them;” and the Targum,”behold, I will bring my vengeance upon thee for the sins of mammon.”

14 Can thine heart endure or can thine hands be strong in the days that I shall deal with thee? I, the Lord, have spoken it, and will do it.

15 And I will scatter thee among the nations and disperse thee in the countries, and will consume thy filthiness out of thee. — to be scattered and dispersed throughout various provinces of other nations, as chaff is by the winds.

16 And thou shalt take thine inheritance in thyself in the sight of the nations, and thou shalt know that I am the Lord.’”

17 And the word of the Lord came unto me, saying,

18 “Son of man, the house of Israel has to Me become dross [something regarded as worthless; rubbish]. All they are brass and tin and iron and lead in the midst of the furnace; they are even the dross of silver.

19 Therefore thus saith the Lord God: ‘Because ye have all become dross, behold, therefore I will gather you into the midst of Jerusalem.

20 As they gather silver and brass and iron and lead and tin into the midst of the furnace, to blow the fire upon it to melt it, so will I gather you in Mine anger and in My fury, and I will leave you there and melt you. several metals of the baser sort are here mentioned, by a gradation from the better to the worse; tin being not so good as brass, and iron of less value than either, and lead than any of them.

21 Yea, I will gather you and blow upon you in the fire of My wrath, and ye shall be melted in the midst thereof. and I will leave you there, and melt you; that is, I will leave you to the sword, famine, and pestilence, to be destroyed by them; or with fire at the burning of the city: or, “I will rest”; as the refiner does; having put his metal into the furnace, and blown the fire, sits still till all is melted.

22 As silver is melted in the midst of the furnace, so shall ye be melted in the midst thereof; and ye shall know that I, the Lord, have poured out My fury upon you.’”

23 And the word of the Lord came unto me, saying,

24 “Son of man, say unto her: ‘Thou art the land that is not cleansed nor rained upon in the day of indignation.’

25 There is a conspiracy of her prophets in the midst thereof, like a roaring lion ravening the prey. They have devoured souls; they have taken the treasure and precious things; they have made her many widows in the midst thereof.

26 Her priests have violated My law and have profaned Mine holy things. They have put no difference between the holy and profane, neither have they shown difference between the unclean and the clean, and have hid their eyes from My Sabbaths, and I am profaned among them.

27 Her princes in the midst thereof are like wolves ravening the prey, to shed blood and to destroy souls, to get dishonest gain.

28 And her prophets have daubed them with untempered mortar, seeing vanity and divining lies unto them, saying, ‘Thus saith the Lord God,’ when the Lord hath not spoken. — saying, thus saith the Lord God, when the Lord hath not spoken; herein mimicking the true prophets, who came in the name of the Lord, and usually prefaced their prophecies with a thus saith the Lord; and so did these false prophets, when the Lord said nothing to them, and gave them no commission to speak in his name, or say the things they did.

29 The people of the land have used oppression and exercised robbery, and have vexed the poor and needy; yea, they have oppressed the stranger wrongfully.

30 And I sought for a man among them that should make up the hedge and stand in the gap before Me for the land, that I should not destroy it; but I found none. but I found none; no reformer of them, no repairer of the breach, nor restorer of paths, to dwell in; no intercessor for them, as Abraham for Sodom, Moses for Israel; or any, like Aaron, that stood between the living and the dead to stay the plague.

31 Therefore have I poured out Mine indignation upon them; I have consumed them with the fire of My wrath. Their own way have I recompensed upon their heads, saith the Lord God.” — I have consumed them with the fire of my wrath; by the sword, famine, pestilence, and captivity.

Ezekiel (Ch 19-20)

•September 16, 2021 • Leave a Comment

Chapter 19 starts with a riddle of a lioness with her two whelps among other young lions. So what does each of them represent? The riddle seems to be a prophecy over the complexities of the house of Israel and the royal house of Judah spread out over the next two and a half thousands years. The scepter, which belongs to the royal house of Judah, are mentioned only twice in the book of Ezekiel, but both in this chapter. And earlier, we have established that this Ezekiel prophecy was for a time far into the future (Ezekiel 12:27). In fact it’s for the endtime, our time, and so here it is.

Coffman commented that this chapter is a dirge (a lament for the dead, especially one forming part of a funeral rite) written by Ezekiel as a prophetic funeral for the earthly end of the House of David. As Cooke stated it:

“Ezekiel could write fine poetry when he chose; and on this occasion the impulse came from a mixed emotion, his pride in the royal house of Judah, and his pity for the misfortunes of the young princes.”

Ezekiel 19

1“Moreover take thou up a lamentation for the princes of Israel, — so this chapter is a lamentation; notice it started at the beginning with a lamentation and at the end it says: “This is a lamentation and shall be a lamentation,” for the princes of Israel; but who are the princes of Israel?

and say: “‘What is thy mother? A lioness: she lay down among lions; she nourished her whelps among young lions. this indicates an original royal family that had spread her wings over many nations.

And she brought up one of her whelps; it became a young lion, and it learned to catch the prey; it devoured men.

The nations also heard of him; he was taken in their pit, and they brought him with chains unto the land of Egypt. — this young lion could well be Joseph, who was sold as a slave into Egypt, later his sons were to led the house of Israel, headed by Ephraim, the younger yet the ‘firstborn’ of Joseph.

Now when she saw that she had waited, and her hope was lost, then she took another of her whelps, and made him a young lion. — the house of Israel, headed by Ephraim, went into captivity, the lioness waited but her hope was lost as this young lion never came back. . . so her hope now lies with another whelp; the house of Judah.

And he went up and down among the lions; he became a young lion, and learned to catch the prey and devoured men. — the house of Judah grew and became a nation.

And he knew their desolate palaces, and he laid waste their cities; and the land was desolate and the fullness thereof by the noise of his roaring.

Then the nations set against him on every side from the provinces, and spread their net over him; he was taken in their pit. — first the Assyrians came to lay a siege against the house of Judah but they were repelled off. A while later the Chaldeans came and managed to conquer this young nation.

And they put him under guard in chains (put him in a cage as some versions say), and brought him to the king of Babylon. They brought him into prison, that his voice should no more be heard upon the mountains of Israel. — this young lion, “brought to the king of Babylon,” is clearly established to be house of Judah, the scepter holder, but its royal family had vanished;

— no more be heard upon the mountains of Israel; but yes, upon a hill of Israel: Ireland.

10 “‘Thy mother is like a vine in thy blood, planted by the waters; she was fruitful and full of branches by reason of many waters. — thy mother is like a vine in thy blood; having royal blood, this lioness is the royal family that had established herself over many nations.

11 And she had strong rods for the scepters of them that bore rule; and her stature was exalted among the thick branches, and she appeared in her height with the multitude of her branches. — a rod or scepter is an emblem of authority; with numerous offspring and prosperity this royal family would split and spread into numerous other royal families that ruled over many nations in western Europe.

12 But she was plucked up in fury; she was cast down to the ground, and the east wind dried up her fruit. Her strong rods were broken and withered; the fire consumed them. — many of the royal families were overcame “cast down” by revolutions: – France (1830), Portugal (1910), Russia (1917), Germany (1918), Hungary (1918), Italy (1946), Romania (1947), Greece (1974); – they withered and fire consumed them.

13 And now she is planted in the wilderness, in a dry and thirsty ground. — a few royal families remains, planted on dry and thirsty ground; powerless and without authority and in name only: Britain, Denmark, Belgium, Netherlands, Norway, Spain.

14 And fire has gone out from a rod of her branches, which hath devoured her fruit, so that she hath no strong rod to be a scepter to rule.’ This is a lamentation, and shall be for a lamentation.” — and fire is gone out of a rod of her; this speaks of the destruction of the royal family; she hath no strong rod; few of the royal blood of Judah or only weak ones will be left. And from that time onward, perhaps, no new royals would ever sat upon the throne of Israel;

— those that remains would end up in captivity too as fire would consume them. Dark days also lay ahead for their children as fire is ready to devour them as it devours her fruit. As the catastrophe shall be so complete, there will be a lot of mourning as lamentation will be compounded by further lamentation.

Ezekiel 20

This chapter is a continuation of lamentation for the princes and people of the house of Israel, on account of what had already befallen them, and what was yet to come. That means these are those that are left after one third died of famine and pestilence, another third of the sword, and these are those left over or those that survive in captivity.

1 And it came to pass in the seventh year, in the fifth month, the tenth day of the month, that certain of the elders of Israel came to inquire of the Lord, and sat before me. — these were either some of the elders that were carried captive, who came to inquire how long they should continue in this state; or what methods they should use to free themselves from it;

and sat before me; it is usually after some great calamities would elders would humble themselves and come to seek the Lord, by which time (verse 3 below) Ezekiel is forbidden to tell them that he would not be inquired of by them. During peace time these same people are usually contented to ignore God.

Then came the word of the Lord unto me, saying,

“Son of man, speak unto the elders of Israel and say unto them, ‘Thus saith the Lord God: Have ye come to inquire of Me? As I live, saith the Lord God, I will not be inquired of by you.’

Wilt thou judge them, son of man, wilt thou judge them? Cause them to know the abominations of their fathers; cause them to know the abominations of their fathers: God reminded them of the sins they committed, which were abominable in themselves and unto God, by which they would be led to see the abominable evils which they also had been guilty of, in which they had imitated their fathers, and what they had reason to expect in consequence of them.

and say unto them, ‘Thus saith the Lord God: On the day when I chose Israel, and lifted up Mine hand unto the seed of the house of Jacob, and made Myself known unto them in the land of Egypt, when I lifted up Mine hand unto them, saying, “I am the Lord your God.” — here begins the account of their fathers; of God’s unmerited goodness to them, and of their sins and transgressions against him, and how it fared with them.

on the day that I lifted up Mine hand unto them to bring them forth out of the land of Egypt into a land that I had espied for them, flowing with milk and honey, which is the glory of all lands, — which is the glory of all lands; that is, either which fertility, signified by milk and honey, is the glory of all lands, being so fruitful, is more glorious or desirable than any other country; it greatly surpassing all others in its situation, soil, and climate.

— the Targum says, “which is the praise of all provinces:” that is, was praised and commended by the inhabitants of all other provinces for the plenty in it; which must needs be very great, to support so large a number of inhabitants in it, and yet its compass but small.

then said I unto them: “Cast away every man of ye the abominations of his eyes, and defile not yourselves with the idols of Egypt: I am the Lord your God.”

But they rebelled against Me and would not hearken unto Me. They did not every man cast away the abominations of their eyes, neither did they forsake the idols of Egypt. “‘Then I said, “I will pour out My fury upon them, to accomplish My anger against them in the midst of the land of Egypt.”

But I wrought for My name’s sake, that it should not be polluted before the nations among whom they were, in whose sight I made Myself known unto them in bringing them forth out of the land of Egypt. — “I wrought for my name’s sake…”  this is a reference to the fact that God on several occasions did not judge Israel according to what they certainly deserved; but, that in order to prevent the nations from questioning God’s ability to protect his people, simply went on and blessed them in spite of their sins. Two examples of this are found in Exodus 32:12 and in Numbers 14:16.

10 Therefore I caused them to go forth out of the land of Egypt and brought them into the wilderness.

11 And I gave them My statutes and showed them My judgments, which if a man do, he shall even live in them. — God’s statutes and Judgments are dedicated to his servants to implement, starting with the Great Assembly, later the Sanhedrin. Today this Sanhedrin has been re-established here, inheriting and embedded with the following mandates:

Deuteronomy 16:18 “Judges and officers shalt thou make thee in all thy gates which the Lord thy God giveth thee, throughout thy tribes; and they shall judge the people with just judgment. 

19 Thou shalt not distort judgment; thou shalt not respect persons, neither take a bribe; for a bribe doth blind the eyes of the wise and pervert the words of the righteous.

Deuteronomy 17:11 According to the sentence of the law which they shall teach thee and according to the judgment which they shall tell thee, thou shalt do. Thou shalt not decline from the sentence which they shall show thee to the right hand nor to the left. 

12 And the man who will do presumptuously, and will not hearken unto the priest who standeth to minister there before the Lord thy God, or unto the judge, even that man shall die; and thou shalt put away the evil from Israel. 

13 And all the people shall hear, and fear, and do no more presumptuously.

And what happened in 70 AD in Jerusalem and Judea when God exercised His judgement?

History recorded only two sects that escaped this inferno:

(1) The Nazarenes as the early Christians were known in Acts 24:5. Many died as martyrs but according to Eusebius, some received divine warning and escaped to a northern town called Pella, west of the Jordan River.

(2) Pharisees of the House of Hillel escaped to Yavne. These were headed by a rabbi, Johanan ben Zakkai, the head of the Sanhedrin; he was smuggled out of besieged Jerusalem in a coffin. Later, his followers re-emerged as Rabbinic Jews who established the Hillel Calendar, which was revealed by Hillel II in about AD 359 concerning the rules of the Calendar.

12 Moreover also I gave them My Sabbaths to be a sign between Me and them, that they might know that I am the Lord who sanctify them.

13 But the house of Israel rebelled against Me in the wilderness. They walked not in My statutes and they despised My judgments, which if a man do, he shall even live in them; and My Sabbaths they greatly polluted. “‘Then I said I would pour out My fury upon them in the wilderness to consume them.

History recorded two prominent sects that died during this AD 70 inferno:

(a) The Sadducees and Boethusians, following the heretic Samaritan way of observing Passover, kept it on the night of the fourteenth; they perished in the inferno;

(b) The Essenes, after they had repudiated the calendar that was sanctioned by the Sanhedrin, then went about presumptuously making one of their own. They all perished by either the flaming Sword or the consuming Fire.

14 But I wrought for My name’s sake, that it should not be polluted before the nations, in whose sight I brought them out. — “I wrought for my name’s sake…”; this is repeated from verse 9, for emphasis.

15 Yet also I lifted up My hand unto them in the wilderness, that I would not bring them into the land which I had given them, flowing with milk and honey, which is the glory of all lands,

16 because they despised My judgments and walked not in My statutes, but polluted My Sabbaths; for their heart went after their idols.

17 Nevertheless Mine eye spared them from destroying them, neither did I make an end of them in the wilderness.

18 “‘But I said unto their children in the wilderness: “Walk ye not in the statutes of your fathers, neither observe their judgments, nor defile yourselves with their idols.

19 I am the Lord your God: Walk in My statutes, and keep My judgments, and do them;

20 and hallow My Sabbaths, and they shall be a sign between Me and you, that ye may know that I am the Lord your God.”

21 Notwithstanding, the children rebelled against Me. They walked not in My statutes, neither kept My judgments to do them, which if a man do, he shall even live in them; they polluted My Sabbaths. “‘Then I said I would pour out My fury upon them to accomplish My anger against them in the wilderness.

22 Nevertheless I withdrew Mine hand and wrought for My name’s sake, that it should not be polluted in the sight of the nations, in whose sight I brought them forth. — “I withdrew Mine hand and wrought for my name’s sake…”; again, this is repeated from verse 9 and 14 with some variations, for emphasis.

23 I lifted up Mine hand unto them also in the wilderness, that I would scatter them among the nations and disperse them through the countries,

24 because they had not executed My judgments, but had despised My statutes and had polluted My Sabbaths, and their eyes were after their fathers’ idols.

25 Therefore I gave them also statutes that were not good and judgments whereby they should not live;

26 and I polluted them in their own gifts, in that they caused to pass through the fire all who openeth the womb, that I might make them desolate, to the end that they might know that I am the Lord.’

27 “Therefore, son of man, speak unto the house of Israel and say unto them, ‘Thus saith the Lord God: Yet in this your fathers have blasphemed Me, in that they have committed a trespass against Me.

28 For when I had brought them into the land for which I lifted up Mine hand to give it to them, then they saw every high hill and all the thick trees, and they offered there their sacrifices, and there they presented the provocation of their offering. There also they made their sweet savor, and poured out there their drink offerings.

29 Then I said unto them: What is the high place whereunto ye go?’” (And the name thereof is called Bamah unto this day.)

30 “Therefore say unto the house of Israel, ‘Thus saith the Lord God: Are ye polluted after the manner of your fathers? And commit ye whoredom after their abominations?

31 For when ye offer your gifts, when ye make your sons pass through the fire, ye pollute yourselves with all your idols, even unto this day. And shall I be inquired of by you, O house of Israel? As I live, saith the Lord God, I will not be inquired of by you.

32 “‘And that which cometh into your mind shall not be at all: in that ye say, “We will be as the nations, as the families of the countries, to serve wood and stone.”

33 “‘As I live, saith the Lord God, surely with a mighty hand and with a stretched out arm and with fury poured out, will I rule over you.

34 And I will bring you out from the people, and will gather you out of the countries wherein ye are scattered, with a mighty hand and with a stretched out arm, and with fury poured out;

35 and I will bring you into the wilderness of the people, and there will I plead with you face to face. — “I will bring you into the wilderness of the peoples…”; this new wilderness was not a geographical wilderness like the wilderness of Egypt, but a wilderness, “of strange peoples, unusual social customs, etc,” 

— it was the wilderness of their captivity in an unknown civilization, the Assyrian; and the vast majority of Israel would not pass that test of being an Israelite, any more than their fathers had passed it in the former wilderness, Egypt;

— most of them, enamored with the wealth and splendor of modern “civilization” would never leave for any return to Palestine, even when free to do so. Such persons were described as, “Separated by the refining process, and not allowed to participate in the restoration.”

36 As I pleaded with your fathers in the wilderness of the land of Egypt, so will I plead with you, saith the Lord God.

37 And I will cause you to pass under the rod, and I will bring you into the bond of the covenant;

38 and I will purge out from among you the rebels and them that transgress against Me. I will bring them forth out of the country where they sojourn, and they shall not enter into the land of Israel; and ye shall know that I am the Lord.

39 “‘As for you, O house of Israel, thus saith the Lord God: Go ye, serve ye every one his idols, and hereafter also, if ye will not hearken unto Me; but pollute ye My holy name no more with your gifts, and with your idols. — “go ye, serve every one his idols…” this is the same kind of commandment that God gave to Judas Iscariot, when he said, “What thou doest, do quickly.” God never restrains anyone from evil who has already made up his mind to do more evil: “We lied, We cheated, We stole… It reminds you of the glory of the American experiment.” That would appear to be the condition of those elders who sat in front of Ezekiel.

40 For in Mine holy mountain, in the mountain of the height of Israel, saith the Lord God, there shall all the house of Israel, all of them in the land, serve Me. There will I accept them, and there will I require your offerings and the firstfruits of your oblations, with all your holy things. — “all hostilities and separation between Israel and Judah shall cease;” this is in great contrast we have today:

“Manasseh, Ephraim; and Ephraim, Manasseh; and they together shall be against Judah. For all this His anger is not turned away, but His hand is stretched out still” Isaiah 9:21 

The vast majority of today’s professing Christianity (99.99 percent) in the house of Ephraim and Manasseh make one fundamental error against his brother Judah in studying The Oracles of God.

41 I will accept you with your sweet savor when I bring you out from the people and gather you out of the countries wherein ye have been scattered; and I will be sanctified in you before the nations. — and I will be sanctified in you before the nations; the outside world will take notice of the power and eminence of God, in the conversion and restoration of house of Israel, and praise and glorify him on account of His doing; and when He will be visibly feared, served, and worshipped, in the midst of Israel.

42 And ye shall know that I am the Lord, when I shall bring you into the land of Israel, into the country for which I lifted up Mine hand to give it to your fathers.

43 And there shall ye remember your ways and all your doings wherein ye have been defiled; and ye shall loathe yourselves in your own sight for all your evils that ye have committed.

44 And ye shall know that I am the Lord, when I have wrought with you for My name’s sake, not according to your wicked ways, nor according to your corrupt doings, O ye house of Israel, saith the Lord God.’”

45 Moreover the word of the Lord came unto me, saying,

46 “Son of man, set thy face toward the south, and drop thy word toward the south, and prophesy against the forest of the southland. — prophesy against the forest of the southland; this prophecy “against” indicates something with a bad outcome, which could be literal or could be symbolic, or even both. But remember again that this prophecy meant is for the house of Israel and is “of the times that are far off (Ezekiel 12:27); far into the future, this time, our time.

47 And say to the forest of the south: ‘Hear the word of the Lord. Thus saith the Lord God: Behold, I will kindle a fire in thee, and it shall devour every green tree in thee and every dry tree. The flaming flame shall not be quenched, and all faces from the south to the north shall be burned therein. — this “kindle a fire” could be literal: the southern United States and southern Europe could be “kindled with fire” and much of the farmland could be in drought and be burnt up and eventually led to famine;

— but it could also be symbolic, where the south of United States (Mexico) and the south of Europe (North Africa) could be burnt with famine and civil unrest that led to huge unwanted migration to the north.

— and it shall devour every green tree, and every dry tree; all sorts of persons should be consumed by one or other of the above calamities, high and low, rich and poor, good and bad; and if good men should suffer, comparable to green trees, which fire will not so easily burn, not being fit fuel for it; then much more bad men, who were by far the most numerous, comparable to dry trees, and so fit fuel for the flames, and easily consumed thereby;

— and this flaming flame will spread from the south to the north: “and all faces from the south to the north shall be burned.”

48 And all flesh shall see that I, the Lord, have kindled it; it shall not be quenched.’” — by this “all flesh shall see that I” the God of heaven will be manifested to all the rest of the nations.

49 Then said I, “Ah, Lord God! They say of me, ‘Doth he not speak parables?’” — parables, riddles and enigmas; sobering thoughts, isn’t it? If there are alternative ideas, please feel free to share, thanks.

Ezekiel (Ch 17-18) 

•September 14, 2021 • Leave a Comment

Chapter 17 starts with a riddle of two eagles and a vine and some mysteries along the historical footpaths in the complexities of the house of Judah and the house of Israel. The best book to have expounded this riddle is “Judah’s Sceptre and Joseph’s Birthright” by J.H. Allen (1847-1930).

In summary, this riddle is a mysterious prophecy as a form of a riddle to both Judah and Israel, which shows how the planting and rebuilding of David’s throne was survive beyond the captivity.

“And the word of the Lord came unto me, saying, Son of man, put forth a riddle, and speak a parable unto the house of Israel; and say, Thus says the Lord God; A great eagle… came unto Lebanon, and took the highest branch of the cedar: he cropped off the top of his young twigs, and carried it into a land of traffic; he set it in a city of merchants. He took also of the seed of the land, and planted it in a fruitful field; he placed it by great waters, and set it as a willow tree. And it grew, and became a spreading vine of low stature… and shot forth sprigs” (Ezekiel 17:1-6).

An Amazing Commission—and a Breach Healed!

The great eagle at the beginning of the riddle was the king of Babylon, who took Zedekiah captive. Verse 11 describes the destruction of Zedekiah’s Pharez lineage. The execution of his sons is the cropping off of the cedar’s young twigs. The “vine of low stature… [shooting] forth sprigs” reflects Judah’s freedom to movement while in captivity in Babylon. The second great eagle (vs. 7) refers to Jeremiah who took the princess from Babylon to Egypt, and later, beyond the seas to the British Isles.

This part of the prophecy pertained to the first eagle of Ezekiel’s riddle—the rooting up and tearing down of the existing throne in Judah. But within this same prophecy, the planting and building up is also addressed, which is the work of the second eagle performed by prophet Jeremiah.

Verses 22-23 go on to describe what was Jeremiah’s commission to re-establish David’s throne in another location. God says that He will take of the highest branch—the seed of King Zedekiah—and set it or plant it. The “tender young twig” of verse 22 could be none other than one of the king’s daughters that Jeremiah took with him to plant in the British Isles. Thus, the “high mountain and eminent” depicts the nations of Israel as God knew they were destined to become, once the birthright promise was realized.

God states that it will eventually be known that it was He who brought down the high tree and exalted the low tree (vs. 24). In light of this, notice a parallel Scripture in Isaiah: “And the remnant that is escaped of the house of Judah shall again take root downward, and bear fruit upward” (37:31). Jeremiah presented this young Hebrew princess—Tea Tephi—to the Zarah line ruling in the British Isles! Her marriage and children would continue the scepter and the dynasty promised David—and heal the breach.

Ezekiel 17

1 And the word of the Lord came unto me, saying,

“Son of man, put forth a riddle, and speak a parable unto the house of Israel,

and say, ‘Thus saith the Lord God: A great eagle with great wings, longwinged, full of feathers which had diverse colors, came unto Lebanon and took the highest branch of the cedar. — a great eagle; which is Nebuchadnezzar king of Babylon, as it is explained, Ezekiel 17:12; who is compared to an eagle for his power and authority, that being the king of birds, and for his swiftness and voracity in conquering and subduing kingdoms; see Jeremiah 48:40.

He cropped off the top of it young twigs and carried it into a land of traffic; he set it in a city of merchants. — young twigs mentioned, but tender ones.

He took also of the seed of the land and planted it in a fruitful field. He placed it by great waters and set it as a willow tree. — the seed of the land; Zedekiah, brother of Jehoiachin, and all their children.

And it [the seed] grew and became a spreading vine of low stature, whose branches turned toward him and the roots thereof were under him. So it became a vine, and brought forth branches and shot forth sprigs. — this indicates that children were born unto them that were in captivity, but that they were to keep a low profile.

“‘There was also another great eagle with great wings and many feathers; and behold, this vine did bend her roots toward him and shot forth her branches toward him, that he might water it by the furrows of her planting. — there was also another great eagle, with great wings and many feathers: — many (John Gill, Adam Clarke, though JH Allen is indecisive or ambiguous) identify this second eagle as the Pharaoh of Egypt, but it seems more like whoever took Jeremiah and the king’s daughters to the British Isles fit this character of a great eagle with great wings. It remains a mystery but whoever took Jeremiah and the king’s daughters in its ship or ships, would be the second eagle that flew over the great seas to transplant the tender twigs there.

It was planted in a good soil by great waters, that it might bring forth branches and that it might bear fruit, that it might be a goodly vine.’

Say thou, ‘Thus saith the Lord God: Shall it prosper? Shall he not pull up the roots thereof and cut off the fruit thereof, that it wither? It shall wither in all the leaves of her spring, even without great power or many people to pluck it up by the roots thereof.

10 Yea, behold, being planted, shall it prosper? Shall it not utterly wither when the east wind toucheth it? It shall wither in the furrows where it grew.’”

11 Moreover the word of the Lord came unto me, saying,

12 “Say now to the rebellious house: ‘Know ye not what these things mean?’ Tell them: ‘Behold, the king of Babylon is come to Jerusalem, and hath taken the king thereof and the princes thereof, and led them with him to Babylon; — and hath taken the king thereof, and the princes (but princess left out here) thereof, and led them with him to Babylon; the king of Judea, and the princes of it; Jeconiah and his nobles, who had been carried captive into Babylon by Nebuchadnezzar; for Ezekiel was among these captives.

13 and hath taken of the king’s seed and made a covenant with him, and hath taken an oath from him. He hath also taken the mighty of the land,

14 that the kingdom might be base, that it might not lift itself up, but that by keeping of his covenant it might stand.

15 But he rebelled against him in sending his ambassadors into Egypt, that they might give him horses and many people. Shall he prosper? Shall he escape that doeth such things? Or shall he break the covenant and be delivered? but he rebelled against him…. Zedekiah rebelled against the king of Babylon, broke the covenant he entered into, and violated his oath.

16 As I live, saith the Lord God, surely in the place where the king dwelleth that made him king, whose oath he despised and whose covenant he broke, even with him in the midst of Babylon he shall die. — surely in the place where the king dwelleth that made him king; in Babylon, where Nebuchadnezzar dwelt, that made Zedekiah king of Judah; which is mentioned, to point out the ingratitude of Zedekiah toward the king of Babylon, but instead, send envoys to Egypt, asking for horses and an army to help him (verse 15).

17 Neither shall Pharaoh with his mighty army and great company help him in the war, by casting up siege mounds and building forts to cut off many persons.

18 Seeing he despised the oath by breaking the covenant, when, lo, he had given his hand and hath done all these things, he shall not escape.

19 Therefore thus saith the Lord God: As I live, surely Mine oath that he hath despised and My covenant that he hath broken, even it will I recompense upon his own head.

20 And I will spread My net upon him, and he shall be taken in My snare, and I will bring him to Babylon and will plead with him there for his trespass that he hath trespassed against Me.

21 And all his fugitives with all his troops shall fall by the sword, and they that remain shall be scattered toward all winds; and ye shall know that I, the Lord, have spoken it.

22 “‘Thus saith the Lord God: I will also take of the highest branch of the high cedar, and will set it; I will crop off from the top of his young twigs a tender one, and will plant it upon a high mountain and eminent. — I (through the second eagle) will crop off from the top of his young twigs a tender one (the feminine gender); and by the “top” and “young twigs” of the highest branch of the cedar, or of the chief tribe in Israel, are meant the royal house and family of David, and the chief of the tribe of Judah; and by the “tender one” is designed the tender gender, the daughters;

— and the Targum says, “I will bring one of the kingdom of the house of David, which is like to a high cedar, and I will raise him up an infant from his children’s children.” But Jeremiah verifies these children were the King’s daughters:

Then Ishmael carried away captive all the residue of the people who were in Mizpah, even the king’s daughters and all the people that remained in Mizpah, whom Nebuzaradan the captain of the guard had committed to Gedaliah the son of Ahikam; and Ishmael the son of Nethaniah carried them away captive, and departed to go over to the Ammonites. Jeremiah 41:10

23 In the mountain of the height of Israel will I plant it; and it shall bring forth boughs and bear fruit and be a goodly cedar, and under it shall dwell all fowl of every wing; in the shadow of the branches thereof shall they dwell. in the mountain of the height of Israel will I plant it…. in the highest part of the land of Israel, which during that time those at “the height of Israel” could well be in the British Isles (Israel in the isles of the sea, Isaiah 24:15), led by Ephraim. (Ephraim followeth after the east wind, Hosea 12:1)

24 And all the trees of the field shall know that I, the Lord, have brought down the high tree, have exalted the low tree, have dried up the green tree, and have made the dry tree to flourish. I, the Lord, have spoken and have done it.’”

Ezekiel 18

Earlier, we have established that this prophecy that Ezekiel delivered was for many years to come (Ezekiel 12:27), and the message is primarily and principally for the United States of America, and secondarily for its European allies. Here the prophecy on the house of Israel continues. . .

1 The word of the Lord came unto me again, saying,

“What mean ye, that ye use this proverb concerning the land of Israel, saying: ‘The fathers have eaten sour grapes, and the children’s teeth are set on edge’? saying, the fathers have eaten sour grapes, and the children’s teeth are set on edge? that is, as the Targum explains it, “the fathers have sinned, and the children are smitten.”

As I live, saith the Lord God, ye shall not have occasion any more to use this proverb in Israel.

Behold, all souls are Mine. As the soul of the father, so also the soul of the son is Mine: the soul that sinneth, it shall die. the soul that sinneth, it shall die; the soul that continues in sin, without repentance towards God, shall be separated from the presence of God, and endure his wrath to all eternity.

But if a man be just and do that which is lawful and right,

and hath not eaten upon the mountains, neither hath lifted up his eyes to the idols of the house of Israel, neither hath defiled his neighbor’s wife, neither hath come near to a menstruous woman, neither hath defiled his neighbour’s wife; been guilty of adultery, by lying with another man’s wife; or by marrying one divorced, not having committed fornication; which divorces were common among the people, and marrying such so divorced.

and hath not oppressed any, but hath restored to the debtor his pledge, hath despoiled none by violence, hath given his bread to the hungry, and hath covered the naked with a garment;

he that hath not given forth upon usury, neither hath taken any increase, that hath withdrawn his hand from iniquity, hath executed true judgment between man and man, hath executed true judgment between man and man; whether in office as a judge, who sits on the bench for that purpose; or as an arbitrator chosen to decide matters in controversy between one man and another, and that does everything just and right between man and man.

hath walked in My statutes and hath kept My judgments to deal truly — he is just: he shall surely live, saith the Lord God. God’s statutes and Judgments are dedicated to his servants to implement, starting with the Great Assembly, later the Sanhedrin. Today this Sanhedrin has been re-established here, inheriting and embedded with the following mandates:

Deuteronomy 16:18 “Judges and officers shalt thou make thee in all thy gates which the Lord thy God giveth thee, throughout thy tribes; and they shall judge the people with just judgment. 

19 Thou shalt not distort judgment; thou shalt not respect persons, neither take a bribe; for a bribe doth blind the eyes of the wise and pervert the words of the righteous.

Deuteronomy 17:11 According to the sentence of the law which they shall teach thee and according to the judgment which they shall tell thee, thou shalt do. Thou shalt not decline from the sentence which they shall show thee to the right hand nor to the left. 

12 And the man who will do presumptuously, and will not hearken unto the priest who standeth to minister there before the Lord thy God, or unto the judge, even that man shall die; and thou shalt put away the evil from Israel. 

13 And all the people shall hear, and fear, and do no more presumptuously.

And what happened in AD 70 in Jerusalem and Judea when God exercised His judgement?

(a) The Sadducees and Boethusians, following the heretic Samaritan way of observing Passover, kept it on the night of the fourteenth; they perished in the inferno;

(b) The Essenes, after they had repudiated the calendar that was sanctioned by the Sanhedrin, then went about presumptuously making one of their own. They all perished by either the flaming Sword or the consuming Fire.

I create darkness; I create evil; I, the LORD, do all these things (Isaiah 45:7).

10 “If he beget a son who is a robber, a shedder of blood, and who doeth the like to any one of these things,

11 and who doeth not any of those duties, but even hath eaten upon the mountains and defiled his neighbor’s wife,

12 hath oppressed the poor and needy, hath despoiled by violence, hath not restored the pledge and hath lifted up his eyes to the idols, hath committed abomination,

13 hath given forth upon usury and hath taken increase — shall he then live? He shall not live. He hath done all these abominations: he shall surely die. His blood shall be upon him.

14 “Now, lo, if he beget a son who seeth all his father’s sins which he hath done, and considereth and doeth not the like,

15 who hath not eaten upon the mountains, neither hath lifted up his eyes to the idols of the house of Israel, hath not defiled his neighbor’s wife,

16 neither hath oppressed any, hath not withheld the pledge, neither hath despoiled by violence, but hath given his bread to the hungry and hath covered the naked with a garment;

17 who hath taken off his hand from the poor, who hath not received usury nor increase, hath executed My judgments, hath walked in My statutes — he shall not die for the iniquity of his father: he shall surely live.

18 As for his father, because he cruelly oppressed, despoiled his brother by violence, and did that which is not good among his people, lo, even he shall die in his iniquity.

19 “Yet say ye, ‘Why? Doth not the son bear the iniquity of the father?’ When the son hath done that which is lawful and right, and hath kept all My statutes and hath done them, he shall surely live.

20 The soul that sinneth, it shall die. The son shall not bear the iniquity of the father, neither shall the father bear the iniquity of the son: the righteousness of the righteous shall be upon him, and the wickedness of the wicked shall be upon him. the son shall not bear the iniquity of the father, neither shall the father bear the iniquity of the son; that is, as the Targum paraphrases it, “the son shall not be punished for the sins of the father, nor shall the father be punished for the sins of the son.”

— but sometimes, one goes through great sufferings though no fault of his or her own, to develop righteous character, like Job and many others did; these will be rewarded enormously at the end.

21 But if the wicked will turn from all his sins that he hath committed and keep all My statutes and do that which is lawful and right, he shall surely live: he shall not die.

22 All his transgressions that he hath committed, they shall not be mentioned unto him. In his righteousness that he hath done he shall live.

23 “Have I any pleasure at all that the wicked should die, saith the Lord God, and not that he should return from his ways and live?

24 But when the righteous turneth away from his righteousness, and committeth iniquity, and doeth according to all the abominations that the wicked man doeth, shall he live? All his righteousness that he hath done shall not be mentioned: in his trespass that he hath trespassed and in his sin that he hath sinned, in them shall he die. — but if the righteous man turn from his righteousness, and doeth wickedness, and acteth according to all the abominations which the ungodly man hath done, should he live? All the righteousness that he hath done shall not be remembered: for his unfaithfulness that he hath committed, and for his sin that he hath sinned, for these he shall die.

25 “Yet ye say, ‘The way of the Lord is not equal.’ Hear now, O house of Israel: Is not My way equal? Are not your ways unequal?

26 When a righteous man turneth away from his righteousness, and committeth iniquity and dieth in it, for his iniquity that he hath done shall he die.

27 Again, when the wicked man turneth away from his wickedness that he hath committed, and doeth that which is lawful and right, he shall save his soul alive. he shall save his soul alive; from famine, pestilence, the sword, or captivity; he shall be preserved, and not be involved in calamities and distress.

28 Because he considereth and turneth away from all his transgressions that he hath committed, he shall surely live: he shall not die. — the Nazarenes and the Hillel branch of Pharisees survived . . . (more below)

29 Yet saith the house of Israel, ‘The way of the Lord is not equal.’ O house of Israel, are not My ways equal? Are not your ways unequal?

30 “Therefore I will judge you, O house of Israel, every one according to his ways, saith the Lord God. Repent, and turn yourselves from all your transgressions, so iniquity shall not be your ruin.

31 Cast away from you all your transgressions whereby ye have transgressed, and make yourselves a new heart and a new spirit. For why will ye die, O house of Israel?

32 For I have no pleasure in the death of him that dieth, saith the Lord God. Therefore turn yourselves, and live ye.

~~~

But which sects managed to escape from the Romans during the AD 66 to 70 siege of Jerusalem? History recorded only two sects that escaped this inferno:

(1) The Christians, known as Nazarenes in Acts 24:5. Many died as martyrs but according to Eusebius, some received divine warning and escaped to a northern town called Pella, west of the Jordan River.

(2) Pharisees of the House of Hillel escaped to Yavne. These were headed by a rabbi, Johanan ben Zakkai, the head of the Sanhedrin; he was smuggled out of besieged Jerusalem in a coffin. Later, his followers re-emerged as Rabbinic Jews who established the Hillel Calendar, which was revealed by Hillel II in about AD 359 concerning the rules of the Calendar.

Ezekiel (Ch 15-16)

•September 12, 2021 • Leave a Comment

Earlier, we have established that this prophecy that Ezekiel delivered was not to be fulfilled during his time, but that its timing was a great distance into the future (Ezekiel 12:27), into our time and the message is primarily and principally for the United States of America, and secondarily its European allies.

Ezekiel 15

1 And the word of the Lord came unto me, saying,

“Son of man, what is the vine tree more than any tree, or than a branch which is among the trees of the forest? — Clarke: what is the vine tree more than any tree; it’s certain that the vine is esteemed only on account of its fruit.

Shall wood be taken thereof to do any work? Or will men take a peg from it to hang any vessel thereon? shall wood be taken thereof to do any work?…. the carpenter and joiner, the house or ship builder, are employed in; as to build houses of, make beams, rafters, floors, build ships with, make masts of, or any vessel or utensil for the use of man.

Behold, it is cast into the fire for fuel; the fire devoureth both the ends of it, and the middle of it is burned. Is it meet for any work? — behold, it is cast into the fire for fuel, that is; a vine tree when cut down, or a branch when cut off, it is good for nothing else; and that is the use it is generally put to; and this, it is suggested, would be the end of the house of Israel; who were become by their sins like a wild vine, and were fit fuel for the fire of divine wrath.

the fire devoureth both ends of it; the branch cast into it, and so is quickly consumed. In Isaiah 9:12; “the Syrians before, and the Philistines behind, and they devour Israel with open mouth.”

Behold, when it was whole, it was meet for no work. How much less shall it be meet yet for any work when the fire hath devoured it and it is burned?

Therefore thus saith the Lord God: As the vine tree among the trees of the forest which I have given to the fire for fuel, so will I give the inhabitants of Jerusalem. so this was fulfilled to Jerusalem in 70 AD, where “I have given to the fire for fuel;” to be burnt, as other trees of the forest are, and along with them; again in 132-135 AD; and could reoccur during the endtime for the house of Israel.

And I will set My face against them: they shall go out from one fire, and another fire shall devour them. And ye shall know that I am the Lord, when I set My face against them. — the house of Israel will be surrounded at all sides, fires everywhere, no place to run to;

from one calamity to another; those that escaped the famine and pestilence in the city fell by the sword; and those that escaped famine, sword, and pestilence, were carried into captivity, and there passed from one hardship and affliction to another.

— the Targum says, “I will execute my vengeance on them, because of the words of the law, which were given out of the midst of fire; they have transgressed, and people who are strong as fire shall consume them.”

— “Out of the cauldron, into the flame.”

And I will make the land desolate, because they have committed a trespass, saith the Lord God.”

Ezekiel 16

1 Again the word of the Lord came unto me, saying,

“Son of man, cause Jerusalem to know her abominations

and say, ‘Thus saith the Lord God unto Jerusalem: Thy birth and thy nativity are of the land of Canaan; thy father was an Amorite and thy mother a Hittite. thy father was an Amorite, and thy mother an Hittite; Abraham and Sarah, who were, properly speaking, the one the father, the other the mother, of the house of Israel, were Chaldeans; and neither Amorites nor Hittites; yet, because they dwelt among them; are so called; and especially since before their conversion they were idolaters, as those were;

besides, the Jews who descended from Judah, and from whom they have their name, very probably sprung from ancestors who might be Amorites and Hittites: since Judah married the daughter of a Canaanite, and such an one seems to be Tamar, he took for his son Er, and by whom he himself had two sons, Pharez and Zarah.

And as for thy nativity, on the day thou wast born thy navel was not cut, neither wast thou washed in water to soothe thee. Thou wast not salted at all, nor swaddled at all. Gill: thy navel was not cut; alluding to what is done to a newborn infant, when the midwife immediately takes care to cut the navel string, by which the child adheres to its mother, and takes in its breath and nourishment in the womb;

— the Targum refers it, “neither wast thou washed in water to supple thee: which also is done, to an infant as soon as born, to cleanse it from the menstruous blood, to make the flesh sleek, and smooth, and amiable; which is done in hot water:

— thou wast not salted at all; which was done, either by sprinkling salt upon it, or using salt and water h, as a detersive of uncleanness, to prevent putrefaction, to dry up the humours, and harden the flesh, and consolidate the parts.

No eye pitied thee to do any of these unto thee, to have compassion upon thee; but thou wast cast out in the open field, to the loathing of thy person on the day that thou wast born. — but thou wast cast out in the open field; alluding to infants exposed by their unnatural parents, or unkind nurses, and left in an open field, or any desert place, to perish for want, unless some kind providence appears for them:

— this open field may design the land of Egypt, where Jacob and his posterity were, being driven out of Canaan by a famine; and where, after the death of Joseph, they were exposed to the hardships and cruelties of the Egyptians;

— and so the Targum paraphrases it, “and he (Pharaoh) decreed a full decree to cast your male children into the river, to destroy you when you were in Egypt.”

“‘And when I passed by thee and saw thee polluted in thine own blood, I said unto thee when thou wast in thy blood, “Live”; yea, I said unto thee when thou wast in thy blood, “Live.” — the Israelites were trodden under foot by the Egyptians, when they made them to serve with rigour, in mortar, and in brick, and in all manner of service in the field;

— and so the Targum paraphrases it, “for it was manifest before me that you were afflicted in your bondage;” as they sighed and cried because of their bondage, the Lord looked upon them with an eye of pity and compassion, and delivered them.

— these are reminder of the house of Israel happening again, this time for 190 years instead of the 210 years in Egypt.

I have caused thee to multiply as the bud of the field, and thou hast increased and waxed great, and thou art come to excellent ornaments. Thy breasts are fashioned and thine hair is grown, whereas thou wast naked and bare.

“‘Now when I passed by thee and looked upon thee, behold, thy time was the time of love; and I spread My skirt over thee and covered thy nakedness. Yea, I swore unto thee and entered into a covenant with thee, saith the Lord God, and thou becamest Mine.

Then washed I thee with water; yea, I thoroughly washed away thy blood from thee, and I anointed thee with oil.

10 I clothed thee also with embroidered work and shod thee with badgers’ skin, and I girded thee about with fine linen, and I covered thee with silk.

Wikipedia: The production of silk originated in China in the Neolithic period, although it would eventually reach other places of the world (Yangshao culture, 4th millennium BC). Silk production remained confined to China until the Silk Road opened at some point during the latter part of the 1st millennium BC, though China maintained its virtual monopoly over silk production for another thousand years.

11 I decked thee also with ornaments, and I put bracelets upon thy hands and a chain on thy neck.

12 And I put a jewel on thy forehead, and earrings in thine ears, and a beautiful crown upon thine head.

13 Thus wast thou decked with gold and silver, and thy raiment was of fine linen and silk and embroidered work. Thou didst eat fine flour and honey and oil; and thou wast exceeding beautiful, and thou didst prosper into a kingdom. — and thou wast exceeding beautiful, and thou didst prosper into a kingdom;

— the Targum says,”and ye became rich, and were greatly strengthened, and prospered, and ruled over all kingdoms.”

14 And thy renown went forth among the nations for thy beauty; for it was perfect through My comeliness, which I had put upon thee, saith the Lord God.

15 “‘But thou didst trust in thine own beauty, and played the harlot because of thy renown, and poured out thy fornications on every one that passed by: his it was. But thou didst trust in thine own beauty…. As the early American pilgrims did upon the new land bestowed on them; in their outward prosperity and grandeur; in their riches, wealth, and wisdom; and in the extent of their dominions, as manifest destiny dictates;

and in such men as America’s Founding Fathers; including George Washington, John Adams, Thomas Jefferson, James Madison, Alexander Hamilton, James Monroe and Benjamin Franklin; together with several other key players of their time, structured the democratic government of the United States and left a legacy that has shaped the world. are apt to put their trust and confidence, and to be elated with, and grow proud and haughty, as a woman because of her beauty.

7 Things You Didn't Know About Faith of the Founding Fathers
America’s Founding Fathers – George Washington, John Adams, Thomas Jefferson, James Madison, Alexander Hamilton, James Monroe and Benjamin Franklin

and playedst the harlot because of thy renown; now playing the the role of a harlot among the nations round about them, for their wisdom, riches, and power; which was a snare unto them, as a woman’s beauty is to her; and they were admired and courted, and complimented by their neighbours, and so drawn into idolatrous practices, as women into fornication and adultery by the admirers of them: idolatry, which is here meant, is frequently signified by playing the harlot, or by fornication and adultery: or “thou playedst the harlot in thy name” alluding to the custom of harlots, notorious infamous ones, who used to set their names over the apartments, to direct men unto them; and so it may denote how famous and notorious the Israelites were for their idolatries, and how impudent in them.

Rashi interprets this of the calf of the wilderness, and other idolatries which the tribe of Dan committed there; but it rather respects the idolatries committed from the times of Solomon to the captivity, which were many, and often repeated; and though sometimes a stop was put to them by pious princes, yet broke out again: so trusting in a man’s own righteousness, or in any outward thing, is idolatry; and also false worship and superstitious observances.

16 And of thy garments thou didst take, and decked thy high places with divers colors and played the harlot thereupon. The like things shall not come, neither shall it be so.

17 Thou hast also taken thy fair jewels of My gold and of My silver, which I had given thee, and madest for thyself images of men and didst commit whoredom with them,  a beautiful woman, now taking the image of a man, as described by John Gill:

Gill: and madest to thyself images of men; images in the shape of men; some were in the shape of women, others in the shape of men; here only male images are mentioned, because the idolatrous Israelites are represented by an adulterous woman committing adultery, with men; and these were made by themselves, of their jewels of gold and silver; or of their golden and silver vessels, which they had to eat and drink out of; these, they melted down and made idols of them in the form of men;

— just as the molten calf was made of the earrings of the women, Exodus 32:3; to which some refer this passage: and as it was a piece of egregious folly in themselves to part with their jewels and plate for such purposes, and of great ingratitude to God, their benefactor, so of the grossest stupidity and ignorance to worship images so made; which was equally as stupid, or more so, than if a woman should embrace the image of a man, instead of a man himself, as it follows.

— and didst commit whoredom with them: the images: that is, idolatry, which is spiritual adultery.

18 and tookest thy embroidered garments and covered them; and thou hast set Mine oil and Mine incense before them.

19 My meat also which I gave thee — fine flour and oil and honey, wherewith I fed thee — thou hast even set it before them for a sweet savor; and thus it was, saith the Lord God; much of these descriptions above are well intended for the early years of United States of America.

20 Moreover thou hast taken thy sons and thy daughters, whom thou hast borne unto Me, and these hast thou sacrificed unto them to be devoured. Is this thy whoredoms a small matter,

21 that thou hast slain My children and delivered them to cause them to pass through the fire for them?

22 And in all thine abominations and thy whoredoms thou hast not remembered the days of thy youth, when thou wast naked and bare and wast polluted in thy blood.

23 “‘And it came to pass after all thy wickedness (Woe, woe unto thee! saith the Lord God),

24 that thou hast also built unto thee a brothel house, and hast made thee a high place in every street.

25 Thou hast built thy high place at every head of the way, and hast made thy beauty to be abhorred, and hast opened thy feet to every one that passed by, and multiplied thy whoredoms.

26 Thou hast also committed fornication with the Egyptians thy neighbors, great of flesh, and hast increased thy whoredoms to provoke Me to anger.

27 Behold, therefore I have stretched out My hand over thee, and have diminished thine ordinary food, and delivered thee unto the will of them that hate thee, the daughters of the Philistines, who are ashamed of thy lewd way.

28 Thou hast played the whore also with the Assyrians, because thou wast unsatiable; yea, thou hast played the harlot with them and yet couldest not be satisfied.

29 Thou hast moreover multiplied thy fornication in the land of Canaan unto Chaldea, and yet thou wast not satisfied herewith.

30 “‘How weak is thine heart, saith the Lord God, seeing thou doest all these things, the work of an imperious whorish woman,

31 in that thou buildest thine eminent place at the head of every way and makest thine high place in every street, and hast not been as a harlot in that thou scornest hire,

32 but as a wife that committeth adultery, that taketh strangers instead of her husband! that taketh strangers instead of her husband; that takes other men into her bed instead of her husband, not for the sake of gain, but lust; and this was the case of modern Ephraim, who are a wicked people, an idolatrous generation; who took strange gods to worship instead of the true God, who had been a husband to them.

33 Gifts are given to all whores, but thou givest thy gifts to all thy lovers, and hirest them, that they may come unto thee on every side for thy whoredom. they give gifts to all whores…. gifts are usually given to whores, by those who commit whoredom with them; it is for the sake of these they prostitute their bodies, nor will they do this without gain.

34 And it is the contrary in thee from other women in thy whoredoms, whereas none followeth thee to commit whoredoms; and in that thou givest a reward and no reward is given unto thee, therefore thou art contrary.

35 “‘Therefore, O harlot, hear the word of the Lord!

36 Thus saith the Lord God: Because thy filthiness was poured out and thy nakedness uncovered through thy whoredoms with thy lovers, and with all the idols of thy abominations, and by the blood of thy children which thou didst give unto them,

37 behold, therefore I will gather all thy lovers with whom thou hast taken pleasure, and all them that thou hast loved, with all them that thou hast hated. I will even gather them round about against thee and will uncover thy nakedness unto them, that they may see all thy nakedness. — when the going gets tough, the tough gets going and American allies (Germany, Turkey, S Korea, the Philippines and Japan?) will take their own interests first, team up with other enemies of the United States (Iran, N Korea, Russia and China?) and will turn against America.

— nar, it is not these countries’ doings, but it is God’s will that will cause these allies to be against the United States, and it is again God’s will through His Spirits that will trap the United States in a snare (And I will spread My net upon him, and he shall be taken in My [not China’s nor Russia’s] snare, Ezekiel 17:20; and he will be like a pig caught in a cage squealing away to no avail) then uncover her nakedness, American nakedness.

— then and only then perhaps that the world will finally uncover all the experiments Professor Ralph Baric and other associates have ventured at Fort Detrick and the University of North Carolina at Chapel Hill. It is God Himself that will lay a net to trap the United States; He is the Overseeing GrandMaster; not China, not Russia, these are only pawns on a chessboard.

38 And I will judge thee, as women that break wedlock and shed blood are judged; and I will give thee blood in fury and jealousy. — and I will judge thee as women that break wedlock…. the marriage covenant, defile the marriage bed, and were adulteresses, who by the law of Moses were to be punished with death.

39 And I will also give thee into their hand, and they shall throw down thine eminent place and shall break down thy high places. They shall strip thee also of thy clothes and shall take thy fair jewels, and leave thee naked and bare. — they shall strip thee also of thy clothes – thy fairjewels — alluding to a lot common enough to prostitutes, their maintainers in the end stripping them of all they had given them. Lots of stolen arts “the vessels of thy glory” the vessels of the sanctuary of gold and silver of other countries, and their own household furniture, with all their riches (from the Opium War booties, etc) and substance from other countries will be laid naked and have to be returned.

40 They shall also bring up a company against thee, and they shall stone thee with stones and thrust thee through with their swords. and thrust thee through with their swords; such as attempted to escape out of the city, or fell into the hands of the enemy when it was taken, were slain with the sword.

41 And they shall burn thine houses with fire, and execute judgments upon thee in the sight of many women; and I will cause thee to cease from playing the harlot, and thou also shalt give no hire any more.

42 So will I make My fury toward thee to rest, and My jealousy shall depart from thee, and I will be quiet and will be no more angry. and I will be quiet, and will be no more angry: the effects of his anger cease, his judgments averted, and he at peace with them, and they with him.

43 Because thou hast not remembered the days of thy youth, but hast made Me fret in all these things, behold, therefore I also will recompense thy way upon thine head, saith the Lord God; and thou shalt not commit this lewdness above all thine abominations.

44 “‘Behold, every one that useth proverbs shall use this proverb against thee, saying, “As is the mother, so is her daughter.” — saying, as is the mother, so is her daughter; an ancient and common proverb, used to express a likeness and agreement between persons their nature and disposition, in their behaviour, conduct, and conversation.

— so the Targum says: “as are the works of the mother, so those of the daughter.”

45 Thou art thy mother’s daughter, who loatheth her husband and her children, and thou art the sister of thy sisters, who loathed their husbands and their children. Your mother was a Hittite and your father an Amorite. the Targum says, “was not your mother Sarah among the Hittites? and she did not do according to their works; and though your father Abraham was among the Amorites, yet he walked not in their counsels.”

46 And thine elder sister is Samaria, she and her daughters, who dwell at thy left hand; and thy younger sister, who dwelleth at thy right hand, is Sodom and her daughters. — Samaria, she and her daughters. The initial inhabitants maybe be Israelites, but they adopted idol worship starting with Jeroboam, worshipping of their calves at Dan and Bethel. The fanciful Samaritans came later, but they are SUN-worshippers.

— today more than 98.5 percent of Christians are honoring the SUN by observing SUNday. They have “their backs toward the temple of the Lord and their faces toward the east; and they worshiped the SUN toward the east,” Ezekiel 8:16. At even on the Fourteenth, onset to begin their passover, the Samaritans face the west as the SUN is setting. How awesome the sight is, exclaims Fred Coulter, for such a surreal ceremony to take place.

— others, following the SUN-worshipping Samaritans, the Church of God Communities are showing their contempt by having their “wavesheaf offering” and Pentecost on a SUNday. Always on SUNdays. And these are supposedly in God’s sanctuary, but God says He is a jealous God, so these pretentious Christians could be spewed out of His mouth! No? Regardless, there are those being described in Revelation 3:17 — wretched, miserable, poor, blind and naked. “As many as I love, I rebuke and chasten: or else I will spew thee out of My mouth (v16,19).”

— Sodom and her daughters; witness the proliferation of LGBTQIA (lesbian, gay, bisexual, transgender, queer (questioning), intersex, asexual (agender)). Thou “madest for thyself images of men,” Ezekiel 16:17). Women been changed into men, and men into women, all images of what they did in Sodom.

Woe unto them that call evil good, and good evil; that count darkness as light, and light as darkness; that put bitter for sweet, and sweet for bitter! Isaiah 5:20

47 Yet hast thou not walked after their ways, nor done according to their abominations, but, as if that were a very little thing, thou wast corrupted more than they in all thy ways.

48 As I live, saith the Lord God, Sodom thy sister hath not done, she nor her daughters, as thou hast done, thou and thy daughters. — as I live, saith the Lord God…. this is an oath, which the Lord God swore; who, because he could swear by no greater, he swore by himself, by his life; and this he did to confirm what he had and was about to say, that the sins of modern house of Israel were greater than those of Samaria and Sodom; which might not be easily believed, but it was as true as he was the living God.

49 Behold, this was the iniquity of thy sister Sodom: pride, fullness of bread, and abundance of idleness was in her and in her daughters, neither did she strengthen the hand of the poor and needy;

50 and they were haughty and committed abomination before Me. Therefore I took them away as I saw good.

51 Neither hath Samaria committed half of thy sins; but thou hast multiplied thine abominations more than they, and hast justified thy sisters in all thine abominations which thou hast done.

52 Thou also, who hast judged thy sisters, bear thine own shame for thy sins that thou hast committed more abominable than they: they are more righteous than thou. Yea, be thou confounded also and bear thy shame, in that thou hast justified thy sisters.

53 “‘When I shall bring back their captives, the captives of Sodom and her daughters and the captives of Samaria and her daughters, then will I bring back the captivity of thy captives in the midst of them,

54 that thou mayest bear thine own shame and mayest be confounded in all that thou hast done, in that thou art a comfort unto them.

55 When thy sisters, Sodom and her daughters, shall return to their former estate and Samaria and her daughters shall return to their former estate, then thou and thy daughters shall return to your former estate.

56 For thy sister Sodom was not mentioned by thy mouth in the day of thy pride,

57 before thy wickedness was uncovered, as at the time of thy reproach of the daughters of Syria and all who are round about her, the daughters of the Philistines, who despise thee round about.

58 Thou hast borne thy lewdness and thine abominations, saith the Lord.

59 “‘For thus saith the Lord God: I will even deal with thee as thou hast done, who hast despised the oath in breaking the covenant.

60 Nevertheless I will remember My covenant with thee in the days of thy youth, and I will establish unto thee an everlasting covenant.

61 Then thou shalt remember thy ways and be ashamed when thou shalt receive thy sisters, thine elder and thy younger; and I will give them unto thee for daughters, but not by thy covenant. then thou shalt remember thy ways, and be ashamed…. when the new spirit of truth is manifested and applied, it brings persons to a sense of their sins, and to an ingenuous acknowledgment of them, with shame and blushing; they remember their evil ways in which they have walked, and blush at the thoughts of what they have been guilty of; and how they have sinned against a God of love, grace, and mercy; and what vile ungrateful creatures they have been.

62 And I will establish My covenant with thee; and thou shalt know that I am the Lord,

63 that thou mayest remember and be confounded and never open thy mouth any more because of thy shame, when I am pacified toward thee for all that thou hast done, saith the Lord God.’”

In conjunction with this chapter, a great youtube to watch here (Brian Berletic vs Daniel Dumbrill)

“I HAVE SEEN A HORRIBLE THING IN THE HOUSE OF ISRAEL” HOSEA 6:10

Ezekiel (Ch 13-14)

•September 11, 2021 • Leave a Comment

We have established that this prophecy that Ezekiel delivered was not to be fulfilled during his time, but that there were many years to come; its timing was a great distance into the future (Ezekiel 12:27), into our time and the message is primarily and principally for the United States of America, and secondarily its European allies.

Ezekiel 13

1 And the word of the Lord came unto me, saying,

“Son of man, prophesy against the prophets of Israel who prophesy, and say thou unto them that prophesy out of their own hearts: ‘Hear ye the word of the Lord! — Son of man, prophesy against the prophets of Israel…. who called themselves so, and were accounted such by others; though they were not true, but the Targum calls them false prophets;

— that prophesy; that is, smooth things to the people; promising a speedy return from the captivity; or that Jerusalem should not be taken by the Chaldeans, and the inhabitants of it, and of the land, be carried captive.

Thus saith the Lord God: Woe unto the foolish prophets, who follow their own spirit and have seen nothing! — false prophecies came into their own spirits and was agreeable to their fancies and carnal imaginations, pretending to the spirit of prophecy.

The prophet that hath a dream, let him tell a dream; and he that hath My word, let him speak My word faithfully. What is the chaff to the wheat?” saith the Lord. Jeremiah 23:28

— any dream is the chaff – it is of no value; it is as wood, hay, and stubble. Only God’s Word is the wheat – in parallel with gold, silver, and precious stones.

O Israel, thy prophets are like the foxes in the deserts. these false prophets, as the Targum says; they are comparable to foxes, for their craftiness and cunning, and lying in wait to deceive, as these seduced the Lord’s people.

Ye have not gone up into the gaps [or breaches], neither made up the hedge [or a “fence”, a fortification] for the house of Israel to stand in the battle on the day of the Lord. — ye have not gone up into the gaps [or breaches as the Targum says]. The allusion is to breaches made in the walls of a city when besieged; at which time those within gather together in great numbers to meet the enemy, and prevent his entrance by the breaches.

— these words are either spoken to the princes of Israel, the civil magistrates; or to the prophets, who seeing the sins of the people, like a mighty torrent, opening a breach for the wrath and judgments of God to pour in upon them, should have put up their prayers, and made intercession to God for them; neither of which they did, and therefore are blamed here.

They have seen vanity and lying divination, saying, “The Lord saith,” but the Lord hath not sent them; and they have made others to hope that they would confirm the word. they have seen vanity, and lying divination…. the visions the false prophets pretended to see were nothing but the fruit of their own fancies and imaginations, and had nothing real in them; and what they divined or foretold should be were all lies, and never came to pass, and never would.

Have ye not seen a vain vision and have ye not spoken a lying divination, wherein ye say, “The Lord saith it,” albeit I have not spoken?

“‘Therefore thus saith the Lord God: Because ye have spoken vanity and seen lies, therefore, behold, I am against you, saith the Lord God.

And Mine hand shall be upon the prophets who see vanity and who divine lies; they shall not be in the assembly of My people, neither shall they be written in the writing of the house of Israel, neither shall they enter into the land of Israel; and ye shall know that I am the Lord God. Gill: they shall not be in the assembly of my people, shall have no place in the church of God, nor fellowship with the saints; they shall not join with them in religious worship here;

but either shall be left by the righteous judgment of God to separate themselves from them, or shall be excluded their communion; and much less shall they stand in the congregation of the righteous hereafter: or, “they shall not be in the secret”, or “council of my people.”

The secret of the Lord is with them that fear Him, and He will show them His covenant. Psalm 25:14

10 “‘Because, even because they have seduced My people, saying, “Peace,” and there was no peace, and one built up a wall, and lo, others daubed it with untempered mortar,

11 say unto those who daub it with untempered mortar that it shall fall. There shall be an overflowing shower, and ye, O great hailstones, shall fall, and a stormy wind shall rend it. — this is another way of saying building a house upon the sands, loose sands.

—the vast majority which would be no less than 99.99 percent of today’s professing Christianity make this fundamental error. This porous foundation differs greatly from the original Nazarenes where they understood what the Oracles as given to the Jews (Romans 3:1-4) would mean. Unless trained in Judaism, they wouldn’t be able to read the Sacred Text, which only had consonants written. This means our modern version of Christianity is primarily built on sands, loose sands. More here.

12 Lo, when the wall has fallen, shall it not be said unto you, “Where is the daubing wherewith ye have daubed it?”

13 Therefore thus saith the Lord God: I will even rend it with a stormy wind in My fury; and there shall be an overflowing shower in Mine anger and great hailstones in My fury to consume it.

14 So will I break down the wall that ye have daubed with untempered mortar and bring it down to the ground, so that the foundation thereof shall be uncovered, and it shall fall and ye shall be consumed in the midst thereof; and ye shall know that I am the Lord. — so says the Targum, “and I will destroy the city in which ye have prophesied false prophecies; and I will cause it to fall to the ground, and its foundations shall be discovered.” Much is repeated and expressed in similar words, both for the sake of confirmation and explanation of what is before said.

15 Thus will I accomplish My wrath upon the wall and upon them that have daubed it with untempered mortar, and will say unto you: “The wall is no more, neither they that daubed it,

16 to wit, the prophets of Israel who prophesy concerning Jerusalem, and who see visions of peace for her and there is no peace, saith the Lord God.”’

One already passed, more along the way . . .

17 “Likewise, thou son of man, set thy face against the daughters of thy people who prophesy out of their own heart; and prophesy thou against them

18 and say, ‘Thus saith the Lord God: Woe to the women who sew pillows to all armholes and make kerchiefs upon the head of those of every stature to hunt souls! Will ye hunt the souls of My people, and will ye save the souls alive who come unto you?

19 And will ye pollute Me among My people for handfuls of barley and for pieces of bread, to slay the souls who should not die and to save the souls alive that should not live, by your lying to My people who hear your lies? and will ye pollute me among my people…. defile the name of the Lord, by abusing it, to cover their wicked designs and practices, pretending they were seat by him, when they were not; that what they said came from him, though he spoke not by them; and that it was his will they declared, when it was their own, and what came out of their own hearts and heads:

— so the Targum says, “will ye pollute my will among my people”; to profane his name among the Gentiles was a great sin, but to pollute it among his own people was greater; attempting to draw them aside from his fear and worship, and that for gain, for small gain too.

20 “‘Therefore thus saith the Lord God: Behold, I am against your pillows, wherewith ye there hunt the souls to make them fly; and I will tear them from your arms and will let the souls go, even the souls whom ye hunt to make them fly.

21 Your kerchiefs also will I tear and deliver My people out of your hand, and they shall be no more in your hand to be hunted; and ye shall know that I am the Lord.

22 Because with lies ye have made the heart of the righteous sad, whom I have not made sad, and strengthened the hands of the wicked, that he should not return from his wicked way by promising him life, — Ephraim is a chronic liar; compulsive lying constantly and continuously; chief of whom is Mike Pompeo freely admitting lying within the CIA : We lied, We cheated, We stole

A parallel scripture is:

Ephraim compasseth me about with lies, and the house of Israel with deceit; but Judah yet ruleth with God, and is faithful with the saints. Hosea 11:12

23 therefore ye shall see no more vanity nor divine divinations; for I will deliver My people out of your hand, and ye shall know that I am the Lord.’”

Ezekiel 14

This chapter emphasizes Israel, house of Israel rather than Judah or house of Judah. Earlier we have established that Ezekiel’s messages were actually meant for those living far into the future, in our time, to the modern house of Israel, the chief of whom is Ephraim, the United States of America. So this prophecy continues . . .

1 Then came certain of the elders of Israel unto me and sat before me. — the elders of Israel unto me…. if these were the elders of Israel, than they should be the “elders of Judah”; hence paradoxically, these are elders of Israel, indicating this scene is prophetic in significance, for the endtime, for those of the house of Israel.

And the word of the Lord came unto me, saying,

“Son of man, these men have set up their idols in their heart and put the stumbling block of their iniquity before their face. Should I be inquired of at all by them?

Therefore speak unto them and say unto them, ‘Thus saith the Lord God: Every man of the house of Israel that setteth up his idols in his heart and putteth the stumbling block of his iniquity before his face, and cometh to the prophet, I the Lord will answer him that cometh according to the multitude of his idols,

that I may take the house of Israel in their own heart, because they are all estranged from Me through their idols.’ — the house of Israel; to have a form and shell of godliness, but to deny its substance, is the essence of hypocrisy.

“Therefore say unto the house of Israel, ‘Thus saith the Lord God: Repent, and turn yourselves from your idols, and turn away your faces from all your abominations. — numerous reference that the warnings are to the house of Israel, here, and closeby verses.

For every one of the house of Israel, or of the stranger that sojourneth in Israel, who separateth himself from Me and setteth up his idols in his heart, and putteth the stumbling block of his iniquity before his face, and cometh to a prophet to inquire of him concerning Me, I the Lord will answer him by Myself. — such men, be he an Israelite or a Gentile, come to a prophet to inquire of God, but it seems too late . . .

And I will set My face against that man and will make him a sign and a proverb, and I will cut him off from the midst of My people; and ye shall know that I am the Lord. and I will set my face against that man…. and look him out of countenance, notwithstanding all his daring impudence and presumption in coming to a prophet of the Lord, and inquiring of him by him, yet guilty of gross idolatry;

the Targum renders it, “my fury”, or “wrath”; and indeed that is what is meant; when God sets his face against a man, he pours out his wrath, or inflicts punishment on him;

— even if he’s set his mind “to inquire of him (Ezekiel) concerning Me,” (verse 7 above); there is a time that’s too late.

And if the prophet be deceived when he hath spoken a thing, I the Lord have deceived [enticed] that prophet, and I will stretch out My hand upon him and will destroy him from the midst of My people Israel. — Rashi: have enticed: I opened a doorway for him to do whatever he wishes. And from here we can learn that if one wishes to defile himself, they open a door for him.

10 And they shall bear the punishment of their iniquity. The punishment of the prophet shall be even as the punishment of him that seeketh unto him, — the punishment of the prophet shall be even as the punishment of him that seekest unto him; they being both alike culpable, each pursuing the desires of their own evil hearts; the one seeking for smooth things to be spoken to him; the other speaking them, in order to gratify him.

11 that the house of Israel may go no more astray from Me, neither be polluted any more with all their transgressions, but that they may be My people and I may be their God, saith the Lord God.’” — conversion during captivity, not before.

12 The word of the Lord came again to me, saying,

13 “Son of man, when the land sinneth against Me by trespassing grievously, then will I stretch out Mine hand upon it, and will break the staff of the bread thereof, and will send famine upon it, and will cut off man and beast from it.

14 Though these three men, Noah, Daniel, and Job were in it, they should deliver but their own souls by their righteousness, saith the Lord God. — though Noah, Daniel, and Job; the intercession even of the holiest of men shall not avert God’s judgments. 

15 If I cause noisome beasts to pass through the land, and they spoil it so that it be desolate, that no man may pass through because of the beasts,

16 though these three men were in it, as I live, saith the Lord God, they shall deliver neither sons nor daughters. They only shall be delivered, but the land shall be desolate. they shall deliver neither sons nor daughters; meaning not adult children, but only little ones, infant sons and daughters; such as had not been guilty.

17 Or if I bring a sword upon that land and say, ‘Sword, go through the land,’ so that I cut off man and beast from it,

18 though these three men were in it, as I live, saith the Lord God, they shall deliver neither sons nor daughters, but they only shall be delivered themselves.

19 Or if I send a pestilence into that land and pour out My fury upon it in blood to cut off from it man and beast, and pour out my fury upon it in blood; or, “by blood”; by corrupting the blood, which is done when a man is seized with the pestilence;

— the Targum renders it, “with slaughter”; by slaying a great number of persons by that disease, as a token of fury and wrath, because of their transgressions. It may be rendered, “because of blood”; and so express the cause and reason of the judgment, the shedding of innocent blood.

20 though Noah, Daniel, and Job were in it, as I live, saith the Lord God, they shall deliver neither son nor daughter. They shall but deliver their own souls by their righteousness.

21 “For thus saith the Lord God: How much more when I send My four sore judgments upon Jerusalem — the sword and the famine and the noisome beast and the pestilence — to cut off from it man and beast? — my four sore judgments — SWORD, war. FAMINE, occasioned by drought. PESTILENCE, epidemic diseases which sweep off a great part of the inhabitants of a land. The NOISOME BEAST, the multiplication of wild beasts in consequence of the general destruction of the inhabitants.

22 Yet, behold, therein shall be left a remnant that shall be brought forth, both sons and daughters. Behold, they shall come forth unto you, and ye shall see their way and their doings; and ye shall be comforted concerning the evil that I have brought upon Jerusalem, even concerning all that I have brought upon it.

23 And they shall comfort you, when ye see their ways and their doings; and ye shall know that I have not done without cause all that I have done in it, saith the Lord God.” — and ye shall know that I have not done without cause all that I have done in it, saith the Lord God; that there was just reason for it; that he was sufficiently provoked to do it; and that it was necessary it should be done, for his own honour, and the good of others.

Ezekiel (Ch 11-12)

•September 10, 2021 • Leave a Comment

As Ezekiel continues his visions of God in Jerusalem, his prophecy is for the children of Israel at the endtime.

Ezekiel 11

1 Moreover the Spirit lifted me up and brought me unto the east gate of the Lord’S house, which looketh eastward; and behold, at the door of the gate five and twenty men, among whom I saw Jaazaniah the son of Azzur, and Pelatiah the son of Benaiah, princes of the people. — and behold at the door of the gate five and twenty men as Rashi thought they were the same as in Ezekiel 8:16 “their backs to the Temple of the Lord” and “their faces toward the east; and they worshiped the sun;”

— now they’re between the porch and the altar; and more details about them, performing services and worshipping there; including the priests at the door of the eastern gate, sitting as a court of judicature, and were civil magistrates;

some say Jerusalem was divided into twenty four parishes, districts, or wards, and everyone had its own head, ruler, and governor; and that there was one who was the president over them all, like the mayor and its rich and influential: “princes”of a city; today we have the likes of Bill Gates, George Soros, Mark Zuckerberg and Rupert Murdoch.

— Gill: princes of the people; men who were entrusted with power and authority to exercise the laws of the nation; and who should have been reformers of the people, and ought to have given them good advice, and set them good examples; whereas they were the reverse.

Then said He unto me: “Son of man, these are the men who devise mischief and give wicked counsel in this city,

— Gill: these are the men that devise mischief, who formed schemes for the holding out of the siege, and for the security of the city, and of themselves in it, which was all folly and vanity:

— and give wicked counsel in this city; either in ecclesiastical affairs, to forsake the worship of God, and cleave to the idols of the nations; or in civil things.

who say, ‘It is not near; let us build houses: this city is the cauldron, and we are the flesh.’ — it is not near — that is, the threatened invasion; this mean the Chiefs of the city are advising the people to ignore Ezekiel’s warnings. These infidels are laughing and even mocking at Ezekiel, saying: “We will run all risks, we will abide in the city. Though it be the cauldron, and we the flesh, yet we will share its fate: if it perish, we will perish with it.” 

— ‘It is not near; or it’s as in Ezekiel 12:27, “of the times that are far off,” where their elders dismissed that Ezekiel’s vision were meant for many years yet to come: “of the times that are far off.”

Therefore prophesy against them, prophesy, O son of man.”

And the Spirit of the Lord fell upon me, and said unto me, “Speak! Thus saith the Lord: Thus have ye said, O house of Israel; for I know the things that come into your mind, every one of them.

Ye have multiplied your slain in this city, and ye have filled the streets thereof with the slain. — “multiplied your slain“ capital crimes increasing, blood upon blood, murder upon murder, shedding of innocent blood, gun violence everywhere in the United States today.

Therefore thus saith the Lord God: Your slain whom ye have laid in the midst of it, they are the flesh, and this city is the cauldron; but I will bring you forth out of the midst of it. — but I will bring you forth out of the midst of it: where they promised themselves safety; ye shall not be permitted to do so, but God will ensure they shall be carried away as captives.

Ye have feared the sword; and I will bring a sword upon you, saith the Lord God. — “ye have multiplied your slain in this city, and ye have filled the streets thereof with the slain;” these crimes, to God, are serious stuff! Hence numerous repeats of a returning “sword” and reminders; repeats “I will bring a sword” and reminders. “Whatever crimes you inflict on others, these will be inflicted back on you.”

And I will bring you out of the midst thereof, and deliver you into the hands of strangers and will execute judgments among you. — indeed the Sword appeared in 70 AD; this time by the hands of the Romans, but it was actually God executing His judgement on:

(a) the Essenses (who had their own calendar); and;

— (b) the Sadducees (who observed a Passover and Pentecost similar to the Samaritan’s) where both defiled the tenets from the Sanhedrin and were wiped out by the Sword!

10 Ye shall fall by the sword; I will judge you in the border of Israel; and ye shall know that I am the Lord.

11 This city shall not be your cauldron, neither shall ye be the flesh in the midst thereof; but I will judge you in the border of Israel.

12 And ye shall know that I am the Lord; for ye have not walked in My statutes, neither executed My judgments, but have done according to the manner of the nations who are round about you.”

13 And it came to pass when I prophesied, that Pelatiah the son of Benaiah died. Then fell I down upon my face, and cried with a loud voice and said, “Ah, Lord God! Wilt Thou make a full end of the remnant of Israel?” — conditions would be so bad that those few who survive would ask, “Would God make a full end to the remnant of Israel?”

The answer is “no.” Nebuchadnezzar left a few Jews back in their land, but they had a pay taxes and tributes to their new Babylonian masters.

II King 25 (Assassination of Gedaliah in 423 BCE: one of the four fast; 3 Tishrei)

22 And as for the people who remained in the land of Judah, whom Nebuchadnezzar king of Babylon had left, even over them he made Gedaliah the son of Ahikam, the son of Shaphan, ruler.

23 And when all the captains of the armies, they and their men, heard that the king of Babylon had made Gedaliah governor, there came to Gedaliah at Mizpah even Ishmael the son of Nethaniah, and Johanan the son of Careah, and Seraiah the son of Tanhumeth the Netophathite, and Jaazaniah the son of a Maachathite, they and their men.

24 And Gedaliah swore to them and to their men, and said unto them, “Fear not to be the servants of the Chaldeans. Dwell in the land and serve the king of Babylon, and it shall be well with you.”

25 But it came to pass in the seventh month that Ishmael the son of Nethaniah, the son of Elishama, of the seed royal, came and ten men with him, and smote Gedaliah so that he died, and the Jews and the Chaldeans who were with him at Mizpah.

26 And all the people, both small and great, and the captains of the armies, arose and came to Egypt; for they were afraid of the Chaldeans.

14 Again the word of the Lord came unto me, saying,

15 “Son of man, thy brethren, even thy brethren, the men of thy kindred, and all the house of Israel wholly, are they unto whom the inhabitants of Jerusalem have said, ‘Get you far from the Lord; unto us is this land given as a possession.’ — all the house of Israel wholly . . . ‘unto us is this land given as a possession.’ Does this mean that the “whole house of Israel” are coming back to claim the land of Israel that were originally given? If so it would include the whole of West Bank, more on Golan Heights and a large chunk of Jordan onward to the land of Iraq.

Perhaps this organization, BNEY YOSEF NORTH AMERICA https://bneyyosefna.com would take a lead.

16 Therefore say, ‘Thus saith the Lord God: Although I have cast them far off among the nations, and although I have scattered them among the countries, yet will I be to them as a little sanctuary in the countries where they shall come.’ — it may be rendered, “the sanctuary of a few”; especially that were truly God-fearing. The Targum says, “I have given them synagogues, second to my sanctuary, and they are as few in the provinces where they are carried captive.”

17 Therefore say, ‘Thus saith the Lord God: I will even gather you from the people and assemble you out of the countries where ye have been scattered, and I will give you the land of Israel.’

18 And they shall come thither, and they shall take away all the detestable things thereof and all the abominations thereof from thence. there would be a lot of cleaning to do, their idols and all things detestable since the birth of their nations. All these abominations should be wholly rooted out; historically this had its accomplishment under Zerubbabel, Ezra, Haggai, and so there should be another revival.

— but who, if any, would clean the detestable filths and abominations of the latter-day house of Israel?

<<< there seems a great gap in time in between from their detestable filthy and abominable stage above to one where the house of Israel would be ready to accept God’s new spirits, statues and judgments below; from Ezekiel 2 to Ezekiel 37 >>>

19 And I will give them one heart, and I will put a new spirit within you; and I will take the stony heart out of their flesh, and will give them a heart of flesh,

20 that they may walk in My statutes and keep Mine ordinances, and do them. And they shall be My people, and I will be their God.

21 But as for them whose heart walketh after the heart of their detestable things and their abominations, I will recompense their way upon their own heads, saith the Lord God.”

22 Then the cherubims lifted up their wings, and the wheels beside them, and the glory of the God of Israel was over them.

23 And the glory of the Lord went up from the midst of the city and stood upon the mountain which is on the east side of the city. — the glory of the Lord went up from the midst of the city — this vision demonstrates that God did not abandon this people all at once; he departed by little and little.

24 Afterwards the Spirit took me up, and brought me in a vision by the Spirit of God into Chaldea to those of the captivity. So the vision that I had seen went up from me. — from Jerusalem, Ezekiel was brought back to the land of the Chaldea, back with fellow captives by the River Chebar. But all this was done in vision; under the influence of the Spirit of God, as if he was carried to Jerusalem, and there saw and heard all he did, and then was brought back again to Chaldea.

25 Then I spoke unto those of the captivity all the things that the Lord had shown me.

~~~

This vision of Shekinah departing (verse 23 above) demonstrates that God did not abandon this people all at once; he departed by little and little. First, he left the temple. Second, he stopped a little at the gate of the city. Third, he departed entirely from the city and went to the Mount of Olives, which lay on the east side of the city. Having tarried there for some time to see if they would repent and turn to him.

Fourth, he departed earth to heaven. The vision being now concluded, Ezekiel is taken away by the Spirit back to Chaldea, and there announces to fellow captive Israelites what God had showed him in the preceding visions, and the good that he had spoken concerning them; but they did not seem to agree with him, which the prophet reprimands severely.

Ezekiel 12

Ezekiel 12 explains why a few are going to be left to survive, that they may declare all their abominations among the nations. And that the vision that Ezekiel seeth is for many days to come, “and he prophesieth of the times that are far off.”

1 The word of the Lord also came unto me, saying,

“Son of man, thou dwellest in the midst of a rebellious house, who have eyes to see and see not; they have ears to hear and hear not, for they are a rebellious house. — this is true even for those dwelling in the Sanctuary, in the house of God; they have ears but couldn’t hear, eyes to see but couldn’t see; they don’t even know what the Oracles of God are; not to say about a willingness and the spirits to keep them.

Therefore, thou son of man, prepare thee supplies for departure, and remove by day in their sight; and thou shalt remove from thy place to another place in their sight. It may be they will consider, though they are a rebellious house.

Then shalt thou bring forth thy goods by day in their sight, as supplies for removing; and thou shalt go forth at evening in their sight, as they that go forth into captivity.

Dig thou through the wall in their sight, and carry out through it.

In their sight shalt thou bear it upon thy shoulders and carry it forth in the dark [עֲלָטָה H5939 thick darkness]. Thou shalt cover thy face, that thou see not the ground; for I have set thee for a sign unto the house of Israel.”

And I did so as I was commanded: I brought forth my goods by day, as supplies for captivity, and in the evening I dug through the wall with mine hand. I brought them forth in the dark [darkness], and I bore them upon my shoulder in their sight.

And in the morning came the word of the Lord unto me, saying,

“Son of man, hath not the house of Israel, the rebellious house, said unto thee, ‘What doest thou?’

10 Say thou unto them, ‘Thus saith the Lord God: This burden concerneth the prince in Jerusalem and all the house of Israel that are among them.’

11 Say, ‘I am your sign: as I have done, so shall it be done unto them. They shall remove and go into captivity.’ — this captivity of the house of Israel would most probably last 190 years and for the house of Judah 40 years (see study on Ezekiel chapter 4).

12 And the prince who is among them shall bear upon his shoulder in the dark [darkness], and shall go forth; they shall dig through the wall to carry out through it. He shall cover his face, that he see not the ground with his eyes.

13 My net also will I spread upon him, and he shall be taken in My snare; and I will bring him to Babylon to the land of the Chaldeans; yet shall he not see it, though he shall die there.

14 And I will scatter toward every wind all who are about him to help him, and all his troops; and I will draw out the sword after them.

15 And they shall know that I am the Lord, when I shall scatter them among the nations and disperse them in the countries.

16 But I will leave a few men of them from the sword, from the famine and from the pestilence, that they may declare all their abominations among the nations whither they come; and they shall know that I am the Lord.” — “that they may declare all their abominations among the nations;” this explains why a few are left to survive;

if they have hidden in some secret hideouts, they won’t be able to “declare all their abominations among the nations” whither they come; who, observing their calamities, and distresses, could deserve and a need to know, and hear those who are well-versed to explain their sins, abominations and judgement to the nations.

17 Moreover the word of the Lord came to me, saying,

18 “Son of man, eat thy bread with quaking, and drink thy water with trembling and with sorrow;

— those remnants who survive would explain to the nations that they have been guilty of great enormities, so that their punishment was a visible and standing declaration and warning to the nations of the abominable sins they, of the house of Israel, had been guilty of; and not to repeat them in their own nations.

19 and say unto the people of the land, ‘Thus saith the Lord God of the inhabitants of Jerusalem and of the land of Israel: They shall eat their bread with sorrow, and drink their water with dismay, that her land may be desolate of all that is therein, because of the violence of all them that dwell therein. — her land will be desolated: men, cities, towns, houses, vineyards, fields, fruits, and cattle are all in ruin. Those who could see, only sorrow and dismay.

20 And the cities that are inhabited shall be laid waste, and the land shall be desolate; and ye shall know that I am the Lord.’”

21 And the word of the Lord came unto me, saying,

22 “Son of man, what is that proverb that ye have in the land of Israel, saying, ‘The days are prolonged, and every vision faileth’? — this is another way for the hardhearted (also stiffnecked) in the “land of Israel” to dismiss Ezekiel’s warning, “every visions faileth”!

23 Tell them therefore, ‘Thus saith the Lord God: I will make this proverb to cease, and they shall no more use it as a proverb in Israel.’ But say unto them, ‘The days are at hand, and the effect of every vision.

24 For there shall be no more any vain vision nor flattering divination within the house of Israel.

25 For I am the Lord: I will speak, and the word that I shall speak shall come to pass; it shall be no more put off. For in your days, O rebellious house, will I say the word and will perform it, saith the Lord God.’”

26 Again the word of the Lord came to me, saying,

27 “Son of man, behold, they of the house of Israel say, ‘The vision that he seeth is for many days to come, and he prophesieth of the times that are far off.’ — see, this warning vision that Ezekiel saw concerning Israel’s ruin and the prophecy which he delivered, the house of Israel say, were not for their time to be fulfilled; dismissing that that they were only meant for many years yet to come: “of the times that are far off.”

28 Therefore say unto them, ‘Thus saith the Lord God: There shall none of My words be put off any more, but the word which I have spoken shall be done, saith the Lord God.’” but the word which I have spoken shall be done, saith the Lord God: one jot and tittle of it shall not pass away till all be fulfilled; sooner may heaven and earth pass away than that shall; it is for ever settled in heaven, and shall be fulfilled on earth; he that has said it is of one mind, and none can turn him; and is able to do whatsoever he pleases.

~~~

Please allow me to elaborate (on verse 27 above): God must had told Ezekiel that the visions were for a time far into the future, and Ezekiel, in turn, repeated God’s message to the house of Israel, which seems unrecorded. Being hardhearted, the house of Israel, or their elders, turned around, brushing off those warnings by saying the visions were only meant for those living in the far future, which is recorded as in verse 27; hence they could continue to practice their abominable things which they were doing.

But more calamities were to fall for the house of Judah a few years later when Nebuchadnezzar took more captives; and a few hundred years later, in 70 AD and 132 AD, this time by the Romans; hence God’s warning messages were meant for the house of Judah since those days; timeless, and another meant “of the times that are far off.” That is, it was a warning meant for the endtime, our time, and this prophecy is primarily and principally for the United States of America and secondarily its European allies.

Ezekiel (Ch 9-10)

•September 8, 2021 • 2 Comments

As Ezekiel continues his visions of God in Jerusalem, his prophecy is for the children of Israel at the endtime.

In chapter 9 it has the core subject about killing those who preside over God’s Sanctuary, and in the endtime, the saints. Yet these saints are to be slain: “Slay utterly old and young . . . and begin at my Sanctuary,” Ezekiel 9:6.

But a small remnants are spared; why spared these and not the others?

Ezekiel: Prophecy as Performance Art | My Jewish Learning
Ezekiel’s Vision of God for the Endtime rebellious House of Israel

Ezekiel 9

1 He cried also in mine ears with a loud voice, saying, “Cause them that have charge over the city to draw near, even every man with his destroying weapon in his hand.” — he cried also in mine ears with a loud voice…. that is, the Shekinah, whom the prophet saw in the temple, and who directed him from place to place, now wanted to show him all the abominations committed there;

— saying, cause them that have the charge over the city to draw near; or, “those appointed over the city,” as the Targum says; that is, the city of Jerusalem; by whom are meant the ministering angels, who had been the guardians of it, but now were to be employed another way;

— even every man with his destroying weapon in his hand; weapons of war, as bows and arrows, sword and spear.

And behold, six men came from the way of the higher gate, which lieth toward the north, and every man a slaughter weapon in his hand; and one man among them was clothed with linen, with a writer’s inkhorn by his side. And they went in and stood beside the brazen altar. — in the good old days, these “six men” or six destroyers could be the generals of Nebuchadnezzar Jeremiah 39:3; but in modern times, they could be Chechens, Syrians, Iraqis, Palestinians, Libyans and Afghans.

— in the Talmud: “wrath, anger, fury, destruction, breach, and consumption.”

And the glory of the God of Israel had gone up from the cherub, whereupon he was, to the threshold of the house. And He called to the man clothed with linen, who had the writer’s inkhorn by his side; — and the glory of the God of Israel was gone up from the cherub, whereupon he was…. that is, the glorious God; or the Shekinah, removed from thence, as a token of his being about to depart from the temple, and with its protection removed, the temple was destroy in a short time.

— the Targum says, “the glory of the God of Israel departed in the cherub on which he dwelt, in the house of the holy of holies;” the cherubim removed with him, as were his chariot in which he rode.

2321.) Ezekiel 10 | DWELLING in the Word
Shekinah, the Glory of God left the Temple and Jerusalem was soon destroyed

and the Lord said unto him, “Go through the midst of the city, through the midst of Jerusalem, and set a mark upon the foreheads of the men who sigh and who cry because of all the abominations that are done in the midst thereof.” and you shall mark a sign: you shall mark a sign on the foreheads of the righteous men in order to show the destroyers those men whom they should not strike.

Gill: It is a Rabbinical thought, mentioned by Kimchi that Gabriel had orders to write the letter ת (tav; the last letter of the alphabet) in ink upon the foreheads of the righteous, which signified תחיה, “thou shall live”. And for the wicked the same letter ת were written in blood upon the foreheads, but it signified תמות, “thou shall die”.

the letter ת in the original paleo Hebrew looks like an x sign.

And to the others He said in mine hearing, “Go ye after him through the city and smite. Let not your eye spare, neither have ye pity.

Slay utterly old and young, both maids and little children and women; but come not near any man upon whom is the mark; and begin at My sanctuary.” Then they began with the elder men who were before the house. — Gill: and begin at my sanctuary; the temple, the house of God, and the priests and Levites that dwelt there;

the Septuagint version is, “begin at my saints”; those who professed themselves to be saints of the Lord, and were separated and devoted to his service; and so the Rabbins say, do not read ממקדשי, “at my sanctuary”; but ממקודשי, “at those that sanctify me”, or “my sanctified ones”; which they interpret of those that keep the whole law, from “aleph” to “tau”.

And He said unto them, “Defile the house, and fill the courts with the slain. Go ye forth.” And they went forth and slew in the city.

And it came to pass, while they were slaying them and I was left, that I fell upon my face and cried, and said, “Ah Lord God! Wilt Thou destroy all the residue of Israel in Thy pouring out of Thy fury upon Jerusalem?” — when Ezekiel was delivering his message both the house of Israel and Judah were already in captivity. He was among the captives at the river Chebar, so Ezekiel’s messages were actually meant for those living far into the future, in our time, to the modern house of Israel, the chief of whom is Ephraim, the United States of America — in thy pouring out of thy fury by famine, pestilence, and sword.

Then said He unto me, “The iniquity of the house of Israel and Judah is exceeding great, and the land is full of blood and the city full of perverseness; for they say, ‘The Lord hath forsaken the earth, and the Lord seeth not.’

A Nation Full of Blood Crimes!

10 And as for Me also, Mine eye shall not spare, neither will I have pity, but I will recompense their ways upon their heads.”

11 And behold, the man clothed with linen, who had the inkhorn by his side, reported the matter, saying, “I have done as Thou hast commanded me.”

~~~

More on Ezekiel 9:6 Slay utterly old and young . . . and begin at my sanctuary:

Today many pretentious Christians, especially among the CoG Communities, believe they will go into a place of safety? But this is just a fantasy. It’s far more likely that lightnings and thunderstorms would begin with these professing Christians.

Deuteronomy 16:18 “You shall appoint judges and officers in all your towns that the Lord your God is giving you, according to your tribes, and they shall judge the people with righteous judgment.

Deuteronomy 17:11 According to the sentence of the law which they shall teach thee, and according to the judgment which they shall tell thee, thou shalt do: thou shalt not decline from the sentence which they shall shew thee, to the right hand, nor to the left. 12 And the man who will do presumptuously, and will not hearken unto the priest who standeth to minister there before the Lord thy God, or unto the judge, even that man shall die.

Moses knew he would die soon and his understanding had been conveyed to the judges, the Levites and priests where the true interpretation of the law were taught. So in the book of Deuteronomy Moses spoke and explained unto all Israel “according unto all that the Lord had given him” as to how to keep them, the blessing they would have if they obey, or cursing if they disobey, in a language they could understand. Men may have good intentions, but may do things seen as presumptuously? What is presumptuous or presumptuously? 

Below are its synonyms: 

arrogant, bumptious, cavalier, chesty, haughty, high-and-mighty, high-handed, high-hat, huffish, huffy, imperious, important, lofty, lordly, masterful, overweening, peremptory, pompous, presuming, pretentious, self-asserting, self-assertive, sniffy, supercilious, superior, uppish, uppity

The Jews were prophesied they would mourn One whom they had rejected: “And they shall look to Me whom they have pierced; then they shall mourn for him, as one mourns for an only son” (Zechariah 12:10). But these Christians have nothing to mourn? Currently these endtime virgins are described as lukewarm and in need of nothing, but would they not mourn when they realise that they had been blind, wretched and naked, seeing finally that Christ had suffered far more through His torn flesh and shed blood than they had ever realised? No?

Today more than 98.5 percent of Christians are honoring the SUN by observing SUNday. They have “their backs toward the temple of the Lord and their faces toward the east; and they worshiped the SUN toward the east,” Ezekiel 8:16.

Others, following the SUN-worshipping Samaritans, the Church of God Communities are showing their contempt for God by having their “wavesheaf offering” and Pentecost on a SUNday. Always on SUNdays. And these are supposedly in God’s sanctuary, but God says He is a jealous God, so these pretentious Christians could be spewed out of His mouth! No? Regardless, there are those being described in Revelation 3:17 wretched, miserable, poor, blind and naked. “As many as I love, I rebuke and chasten: or else I will spew thee out of My mouth (v16,19).”

Despite the above, there’ll be a remnant that are spared: “Go through the midst of the city, through the midst of Jerusalem, and set a mark upon the foreheads of the men who sigh and who cry because of all the abominations that are done in the midst thereof,” Ezekiel 9:4. These remnants “who sigh and who cry” will be marked with a letter ת in ink on the forehead;

but the question is, do we qualify to be in this category?

Ezekiel 10

Chapter 10 is a vision, very much like that in the first chapter, with some difference, and with a different view, the design of it being to represent the wrath of God against Jerusalem, and his departure from the city and temple. A throne much like that in Ezekiel 1:26 is described.

1 Then I looked, and behold, in the firmament that was above the head of the cherubims there appeared over them, as it were, a sapphire stone with the appearance of the likeness of a throne.

And He spoke unto the man clothed with linen, and said, “Go in between the wheels, even under the cherub, and fill thine hand with coals of fire from between the cherubims, and scatter them over the city.” And he went in in my sight. — and He spake unto the man clothed with linen…. that is, the God of Israel gave orders to the man clothed in linen, who appears in another character, and represents the Chaldean or Roman army; these “coals of fire” were an emblem of the wrath of God against Jerusalem.

Now the cherubims stood on the right side of the house when the man went in; and the cloud filled the inner court. — now the cherubim stood on the right side of the house…. according to the Targum, it was the south side of the house; opposite the north; that’s where the gross idolatries were committed.

Then the glory of the Lord went up from the cherub and stood over the threshold of the house; and the house was filled with the cloud, and the court was full of the brightness of the Lord’S glory. this is a token and intimation of the Lord’s leaving of the temple; and a little before the destruction of Jerusalem by the Romans.

And the sound of the cherubims’ wings was heard even to the outer court, as the voice of the Almighty God when He speaketh. and the sound of the cherubim’s wings was heard even to the outer court…. or outward court. The sound of the Kingdom, and salvation by Christ; the sound of this in the swift ministry of the apostles, signified by the “cherubim’s wings”, went into all the earth, and throughout the whole Gentile world.

And it came to pass that when He had commanded the man clothed with linen, saying, “Take fire from between the wheels, from between the cherubims,” then he went in and stood beside the wheels.

And one cherub stretched forth his hand from between the cherubims unto the fire that was between the cherubims, and took thereof and put it into the hands of him that was clothed with linen, who took it and went out. who took it, and went out; took the fire, and went out of the temple, and scattered it upon the city of Jerusalem; so representing the Chaldean, or rather the Roman army, burning it with fire.

but Ezekiel is a prophetic book, so the most important Question remains for us to ponder during the endtime: who would burn down the house of Israel?

And there appeared in the cherubims the form of a man’s hand under their wings. — one of them put forth his hand, which was seen by the prophet, but this was only the “form” of one; which is not to be taken literally, but as seen in the vision of prophecy; and being under their wings denotes secrecy and privacy.

And when I looked, behold, the four wheels by the cherubims, one wheel by one cherub and another wheel by another cherub; and the appearance of the wheels was as the color of a beryl stone.

10 And as for their appearance, all four had one likeness, as if a wheel had been in the midst of a wheel.

11 When they went, they went upon their four sides. They turned not as they went, but to the place whither the head looked they followed it; they turned not as they went.

12 And their whole body, and their backs, and their hands, and their wings, and the wheels, were full of eyes round about — even the wheels that the four had.

13 As for the wheels, it was cried unto them in my hearing, “O wheel.”

14 And every one had four faces: the first face was the face of a cherub, and the second face was the face of a man, and the third the face of a lion, and the fourth the face of an eagle. — the first face was the face of a cherub; this in place of the ox’s face, indicating, perhaps, that the face of an ox and a cherub has the same significance.

But the Ox is also the symbol of the United States; the UK has the Unicorn (more below).

15 And the cherubims were lifted up. This is the living creature that I saw by the River of Chebar.

16 And when the cherubims went, the wheels went alongside them; and when the cherubims lifted up their wings to mount up from the earth, the same wheels also turned not from beside them.

17 When they stood, these stood, and when they were lifted up, these lifted up themselves also; for the spirit of the living creature was in them. when they stood, these stood…. when the one were inactive, lifeless, and without motion, making no progress in knowledge, experience, and practice, the other were so likewise.

18 Then the glory of the Lord departed from off the threshold of the house and stood over the cherubims. — the departure of the glory of God from the threshold to the east gate of the Lord’s house, with the motion of the cherubim and wheels along with him. 

19 And the cherubims lifted up their wings and mounted up from the earth in my sight. When they went out, the wheels also were beside them, and every one stood at the door of the east gate of the Lord’S house; and the glory of the God of Israel was over above them.

20 This is the living creature that I saw under the God of Israel by the River of Chebar; and I knew that they were the cherubims.

21 Every one had four faces apiece, and every one four wings, and the likeness of the hands of a man was under their wings. and everyone four wings: the Septuagint reads eight wings; and the Syriac version “six”; so many in all indeed they had.

22 And the likeness of their faces was the same as the faces which I saw by the River of Chebar, their appearances and themselves. They went every one straight forward. they went everyone straight forward; their motion as well as their form were alike; they kept one even course, looking right on, and their eyes right before them.

~~~

More on the Ox and the Unicorn:

His glory is like the firstling of his ox (bullock), and his horns are like the horns of unicorns. With them he shall push the people together to the ends of the earth; and they are the ten thousands of Ephraim, and they are the thousands of Manasseh,” Deuteronomy 33:17.

In the above verse, the Ox (verse 14 above) and Ephraim are named first, the firstborn of his (Joseph’s) “bullock is his glory”: the reference being to Ephraim; followed by Unicorn and Manasseh.

Although Manasseh was the firstborn, Joseph the father crossed his hands and placed Ephraim as firstborn, hence Ephraim, often known as the thirteenth tribe, represents not just the house of Joseph, but more often the house of the 10-tribes Northern Kingdom.

[U.S. Coat of Arms]
The Coat of Arms of the United States; thirteen Stars and thirteen Arrows – the thirteenth tribe
Royal Coat of Arms of the United Kingdom.svg
A Unicorn in the Royal Coat of Arms of the United Kingdom

In Rabbinic teachings: the myriads (ten thousands) slain by Joshua, of the tribe of Ephraim: These are the myriads descended from Ephraim;

and the thousands of Manasseh: these are the thousands slain by Gideon, who was of the tribe of Manasseh. These are the thousands descended from Manasseh.

In his blessings Jacob ascribes to Ephraim ten thousands, and to Manasseh only thousands; thus foreshowing, that Ephraim the younger was to be the more numerous of the two, as Jacob had before prophesied of them.

Ezekiel (Ch 7-8)

•September 7, 2021 • Leave a Comment

As Ezekiel continues his visions from God, his prophecy is for the children of Israel at the endtime.

Ezekiel 7

Moreover the word of the Lord came unto me, saying, — the Targum, whose origin in the Aramaic language could be traced to Ezra; expresses it as “The word of prophecy from the Lord.”

“Also, thou son of man, thus saith the Lord God unto the land of Israel: “An end! The end is come upon the four corners of the land. — the Targum says, “the punishment of the end, or the punishment determined to come upon the four winds of the earth;” this Targum version recognizes that the Israelites are all over the face of the earth, spread over the four winds!

in Ezekiel 6:3 the message was to the “mountains of Israel,”referring to the United States, UK and France. . . . “and to the hills, to the rivers and to the valleys;” — the hills: Ireland, Switzerland and the Scandinavian countries: Denmark, Norway, and Sweden, Finland, and Iceland; and the valleys, the low countries: Belgium, the Netherlands, and Luxembourg.

— to the rivers; where during the nineteenth century, the British Royal Navy were known to “Rule the Waves;” and the United States having been plowing up and down the five oceans with her Seven Fleets since the British left the scene;

and now “are all over the face of the earth, spread over the four winds” as the Targum says; which would include Australia, New Zealand, Canada (and perhaps South Africa?) and numerous small islands around the world.

and in this context, “the land of Israel” and “over the face of the earth” would most probably include the modern state of Israel in Palestine.

Now is the end come upon thee, and I will send Mine anger upon thee, and will judge thee according to thy ways, and will recompense upon thee all thine abominations.

And Mine eye shall not spare thee, neither will I have pity; but I will recompense thy ways upon thee, and thine abominations shall be in the midst of thee; and ye shall know that I am the Lord. the punishments would be so great that “ye shall know who the LORD is,” to whom vengeance belongs; who takes notice of all their sinful actions, and punishes for them.

“Thus saith the Lord God: An evil, an only evil, behold, is come! the Targum says, “evil after evil, lo, it cometh.”

An end is come, the end is come! It watcheth for thee; behold, it is come. the repeating is for emphasis as these words, so often repeated, show the eagerness and concern of the prophet’s mind; the speed and haste destruction was making, or is to come; and the great hardheartedness and stupidity of the people, which requires constant repetitions.

The morning is come unto thee, O thou that dwellest in the land; the time is come, the day of trouble is near, and not the sounding again of the mountains. — the Targum, “and there is no fleeing or escaping to the tops of the mountains.”

Now will I shortly pour out My fury upon thee, and accomplish Mine anger upon thee; and I will judge thee according to thy ways, and will recompense thee for all thine abominations.

And Mine eye shall not spare, neither will I have pity. I will recompense thee according to thy ways and thine abominations that are in the midst of thee; and ye shall know that I am the Lord that smiteth.

10 “Behold the day, behold, it is come! The morning is gone forth, the rod hath blossomed, pride hath budded. the Targum says, “a ruler hath budded, a wicked one hath appeared.”

11 Violence is risen up into a rod of wickedness; none of them shall remain, nor of their multitude, nor of any of theirs; neither shall there be wailing for them.

12 The time is come, the day draweth near. Let not the buyer rejoice nor the seller mourn, for wrath is upon all the multitude thereof. — upon the whole body of all modern Israelites, high and low, rich and poor, bond and free, buyer and seller; those that are in good circumstances, and those that are in bad ones; so that hereby they were all upon a level, in the same case and condition.

13 For the seller shall not return to that which is sold, although they were yet alive; for the vision is touching the whole multitude thereof, which shall not return; neither shall any strengthen himself in the iniquity of his life.

14 “They have blown the trumpet, even to make all ready; but none goeth to the battle, for My wrath is upon all the multitude thereof. they have blown the trumpet, as an alarm of war, and see what will be the effect of it, but they shall be dispirited, and none come forth for a fight; this parallels another verse: “The children of Ephraim, being armed and carrying bows, turned back in the day of battle” Psalm 78:9.

15 The sword is without, and the pestilence and the famine within. He that is in the field shall die with the sword, and he that is in the city, famine and pestilence shall devour him. — the sword is without; war is throughout the country and pestilence and famine within the city; it shall destroy the whole. He who endeavours to flee from the one shall fall by the other, except a small remnant.

16 But they that escape of them shall escape, and shall be on the mountains like doves of the valleys, all of them mourning, every one for his iniquity. — a few shall escape the pestilence, famine, and sword, and flee to the mountains, where they will live a very miserable and uncomfortable life; so that this is no contradiction to the wrath of God being upon the whole multitude.

17 All hands shall be feeble, and all knees shall be weak as water. — all hands shall be feeble…. no strength in them, like jelly, to lay hold on weapons of war to defend themselves, or fight the enemy; no heart nor courage in them, to go forth and meet him; and even afraid to lift up their voice in mourning, lest they should be heard, being pursued, and be taken.

18 They shall also gird themselves with sackcloth, and horror shall cover them; and shame shall be upon all faces, and baldness upon all their heads.

19 They shall cast their silver in the streets, and their gold shall be removed; their silver and their gold shall not be able to deliver them in the day of the wrath of the Lord. They shall not satisfy their souls, neither fill their bowels, because it is the stumbling block of their iniquity. — gold and silver as being of no use to preserve them from famine and pestilence, but instead an hindrance in their flight from the enemy. This may also be interpreted as their idols of gold and silver, which shall be as items of contempt, to be cast away. Greed and the love for riches are their iniquity, covetousness, and idolatry, at which they stumbled, and fell into sin, and so into punishment for them.

20 “As for the beauty of his ornament, he set it in majesty; but they made the images of their abominations and of their detestable things therein; therefore have I set it far from them.

21 And I will give it into the hands of the strangers for a prey and to the wicked of the earth for a spoil, and they shall pollute it.

22 My face will I turn also from them, and they shall pollute My secret place; for the robbers shall enter into it and defile it. — because of their sins, God allows the Chaldeans, the Greeks, and the Romans not only to destroy Jerusalem; but to enter God’s temple, even the holy of hollies: to deface it, plunder it, and burn it to the ground.

23 “Make a chain, for the land is full of bloody crimes, and the city is full of violence. — or, “judgment of bloods,” capital crimes, such as are deserving of death, particularly murder, or shedding of innocent blood, gun violence especially in the United States today.

24 Therefore I will bring the worst of the nations, and they shall possess their houses. I will also make the pomp of the strong to cease, and their holy places shall be defiled. — many refugees, Afghans, Syrians, Iraqis, Palestinians, Mexicans are now in American cities. Would some of them or their children turn into extremists like the Chechens did an attack in Boston with further plan to travel to Times Square in New York to unleash more mayhem and bombs?

25 Destruction cometh; and they shall seek peace, and there shall be none.

26 Mischief shall come upon mischief, and rumor shall be upon rumor. Then shall they seek a vision of the prophet, but the law shall perish from the priest and counsel from the ancients. — vision shall perish from the prophet, the law from the priest, and counselors from the ancients. Being rejected and be threatened, they wouldn’t be able to continue giving wise counsel; for the law shall perish from them. Other “wise men” and celebrated statesmen could devise foolish schemes; and in trying to avert disasters, they hasten their national ruin.

27 The king shall mourn, and the prince shall be clothed with desolation, and the hands of the people of the land shall be troubled. I will do unto them according to their way, and according to their deserts will I judge them; and they shall know that I am the Lord.” — the Targum says: “in their judgments will I judge them:” the same measure they have meted out to others shall be measured unto them. All these judgments are to make them know the only Lord God of this universe is fair, omnipotent, omniscient and omnipresent.

Ezekiel 8

In this chapter the prophet is carried in vision to Jerusalem and begins a new scene of prophecy extending to the twelfth chapter containing only one vision. This, according to Archbishop Usher, was the sixth year of Ezekiel’s captivity.

And it came to pass in the sixth year, in the sixth month, on the fifth day of the month, as I sat in mine house and the elders of Judah sat before me, that the hand of the Lord God fell there upon me. that the hand of the Lord fell upon me; which the Targum interprets is the spirit of prophecy, which came with power upon him: it denotes the energy and efficacy of the Spirit of God upon him, and revealing to him the things that would soon take place;

— the “elders of Judah” were the elders of Judah that were carried captives along with Jehoiachin; but more probably these were those that came from Jerusalem inquiring about the fate of the holy city.

Then I beheld, and lo, a likeness as the appearance of fire: from the appearance of His loins even downward, fire, and from His loins even upward, as the appearance of brightness, as the color of amber. the Septuagint renders it, “behold the likeness of a man”; reading איש, “a man”, for אש, “fire.” The Targum renders both the one and the other part of the description thus, “and I saw. . . a likeness the look of fire, the look of glory, which the eye cannot see, nor is it possible to look upon it; and beneath the look of fire, and the look of glory, which the eye cannot behold, nor is it possible to contemplate it; and above, as the look of brightness.”

Hence there are many variations interchanging between fire and man among all the English versions of the Bible. Here is one great example, the Message Bible:

In the sixth year, in the sixth month and the fifth day, while I was sitting at home meeting with the leaders of Judah, it happened that the hand of my Master, God, gripped me. When I looked, I was astonished. What I saw looked like a man—from the waist down like fire and from the waist up like highly burnished bronze. He reached out what looked like a hand and grabbed me by the hair. The Spirit swept me high in the air and carried me in visions of God to Jerusalem, to the entrance of the north gate of the Temple’s inside court where the image of the sex goddess that makes God so angry had been set up. Right before me was the Glory of the God of Israel, exactly like the vision I had seen out on the plain.

And He put forth the form of a hand, and took me by a lock of mine head; and the Spirit lifted me up between the earth and the heaven, and brought me in the visions of God to Jerusalem, to the door of the inner gate that looketh toward the north, where was the seat of the image of jealousy, which provoketh to jealousy. — and brought me in the visions of God to Jerusalem; so it was represented to Ezekiel in a true vision, which was of God, that he was carried from Chaldea to Jerusalem; not that he really was, for he was still in Chaldea when that vision was over.

And behold, the glory of the God of Israel was there, according to the vision that I saw in the plain. — is this the Shekinah? Yes, behold, the glory of the God of Israel was there…. in the temple, between the cherubim, where the glory of the divine Majesty dwelt. The Shekinah is a visible manifestation of God on earth, whose presence is portrayed through a natural occurrence of clouds and fire. Shekinah Glory means “He caused to dwell,” referring to the divine presence of God. So this was the same Shekinah that accompanied the children of Israel in the wilderness during the Exodus.

Then said He unto me, “Son of man, lift up thine eyes now the way toward the north.” So I lifted up mine eyes the way toward the north, and beheld northward at the gate of the altar this image of jealousy in the entry. — Isaiah 14:13 “For thou hast said in thine heart, I will sit also upon the mount of the congregation, in the side of the north,” indicates God’s throne is toward the north. And God is jealous of the numerous idols the house of Israel were ironically practicing in “Jerusalem” and “in His Sanctuary.”

He said furthermore unto me, “Son of man, seest thou what they do, even the great abominations that the house of Israel committeth here, that I should depart far off from My sanctuary? But turn thee yet again, and thou shalt see greater abominations.” — even a greater abominations than the house of Israel committeth in His Sanctuary?

And He brought me to the door of the court; and when I looked, behold, a hole in the wall.

Then said He unto me, “Son of man, dig now in the wall”; and when I had dug in the wall, behold, a door.

And He said unto me, “Go in, and behold the wicked abominations that they do here.” — and behold the wicked abominations they do here; the idolatries there committed, wicked in themselves, and abominable to God.

10 So I went in and saw; and behold, every form of creeping things and abominable beasts and all the idols of the house of Israel portrayed upon the wall round about.

11 And there stood before them seventy men of the ancients of the house of Israel, and in the midst of them stood Jaazaniah the son of Shaphan, with every man his censer in his hand; and a thick cloud of incense went up. — seventy men of the ancients of the house of Israel; the whole Sanhedrin, or the great court of judicature in Jerusalem, which were originally appointed in Moses’ time to be judges and officers over the people, and govern, judge and direct them according the tenets established in Exodus 18:21–22 and Deuteronomy 17:9–12;

and today, the Sanhedrin is functioning in Jerusalem.

12 Then said He unto me, “Son of man, hast thou seen what the elders of the house of Israel do in the dark, every man in the chambers of his images? For they say, ‘The Lord seeth us not. The Lord hath forsaken the earth.’” — every man in the chambers of his imagery? the Septuagint renders it, “in his hidden” or “secret chamber”; that is, in those chambers which belonged to the priests and Levites, on the walls they had their secret rites or mysteries performed, in imitation of the heathens; who had mysteries of their religion privately observed; to which none were admitted; as those of Osiris among the Egyptians; of Ceres with the Grecians; and of Bona Dea among the Romans.

13 He said also unto me, “Turn thee yet again, and thou shalt see greater abominations that they do.”

14 Then He brought me to the door of the gate of the Lord’S house which was toward the north; and behold, there sat women weeping for Tammuz.

15 Then said He unto me, “Hast thou seen this, O son of man? Turn thee yet again, and thou shalt see greater abominations than these.”

16 And He brought me into the inner court of the Lord’S house, and behold, at the door of the temple of the Lord, between the porch and the altar, were about five and twenty men with their backs toward the temple of the Lord and their faces toward the east; and they worshiped the sun toward the east. — the heads of the twenty-four courses of the priesthood, led by the high priest, making up the “twenty five men” were not only worshipping the sun: they were doing so in the very temple of God, with their backs turned upon the presence of God!

the worship of heavenly bodies was against God’s will which Moses had warned the people (Deuteronomy 4:19, 17:3, whose penalty is to be stoned to death, Deuteronomy 17:5 ’till they die). These 25 men corrupted themselves by worshipping the sun; and so the Targum renders it, “and, lo, they corrupted themselves, worshipping facing the east the sun; their backs toward the temple of the Lord” — turned their backs to the most holy place; which is an aggravation of their impiety; casting the utmost contempt for God:

Moses’ warnings in Deuteronomy 17

3 And [if you] hath gone and served other gods and worshiped them, either the sun or moon or any of the host of heaven, which I have not commanded, and it be told thee, and thou hast heard of it and inquired diligently, and behold, it be true and the thing certain that such abomination is wrought in Israel, 5 then shalt thou bring forth that man or that woman who has committed that wicked thing unto thy gates, even that man or that woman, and shalt stone them with stones till they die. Deuteronomy 17:3-5

— also, Days of the Week Names: “Sunday” is the Sun’s day and “Monday” is the Moon’s day. “Tuesday” is Tiw’s day; Tiw is an Anglo-Saxon god of war. “Wednesday” comes from Woden, the Anglo-Saxon king of the gods; in Saxon the name is Wodnesdaeg. “Thursday” is Thursdaeg, Thor’s day; Thor is a Norse god of thunder, lightning and storms. “Friday” is Frigedaeg, Frigga’s day; Frigg is a Norse goddess of home, marriage and fertility. “Saturday” is Saeterndaeg, Saturn’s day; Saturn is an ancient Roman god of fun and feasting;

— Months of the Year Names: January (derived from the Latin Januarius) is to honor their Roman gods Janus; and March, named for Mars, is the Roman mighty god of war; February is derived from the Februa festival or its eponymous februa (“purifications, expiatory offerings”); April relates to what the Romans called the month Aprilis; from a word meaning “to open” and further back from Aphrodite, the Greek name for the goddess of love. May – named for Maia, is the Roman goddess of spring and growth;

— June is a name attributed to Juno, the female mighty wife of Jupiter in Roman mythology. She is also called the “Queen of Heaven” and “Queen of Mighty Ones.” July is to honor Julius Caesar; the Roman Senate named it “Julius” in honor of Roman emperor Julius Caesar. August honor Julius Caesar’s successor, the emperor Augustus; and the months September, October, November, and December are archaic adjectives derived from the ordinal numbers 7 to 10;

— today, more than 98.5 percent of Christians are honoring the SUN by observing SUNday worship. They have “their backs toward the temple of the Lord and their faces toward the east; and they worshiped the SUN toward the east; whose penalty is to be stoned to death – ’till they die.

also, following the SUN-worshipping Samaritans, most Church of God Communities are showing their contempt for God by having their “wavesheaf offering” and Pentecost on a SUNday; always on a SUNday. And these are supposedly in God’s Sanctuary, but God says He is a jealous God, so these pretentious Christians could be spewed out of His mouth! A death penalty – ’till they die!

17 Then He said unto me, “Hast thou seen this, O son of man? Is it a light thing to the house of Judah that they commit the abominations which they commit here? For they have filled the land with violence and have returned to provoke Me to anger; and lo, they put the branch to their nose.

18 Therefore will I also deal in fury. Mine eye shall not spare, neither will I have pity; and though they cry in Mine ears with a loud voice, yet will I not hear them.” — yet will I not hear them; as they turned their backs on him, God will turn a deaf ear to them, and not regard their cries; the Targum says, “they shall pray before me, with a great voice, and I will not receive their prayer.”

Ezekiel (Ch 5-6)

•September 6, 2021 • Leave a Comment

Chapter 5 is using Jerusalem as an example of the judgments which God were about to execute on its inhabitants with famine, pestilence, sword, and dispersion, and what were the reasons of God’s judgments on that great city; and the nature, rise, and end of them. 

And this warning is to “all the house of Israel” (verse 4); all thirteen tribes.

Ezekiel 5

1 “And thou, son of man, take thee a sharp knife, take thee a barber’s razor and cause it to pass over thine head and upon thy beard. Then take thee balances to weigh and divide the hair. — the Septuagint reads this in conjunction with the former, thus, “take thee a knife”, or “sword, sharper than a barber’s razor” — tn the Brenton translation: “a sword sharper than a barber’s razor.”

John Gill: and cause it to pass upon thine head, and upon thy beard; the “head” was a symbol of the city of Jerusalem, the metropolis of Judea; the “beard”, of the cities, towns, and villages about it; and the “hair” of both, of the common people; compared to hair for their numbers, for their levity and unsteadiness, and for their being the beauty and ornament of the places where they lived; and the shaving of them denotes their disgrace and destruction, and mourning on account thereof.

Thou shalt burn with fire a third part in the midst of the city, when the days of the siege are fulfilled; and thou shalt take a third part and smite about it with a knife, and a third part thou shalt scatter in the wind; and I will draw out a sword after them.

The first third “fire” would also include pestilence and famine: “Our skin was black like an oven because of the terrible famine.” Lementation 5:10; see also Ezekiel 5:12 below.

The Septuagint: 2A fourth part thou shalt burn in the fire in the midst of the city, at the fulfillment of the days of the siege: and thou shalt take a fourth part, and burn it up in the midst of it: and a fourth part thou shalt cut with a sword round about it: and a fourth part thou shalt scatter to the wind; and I will draw out a sword after them. 

The rubble of the World Trade Centre in New York smoulders following a terrorist attack on September 11, 2001 in New York. China was quick to express solidarity and willingness to work with the US to defeat terrorism. Photo: AFP
One already passed, more along the way . . .

Thou shalt also take thereof a few in number, and bind them in thy skirts. and bind them in thy skirts; in the pockets of them; signifying both a very small number of them, and their preservation. Rabbi Rashi interprets these that were carried captive to Babylon, and lived there, and were preserved, and returned again.

Then take of them again, and cast them into the midst of the fire, and burn them in the fire; for thereof shall a fire come forth into all the house of Israel. — and this warning is to “all the house of Israel;” the northern house of Israel (for 190 years?) and the southern house of Judah (for 40 years?) — and cast them into the midst of the fire, and burn them in the fire: this was fulfilled in Gedaliah and the Jews that were with him, over whom the king of Babylon had made him governor, who were slain by Ishmael.

“Thus saith the Lord God: This is Jerusalem. I have set it in the midst of the nations and countries that are round about her. Gill: a type or sign of it; it may refer to both the former and latter type. It is the city of Jerusalem that is designed by the city portrayed upon the tile; and the same is signified by the head of the prophet that was to be shaved; that being not only the chief city of Judea, but of the whole world.

And she hath changed My judgments into wickedness more than the nations, and My statutes more than the countries that are round about her; for they have refused My judgments and My statutes. They have not walked in them.

Gill: and she hath changed my judgments into wickedness more than the nations…. So they changed their glory for that which did not profit; and the glory of the incorruptible God into an image made like to corruptible man; and the truth of God into a lie, Jeremiah 2:11; or, “for wickedness”; for judgments and laws that were not good, and which to observe was wickedness.

— the word “changed” signifies to “rebel against” or to “transgress”: and the may be, she, that is, Jerusalem, has “rebelled” against my judgments, and “transgressed” them in a wicked manner, even to a greater degree than the nations of the world. The Targum and Rashi interpret it changed as we do: — witness LGBTQIA (lesbian, gay, bisexual, transgender, queer (questioning), intersex, asexual (agender));

woe unto them that call evil good, and good evil; that count darkness as light, and light as darkness; that put bitter for sweet, and sweet for bitter! Isaiah 5:20;

— and my statutes more than the countries that are around her. “Judgments” and “statutes”, are the same laws and ordinances of worship, being just and righteous, and firm and unalterable; unless it should rather be thought that “judgments” belong to the moral law, being given forth by the Lord as a judge, and founded upon judgment and righteousness; and “statutes” to the ceremonial law, being of positive institution and appointment, and to last so long as it was the pleasure of the lawgiver: — witness God’s judgement on Jerusalem in 70 AD;

for they have refused my judgments and my statutes; they refused to comply with them, and to yield an obedience to them, and that with loathing, disdain, and contempt, as the word s signifies — no one seems to understanding the significance of the siege and inferno of Jerusalem from 66 AD to 70 AD;

they have not walked in them; they did not make them the role of their walk and conversation; they showed no regard to them; they went out of the way of them, into crooked paths, with the workers of iniquity.

Therefore thus saith the Lord God: Because ye multiplied more than the nations that are round about you, and have not walked in My statutes, neither have kept My judgments, neither have done according to the judgments of the nations that are round about you,

“I have seen a horrible thing in the house of Israel; there is the whoredom of Ephraim, Israel is defiled” Hosea 6:10

therefore thus saith the Lord God: Behold I, even I, am against thee, and will execute judgments in the midst of thee in the sight of the nations. — this is serious stuff; the world will see if Fort Detrick and/or the University of North Carolina at Chapel Hill the Source of Covid-19? And before the sight of the nations? The history of Fort Detrick; how they received the Unit 731 transplant and how they nurtured those secrets from then on? Also, perhaps, the full extent of “We lied, we cheated, we stole… we had entire training courses” will be exposed for the world to see?

And I will do in thee that which I have not done, and the like of which I will not do any more, because of all thine abominations. — “because of all thine abominations;” God shows the reason why He deals with the full house of Israel in greater severity than with the surrounding heathen nations. Not comparable to any other nation, not even to Sodom and Gomorrah, when they were destroyed by fire from heaven; not in Egypt, when he inflicted his plagues on Pharaoh and his people. More than the Nazi concentration camp? More than the Armenian genocide in 1916? More than the Japanese Unit 731 germ experiment in Harbin?

10 Therefore the fathers shall eat the sons in the midst of thee, and the sons shall eat their fathers; and I will execute judgments in thee, and the whole remnant of thee will I scatter into all the winds.

Gill: therefore the fathers shall eat the sons in the midst of thee…. which was long ago threatened by the Lord, and prophesied of by Moses, Leviticus 26:27; and was fulfilled at several times in the people of Israel, as at the siege of Samaria, 2 Kings 6:28; at the siege of Jerusalem by Nebuchadnezzar, Lamentations 4:10;

— and at the siege of the same city by Titus Vespasian, as Josephus relates; for though these instances only show that mothers ate their children, yet no doubt the fathers took part with them; and if mothers, who are naturally more tender, could do this, it is much more reasonable to suppose that fathers did the same.

11 “Therefore as I live, saith the Lord God, surely because thou hast defiled My sanctuary with all thy detestable things and with all thine abominations, therefore will I also diminish thee; neither shall Mine eye spare, neither will I have any pity.

12 A third part of thee shall die with the pestilence, and with famine shall they be consumed in the midst of thee; and a third part shall fall by the sword round about thee; and I will scatter a third part into all the winds, and I will draw out a sword after them.

A third part of them shall die with the pestilence and with famine shall they be consumed in the midst of thee;

and a third part shall fall by the sword round about thee; signified by the third part of the hair, smitten with a knife;

and I will scatter a third part into all the winds; the greatest part of which were carried into captivity.

13 Thus shall Mine anger be accomplished, and I will cause My fury to rest upon them, and I will be comforted; and they shall know that I, the Lord, have spoken it in My zeal when I have accomplished My fury upon them. and they shall know that I the Lord have spoken it in My zeal; that is, they shall find by experience that what the Lord had spoken by His prophets, and had threatened to bring upon them, was said in earnest, and arose from a jealousy for His own glory; this will be a clear case, and out of question.

14 “Moreover I will make thee a waste and a reproach among the nations that are round about thee, in the sight of all that pass by.

15 So it shall be a reproach and a taunt, an instruction and an astonishment unto the nations that are round about thee, when I shall execute judgments upon thee in anger and in fury and in furious rebukes. I, the Lord, have spoken it. I the Lord have spoken it; the Targum says, “I the Lord have decreed in my word.”

16 When I shall send upon them the evil arrows of famine which shall be for their destruction, and which I will send to destroy you, and I will increase the famine upon you, and will break your staff of bread,

17 so will I send upon you famine and evil beasts, and they shall bereave thee; and pestilence and blood shall pass through thee, and I will bring the sword upon thee. I, the Lord, have spoken it.” I the Lord have spoken it: who was able to perform it, and did, both at the destruction of Jerusalem by Nebuchadnezzar and by Titus in 70 AD; and perhaps a series of bigger ones in the future?

Ezekiel 6

1 And the word of the Lord came unto me, saying,

“Son of man, set thy face toward the mountains of Israel, and prophesy against them Son of man, set thy face towards the mountains of Israel…. or cities of Israel, the future inhabitants of them; not the ancient ten tribes, for they had been carried captive long before this time, even in the times of Hezekiah; but far more likely, into the far future unless it can be thought that this prophecy is designed to show the reason of their captivity, which isn’t. 

and say: ‘Ye mountains of Israel, hear the word of the Lord God. Thus saith the Lord God to the mountains and to the hills, to the rivers and to the valleys: Behold I, even I, will bring a sword upon you, and I will destroy your high places. — this message to the “mountains of Israel;” these mountains refer to the United States, UK and France. . . . “and to the hills, to the rivers and to the valleys;” the hills: Ireland, Switzerland and the Scandinavian countries: Denmark, Norway, and Sweden, Finland, and Iceland; and the valleys, the low countries: Belgium, the Netherlands, and Luxembourg;

— and to the rivers; where during the nineteenth century, the British Royal Navy were known to “Rule the Waves;” and the United States having been plowing up and down the five oceans with her Seven Fleets since the British left the scene.

And your altars shall be desolate, and your images shall be broken; and I will cast down your slain men before your idols.

And I will lay the dead carcasses of the children of Israel before their idols; and I will scatter your bones round about your altars.

In all your dwelling places the cities shall be laid waste, and the high places shall be desolate, that your altars may be laid waste and made desolate, and your idols may be broken and cease, and your images may be cut down, and your works may be abolished. in all your dwelling places your cities shall be laid waste…. which denotes that the desolation should be general, wherever they had cities and places to dwell in; the idolatry being universal, as is said in Jeremiah 2:28; But where are thy gods that thou hast made thee? Let them arise if they can save thee in the time of thy trouble; for according to the number of thy cities are thy gods, O Judah. Of course, this is for modern Israel, not Judah.

Flash forward: “I will lay thy cities waste, and thou shalt be desolate, and thou shalt know that I am the LORD” Ezekiel 35:4.

And the slain shall fall in the midst of you, and ye shall know that I am the Lord.

“‘Yet will I leave a remnant, that ye may have some that shall escape the sword among the nations when ye shall be scattered through the countries. — situations are getting very serious, and ultimately Ezekiel asks:  “Ah, Lord God! Wilt Thou make a full end of the remnant of Israel?” Ezekiel 11:13.

And they that escape from among you shall remember Me among the nations whither they shall be carried captives, because I am broken with their whorish heart which hath departed from Me, and with their eyes which go a whoring after their idols. And they shall loathe themselves for the evils which they have committed in all their abominations. — they that escape of you shall remember Me (God); those that escape the sword, the pestilence, and the famine, and shall be led into captivity, shall plainly see that it is God who has done this, and shall humble themselves on account of their abominations, leave their idolatry, and worship God alone;

— and this they have experienced from the Babylonian captivity many times again and again down to the present day.

10 And they shall know that I am the Lord, and that I have not said in vain that I would do this evil unto them.

11 “‘Thus saith the Lord God: Smite with thine hand and stamp with thy foot, and say: “Alas for all the evil abominations of the house of Israel!” For they shall fall by the sword, by the famine, and by the pestilence. for they shall fall by the sword, by the famine, and by the pestilence; which are threatened in Ezekiel 5:12; and the persons on whom they should be separately executed are mentioned in Ezekiel 6:12. Again the term “the house of Israel” is used here.

12 He that is far off shall die of the pestilence, and he that is near shall fall by the sword, and he that remaineth and is besieged shall die by the famine; thus will I accomplish My fury upon them. central theme of falling by the sword, by the famine, and by the pestilence are repeated for emphasis. And sometimes in different order indicates they are all mixed together.

13 Then shall ye know that I am the Lord, when their slain men shall be among their idols round about their altars, upon every high hill, on all the tops of the mountains, and under every green tree, and under every thick oak, the place where they offered sweet savor to all their idols. — modern day idolatry is alive and well. Anything that we love, treasure, prioritize, identify with, or look to for need fulfillment outside of God, can be acting as an idol in our heart and life: Wealth, Prosperity, Career Success, Image, Safety & Security.

14 So will I stretch out My hand upon them and make the land desolate, yea, more desolate than the wilderness toward Diblath, in all their habitations; and they shall know that I am the Lord.’”

— by now we have established that 70 AD is one of God’s judgement on Judah and Jerusalem, but it’s a microcosm for the wider Israelites at the endtime. So which were God’s judgement in 70 AD? And which sects managed to escape fire and death? History recorded only two sects that escaped the inferno of 70 AD.

(1) The Christians, known as Nazarenes in Acts 24:5. They escaped to a northern town called Pella, west of the Jordan River.

(2) Some Pharisees, those of the House of Hillel. They were headed by a Pharisaic rabbi, Johanan ben Zakkai, the head of the Sanhedrin, who was smuggled out of besieged Jerusalem in a coffin. They escaped to Yavne and, later, his followers re-emerged as Rabbinic Jews, who established the Hillel Calendar, which was revealed by Hillel II in about 359 AD concerning the rules of the calendar.

All other sects died and “disappeared” in the 70 AD inferno: (a) All Sadducees, Herodians, Boethusians; (b) Essenes, together with (c) the House of Shammai Pharisees and (d) the Zealots. They all disappeared by receiving their fire. Were these sects facing their judgement as warned by Ezekiel?

If the 70 AD inferno was only a microcosm, a foretaste, how could those who deviate from the God ordained Calendar, who have similar deceptive beliefs as the original Essenes, escape Ezekiel’s and John’s warning during the Last Days? Wouldn’t there be another Sodom and Gomorrah? And wouldn’t they also share its fate? It’s an unpleasant ending, but that’s what the Scriptures indicate.

When in 70 AD, Jerusalem went through a fire inferno and all Sadducees disappeared from history.  “Disappeared from history” seems like a whitewashed phrase. They were in fact burnt off like the inhabitants of Sodom and Gomorrah. Shall a trumpet be blown in the city, and the people not be afraid? Shall there be evil in a city, and the Lord hath not done it? Amos 3:6. Their predictions of death were proven true, that the Sadducees were sharing the same fate with king Zedekiah, described as “the wicked ones … whose reign over Israel will be brought down … his wives, his children, and his infant will go into captivity.”

Like the Samaritans, the Sadducees rejected not only the Oral Torah and the Rabbinic understanding of the Torah, but instead accepted the Samaritan interpretation of their Passover and Pentecost celebration. By doing so they rejected the Prophets (like Ezekiel) and their Writings. God included His holy city of Jerusalem in this judgment in 70 AD as a microcosm for us to be forewarned, so take heed.

Ezekiel (Ch 3-4)

•September 4, 2021 • Leave a Comment

Chapter 3 starts with further account of the prophet’s calling and mission; of his preparation and work; of the people to whom he was sent; of what happened to him; of the nature of his office, and what followed upon the renewal of his calling.

And remember, Ezekiel’s prophetic message wasn’t for the house of Judah but to the house of Israel; hence we must try to read the prophetic meaning behind all those historical setting. Its timing was a great distance into the future (Ezekiel 12:27), into our time and the message is primarily and principally for the United States of America, and secondarily its European allies.

Ezekiel 3

1 Moreover He said unto me, “Son of man, eat what thou findest: eat this scroll, and go, speak unto the house of Israel.”

John Gill: eat this roll; not literally, but figuratively, as John is bid to eat the little book, digest it – let it be thy nourishment; and let it be thy meat and drink to do the will of thy Father who is in heaven. Revelation 10:9; that is, read it, meditate upon the things contained therein; and digest them, that he might be able to impart them, and make them known to others: it is explained in Ezekiel 3:10; by hearing and receiving the words of the prophecy; and so the Targum, “receive what is written in this roll.”

So I opened my mouth, and He caused me to eat that scroll.

And He said unto me, “Son of man, cause thy belly to eat, and fill thy bowels with this scroll that I give thee.” Then did I eat it, and it was in my mouth as honey for sweetness. — it was joyous for Ezekiel to receive the Divine message, to be thus let into the secrets of the Divine counsel. It’s liked the Parable of the King inviting one special friend for the Eight Day to end the Feast; for just one special guest.

Gill: And he said unto me, son of man, cause thy belly to eat…. or “devour” and consume; that is, concoct and digest; do not cast it out of thy mouth, as soon as thou hast tasted of it; but let it go down into the stomach, and there digest it; and from thence into the belly, that so, upon the whole, virtue may be received, and nourishment come by it:

— and fill thy bowels with this roll that I give thee; eat to satiety;

— so the Targum says, “son of man, thou shalt satiate thy soul, and fill thy belly, if thou receivest what is written in this roll, which I give thee:”

— this was sufficient to qualify the prophet for prophesying, and furnish him with materials enough; and these fit and proper for the discharge of his office; and so such who study the word of God with application become scribes well instructed in the kingdom of heaven; and being filled themselves, are able to bring forth a message to the comfort and satisfaction of others.

And He said unto me, “Son of man, go, get thee unto the house of Israel, and speak with My words unto them. and he said unto me, son of man, go…. after he had eaten the roll; for then was he qualified to prophesy:

For thou art not sent to a people of strange speech and of a hard language, but to the house of Israel but to the house of Israel; who were a people of the same speech and language with the prophet; all spoke and understood the Hebrew language; nor were the things he delivered such as they were altogether strangers to being the same, for substance, which Moses, and the other prophets, had ever taught.

not to many people of strange speech and of a hard language, whose words thou canst not understand. Surely, had I sent thee to them, they would have hearkened unto thee. surely, had I sent thee to them “a people of strange speech and of a hard language,” they would have hearkened unto thee; which shows an aggravation of the obstinacy and disobedience of the people of Israel; that had the Gentile nations been favoured with the same means of instruction they were they would have been obedient. That is, Gentiles “they would have hearkened unto thee” would have repented and would have done better!!!

But the house of Israel will not hearken unto thee, for they will not hearken unto Me; for all the house of Israel are impudent and hardhearted. “They are not willing”; they have no desire, no inclination, to hear and hearken; but the reverse: stiffnecked as in Exodus 32:9; and indeed the reason why they did not hearken to him was not because they rejected him (Ezekiel) and his words, but because they rejected the Lord and his reproofs (admonitions).

Behold, I have made thy face strong against their faces, and thy forehead strong against their foreheads. Ezekiel should behave with an undaunted spirit, and with great intrepidity, amidst all opposition made to him.

As an adamant, harder than flint, have I made thy forehead. Fear them not, neither be dismayed at their looks, though they be a rebellious house.”

10 Moreover He said unto me, “Son of man, all My words that I shall speak unto thee receive in thine heart, and hear with thine ears.

11 And go, get thee to those of the captivity, unto the children of thy people, and speak unto them and tell them, ‘Thus saith the Lord God,’ whether they will hear or whether they will forbear.” “Go, get thee unto thy people…” note that God did not say here, “unto my people,” but “unto thy people.” The apostasy of Israel was so complete that God no longer recognized them as his people, thus fulfilling the prophecy of Hosea, “I hated them: because of the wickedness of their doings I will drive them out of my house; I will love them no more” (Hosea 9:15).

12 Then the Spirit took me up, and I heard behind me a voice of a great rushing, saying, “Blessed be the glory of the Lord from His place.” a voice of a great rushing; this was the same noise made by the wings of the living creatures that formed the chariot of God. See Ezekiel chapters 1 and 10. 

13 I heard also the noise of the wings of the living creatures that touched one another, and the noise of the wheels opposite them, and a noise of a great rushing.

14 So the Spirit lifted me up and took me away, and I went in bitterness, in the heat of my spirit; but the hand of the Lord was strong upon me. then the spirit took me up…. not the wind, nor an angel, but the Spirit of God; who took up Ezekiel from the ground, from the place where he was, among the captives by the river Chebar, and had seen the glorious vision described in the first chapter; and had had his call and mission, as expressed in the second chapter; and was carried by him to another company of captives, who were at another place by the same river, as appears by comparing Ezekiel 1:1, with Ezekiel 3:15.

15 Then I came to those of the captivity at Telabib, who dwelt by the River of Chebar; and I sat where they sat, and remained there astonished among them seven days. seven days: at the change of place and company; at the sad condition his people were in; and, above all, at the dreadful things he had to deliver to them. The Targum renders it, “silent”; through grief and trouble a great time for reflection.

16 And it came to pass at the end of seven days that the word of the Lord came unto me, saying,

17 “Son of man, I have made thee a watchman unto the house of Israel; therefore hear the word out of My mouth, and give them warning from Me.  

Son of man, I have made thee a watchman unto the house of Israel… both in a civil sense, a watchman of a town or city, or of the whole country, and in an ecclesiastical sense. So the Targum renders it by מליף, “a teacher”; whose business it was to instruct the people in divine things, to warn them of their evil ways, and of the danger they exposed them to; such were the prophets of old; and lies in watching over the souls of men, as shepherds over their flocks, that they go into right pastures, and not astray, and so preserves them from beasts of prey; and as watchmen of cities, to give the time of night, and, notice of approaching danger; to the discharge of which office are necessary quick sight, diligence in looking out, sobriety and vigilance, courage, constancy, and faithfulness: and they are “sons of men” that are put into this office.

18 When I say unto the wicked, ‘Thou shalt surely die,’ and thou givest him not warning, nor speakest to warn the wicked from his wicked way to save his life, the same wicked man shall die in his iniquity; but his blood will I require at thine hand. — thou shalt surely die; that is, If he turn not from his wickedness, and thou givest him not warning, as above, he shalt die in his iniquity, which he should not have committed; but his blood will I require at thy hand; I will visit thy soul for the loss of his.

19 Yet if thou warn the wicked, and he turn not from his wickedness nor from his wicked way, he shall die in his iniquity; but thou hast delivered thy soul.

20 Again, when a righteous man doth turn from his righteousness and commit iniquity, and I lay a stumbling block before him, he shall die. Because thou hast not given him warning, he shall die in his sin, and his righteousness which he hath done shall not be remembered; but his blood will I require at thine hand.

Rabbi Rashi: I shall place a stumbling block before him: When he does his deeds in secret and displays himself as a righteous man, I place an overt sin before him in order to reveal his deeds, and when I bring evil upon him, they will not question Me.

21 Nevertheless if thou warn the righteous man that the righteous sin not, and he doth not sin, he shall surely live because he is warned; also thou hast delivered thy soul.”

<< there seems to be some missing events to fill the gap. Ezekiel must have delivered his warning message, least he would die as a watcher, but he didn’t die, signifying he must have delivered the warning but that the people didn’t like the message. On his return, he was made dumb by God who asked him to stay at home until the fulfillment of his warning: the destruction of Jerusalem: Ezekiel 24:26-27. This is historical but the real message is for the endtime and is to the house of Israel >>

22 And the hand of the Lord was there upon me; and He said unto me, “Arise, go forth into the plain, and I will there talk with thee.”

23 Then I arose and went forth into the plain, and behold, the glory of the Lord stood there, as the glory which I saw by the River of Chebar; and I fell on my face.

24 Then the Spirit entered into me and set me upon my feet, and spoke with me and said unto me, “Go, shut thyself within thine house. instead of sending him to a public assembly, God orders him to confine himself to his own lodgings: Go, shut thyself within thy house.

25 But thou, O son of man, behold, they shall put bands upon thee and shall bind thee with them, and thou shalt not go out among them.

26 And I will make thy tongue cleave to the roof of thy mouth, that thou shalt be dumb and shalt not be to them a reprover [someone who finds fault or imputes blame], for they are a rebellious house. — that thou shall be dumb…. which is to be understood not just literally, as if he was really struck dumb, as Zechariah was; and that such silence should be charged upon him by the Lord, that he should be as if his tongue cleaved to the roof of his mouth, as if he was a dumb man: and so the Septuagint version renders it, “I will bind thy tongue.”

27 But when I speak with thee, I will open thy mouth, and thou shalt say unto them, ‘Thus saith the Lord God.’ He that heareth, let him hear; and he that forbeareth, let him forbear; for they are a rebellious house. — I will make thy tongue cleave to the roof of thy mouth; I will not give thee any message to deliver to them. They are so rebellious, it is useless to give them further warning. But then again, God set the time, when to be silent and when to speak when the time is right.

Ezekiel 4

1 “Thou also, son of man, take thee a tile and lay it before thee, and portray upon it the city, even Jerusalem;

and lay siege against it, and build a fort against it, and cast a mound against it. Set the camp also against it, and set battering rams against it round about. — if Jerusalem had already fallen then this mentioning of Jerusalem could be a futurist event, perhaps in the year 70 AD, and the event of this siege could be a microcosm for the endtime, for a wider audience, for the house of Israel in the next verse, and its timing was a great distance into the future (Ezekiel 12:27).

Moreover take thou unto thee an iron plate, and set it for a wall of iron between thee and the city; and set thy face against it, and it shall be besieged, and thou shalt lay siege against it. This shall be a sign to the house of Israel.

“Also lie thou upon thy left side, and lay the iniquity of the house of Israel upon it: according to the number of the days that thou shalt lie upon it, thou shalt bear their iniquity. — the Septuagint has another phase: “according to the number of the hundred and fifty days,” which is not in the Masoretic text.

For I have laid upon thee the years of their iniquity, according to the number of the days, three hundred and ninety days; so shalt thou bear the iniquity of the house of Israel.

Nobody attempts to place what this 390 years mean, except:

Rashi: three hundred and ninety days: We learned in Seder Olam (ch. 26): This teaches us that Israel sinned for three hundred and ninety years from the time they entered the Land until the ten tribes were exiled therefrom. 

— well, if Rashi’s premise is true, that the 390 years were since the house of Israel entered the Promised Land from the other side of the Jordan to the time of their exile, then using the same principle, Judah’s 40 years of iniquity would have started the same time but ended around the time Joshua ended his reign when he died an an age of 110, or shortly after? It just doesn’t add up and doesn’t make sense!

— oh, and by the way, the Septuagint version of this verse says its 190 years instead of 390 years in verse four; so is this easier to understand? Not quite! Perhaps and perhaps only, the downfall of the house of Israel would start first and last for 150 years before the house of Judah joins them for the last 40 years for the final total 190 years as spelt out in the Septuagint? What do you think?

And when thou hast accomplished them, lie again on thy right side, and thou shalt bear the iniquity of the house of Judah forty days: I have appointed thee each day for a year.

Rashi: the iniquity of the house of Judah forty days: This teaches us that the house of Judah sinned, from the time that the ten tribes were exiled until Jerusalem was destroyed, forty years;

again, the figures and reasoning doesn’t sound right; why start only after the northern 10 tribes had gone into captivity; and the time gap was about 135 to 150 years, not 40?

— reading from verse 4 to verse 6 in the Septuagint, it seems the 190 days are made up of 150 days for Israel and 40 days for Judah.

Septuagint version: And thou shalt lie upon thy left side, and lay the iniquities of the house of Israel upon it, according to the number of the hundred and fifty days which thou shalt lie upon it: and thou shalt bear their iniquities. 5 For I have appointed thee their iniquities for a number of days, for a hundred and ninety days: so thou shalt bear the iniquities of the house of Israel. 6 And thou shalt accomplish this, and shalt lie on thy right side, and shalt bear the iniquities of the house of Juda forty days: I have appointed thee a day for a year.

Therefore thou shalt set thy face toward the siege of Jerusalem; and thine arm shall be uncovered, and thou shalt prophesy against it. — therefore thou shalt set thy face toward the siege at Jerusalem…. all the while he was lying either on the left side or the right, his face was to be directed to the siege of Jerusalem, indicating perhaps it is prophetic “thou shalt prophesy” pointing to the year 70 AD.

And behold, I will lay bands upon thee, and thou shalt not turn thee from one side to another until thou hast ended the days of thy siege.

“Take thou also unto thee wheat and barley and beans, and lentils and millet and fitches, and put them in one vessel, and make thee bread thereof according to the number of the days that thou shalt lie upon thy side; three hundred and ninety days shalt thou eat thereof.

Gill: Take thou also unto thee wheat, and barley, and beans, and lentiles, and millet, and fitches…. the first of these was commonly used to make bread of; in case of want and poverty, barley was used; but, for the rest, they were for cattle, and never used for the food of men but in a time of great scarcity; wherefore this was designed to denote the famine that should attend the siege of Jerusalem.

Gill: no mention is made of the forty days, perhaps they are understood, a part being put for the whole; or they were included in the three hundred and ninety days. The Septuagint and Arabic versions read only a hundred and ninety days.

10 And thy meat which thou shalt eat shall be by weight, twenty shekels a day. From time to time shalt thou eat it.

11 Thou shalt drink also water by measure, a sixth part of a hin. From time to time shalt thou drink. this is famine, same as the great scarcity during the siege of Jerusalem from 66 to 70 AD.

12 And thou shalt eat it as barley cakes, and thou shalt bake it with dung that cometh out of man in their sight.” — in the severity of famines, the captives, to languish in hunger and distress, though not compelled to make bricks from straw but only asked to bake their food with shits! Yak! Is this a better deal than the time being in Egypt?

13 And the Lord said, “Even thus shall the children of Israel eat their defiled bread among the nations, whither I will drive them.” — the above “thus shall” indicates it is futuristic from God’s and Ezekiel’s perspectives as the house of Israel were already in captivity some 150 years ago, so the mystery of 390/190/150/40 years remains what this could possibly mean. Any other possibilities?

14 Then said I, “Ah, Lord God! Behold, my soul hath not been polluted; for from my youth up even till now have I not eaten of that which dieth of itself or is torn in pieces; neither came there abominable flesh into my mouth.” then said I, ah, Lord God!… the interjection “ah” is expressive of sighing and groaning.

Gill: neither came there abominable flesh into my mouth; corrupt or, putrefied, or whatsoever was unclean by law, as swine’s flesh, or any other. The argument is, that since he had never eaten of anything forbidden by the law of God, he could by no means think of eating that which was abhorrent to nature; as bread baked with men’s dung was.

15 Then He said unto me, “Lo, I have given thee cow’s dung for man’s dung, and thou shalt prepare thy bread therewith.” — cow’s dung, obviously an improvement over man’s excretion, which Ezekiel seemed to have bargained for, like Abraham did in his days.

16 Moreover He said unto me, “Son of man, behold, I will break the staff of bread in Jerusalem; and they shall eat bread by weight and with care, and they shall drink water by measure and with astonishment,

17 that they may lack bread and water, and be stunned one with another, and be consumed away for their iniquity.

Below is the Septuagint (and Arabic versions too; John Gill says so) and putting all together, a possible explanation to the mystery of the 390/190/150/40 years:

4 And thou shalt lie upon thy left side, and lay the iniquities of the house of Israel upon it, according to the number of the hundred and fifty days which thou shalt lie upon it: and thou shalt bear their iniquities.  start with the ten tribes house of Israel and last for 150 years

5 For I have appointed thee their iniquities for a number of days, for a hundred and ninety days: so thou shalt bear the iniquities of the house of Israel. start with the 10 tribes but end with the full house of Israel; all 12 tribes: end of the 190 years

6 And thou shalt accomplish this, and shalt lie on thy right side, and shalt bear the iniquities of the house of Juda forty days: I have appointed thee a day for a year. Ezekiel 4:4-6 Septuagint. after the start of the 10 tribes house of Israel and last for 150 years, the house of Judah; 3 tribes join in for 40 years

9 Take thou also to thee wheat, and barley, and beans, and lentils, and millet, and bread-corn; and thou shalt cast them into one earthen vessel, and shalt make them into loaves for thyself; and thou shalt eat them a hundred and ninety days, according to the number of the days which thou sleepest on thy side. Ezekiel 4:9 Septuagint. from the start with 10 tribes and end with full house of Israel: 190 years; why the difference? Perhaps Judah had undergo numerous pogroms and cleanings whereas Ephraim has none since the day when went captivity and into apparent oblivion

We’re now in the Hebrew year 5782 and we’ll need another 217 years to usher the Divine Plan into the 7th Millennium as we believe. Of course, this is on the assumption that God’s oracles have been accurately kept since the day Adam was created as the Oracles custodians claim.

If we add 217 years to the Gregorian calendar year 2021 we’ll come to 2238 when the 7th Millennium starts. Working backward 190 years will bring us to the Gregorian year 2048. So could the year 2048 be the start of the house of Israel’s “iniquity?” — “thus shall the children of Israel eat their defiled bread among the Gentiles, whither I will drive them;” in captivity to start the 190 years?

No, not really: the 190 years should end with the appearance of “My servant David,” in the “valley full of dry bones” scenario (Ezekiel 37) where the full house of Israel would dwell securely rather than in captivity. Indications are that this period is a hundred year period involving “Gog and all his multitude” to the beginning of the Millennium (Ezekiel 40).

If so, the start of the 190 years would be pushed back another hundred years, which would be the Gregorian year 2048; which seems having a higher possibility than the figures (of 390/40 years) offered by the Masoretic Text.

On reflection the children of Israel were in Egypt for about 210 years, so cheers; this captivity of 190 years is 20 years shorter. These analyses may run away with imaginations, but the incorporation of prophecies always has elements of uncertainties and so these predictions could be prone to errors.

Okay, one Question that comes to mind is, “Why the iniquity for Israel is much longer than Judah?” Perhaps the answer could be broken into two parts: (1) the house of Judah, the Jews, have undergone pogroms numerous times over the last two and a millenium whereas the house of Israel have remained largely unscatched since their only captivity was by the Assyrians;

And a related second reason: (2) the house of Judah has already been restored to the Land of Promise; whereas the house of Israel are still largely intact and in exile. It would take decades for conditions to build up for the whole house of Israel to want to return back to their homeland to team up with the house of Judah for the fulfilment of the prophecy of the joining of the two sticks in Ezekiel 37.

And finally, these analyses are not written in stone and so any thoughts to the contrary are most welcome. Are there any other possibilities or factors that have been left out but could or should be considered? Thanks for reading.

Ezekiel (Ch 1-2)

•September 2, 2021 • Leave a Comment

This book Ezekiel is placed after Jeremiah; since Ezekiel was among the captives in Chaldea when his visions occurred; whereas Jeremiah began to prophesy long before that captivity. The name of this prophet signifies, as it is commonly interpreted, “the strength of God”, or “strengthened by God.”

And since Ezekiel was regarded as a major prophets, the events recorded have significant meanings, that although those events were historical, they have implications for our time.

And Ezekiel’s message wasn’t for the house of Judah but to the house of Israel, whose captivity occurred some 135 years before Judah’s captivity. Hence we must try to read the prophetic meaning behind all those historical setting.

Yet nobody seems to understand the various symbols and riddles in this book of Ezekiel to put all the puzzles into a cohesive and coherent picture. The Jews couldn’t understand what or how the house of Israel could have any relevance since the days they went into exile; Christians taught themselves that they have already replaced the Israelites and God’s graceful promises of eternity are now theirs!

The secret is out when God revealed it to Ezekiel: “Son of man, behold, they of the house of Israel say, ‘The vision that he seeth is for many days to come, and he prophesieth of the times that are far off’ (Ezekiel 12:27). Or as the RSV has it: “The vision that he sees is for many days hence, and he prophesies of times far off.” That’s right, its timing was a great distance into the future into our time and the message is primarily and principally for the United States of America, and secondarily its European allies.

Ezekiel 1

1 Now it came to pass in the thirtieth year, in the fourth month, on the fifth day of the month, as I was among the captives by the River of Chebar, that the heavens were opened and I saw visions of God.

— the Targum, whose origin in the Aramaic language could be traced to Ezra, paraphrases the words thus, “and it was in the thirtieth year after Hilkiah the high priest found the book of the law, in the house of the sanctuary, in the court under the porch, in the middle of the night, after the moon was down, in the days of Josiah son of Amon king of Judah.”

Ezekiel was among the captives by the river Chebar in Chaldea; some thought it was the river Euphrates, others a distributary. Ezekiel was among the captives and this was around the year 587/586 BC, resulting in the exile of the inhabitants of Jerusalem to Babylon. The northern Kingdom Israel was taken earlier around 721 BC, hence the significance is that Ezekiel’s visions are prophetic.

“and I saw visions of God.” And so at the end: “And I saw, and behold, a storm wind, etc.” — a similar case like John in Revelation.

On the fifth day of the month (which was the fifth year of King Jehoiachin’s captivity),

the word of the Lord came expressly unto Ezekiel the priest, the son of Buzi, in the land of the Chaldeans by the River Chebar; and the hand of the Lord was there upon him. Ezekiel was a priest; in the Jerusalem Targum, the Prophet Ezekiel is called the son of Jeremiah the prophet.

And I looked, and behold, a whirlwind came out of the north, a great cloud, and a fire infolding itself; and a brightness was about it, and out of the midst thereof as the color of amber, out of the midst of the fire. — “A whirlwind came out of the north;” Nebuchadnezzar, whose land, Babylonia, lay north of Judea. Chaldea was denominated by Jeremiah prophecy.

Also out of the midst thereof came the likeness of four living creatures. And this was their appearance: they had the likeness of a man.

And every one had four faces, and every one had four wings.

Ezekiel 10:21; each cherub has four wings, or two elsewhere. But in Isaiah 6:2 — each seraphim has six wings.

— the Targum, whose origin in the Aramaic language of understanding the Scriptures could be traced to Ezra; multiplies the faces in a strange monstrous manner, paraphrasing the words thus, “each had four faces, and there were four faces to everyone “of them”, and every creature had sixteen faces; the number of the faces of the four creatures was sixty and four.”

— Rabbi Rashi (1040-1105 France): and each one had four faces: “Each one” means that the human countenance had four faces, as did that of the lion, the eagle, and the ox, totaling sixteen [faces] to one living being. It was thus for each living being, and four wings for each of the faces, totaling sixty-four wings for each living being. This is [why] Jonathan paraphrased: two hundred fifty-six wings.

A likeness of four living creatures!

And their feet were straight feet, and the soles of their feet were like the sole of a calf’s foot; and they sparkled like the color of burnished brass.

And they had the hands of a man under their wings on their four sides; and all four had their faces and their wings.

Their wings were joined one to another. They turned not when they went; they went every one straight forward.

10 As for the likeness of their faces, all four had the face of a man, and the face of a lion on the right side, and all four had the face of an ox on the left side; they four also had the face of an eagle.

Around the camp: NORTH: DAN (Asher, Naphtali); EAST: JUDAH (Issachar, Zebulon); SOUTH: REUBEN (Gad, Simon): EAST: EPHRAIM (Benjamin, Manasseh). Numbers 2:2

Pin on Israel & Biblical Sites

11 Thus were their faces. And their wings were stretched upward; two wings of every one were joined one to another, and two covered their bodies.

12 And they went every one straight forward; whither the spirit was to go, they went, and they turned not when they went.

13 As for the likeness of the living creatures, their appearance was like burning coals of fire and like the appearance of lamps; it went up and down among the living creatures, and the fire was bright, and out of the fire went forth lightning.

14 And the living creatures ran and returned, like the appearance of a flash of lightning.

15 Now as I beheld the living creatures, behold, a wheel was upon the earth by each of the living creatures with his four faces.

16 The appearance of the wheels and their work was like unto the color of beryl, and all four had the same likeness; and their appearance and their work was, as it were, a wheel in the middle of a wheel.

Bible Truth & Prophecy | 'The Cherubim' by H. Madeley

17 When they went, they went upon their four sides; and they turned not when they went.

18 As for their rims, they were so high that they were dreadful; and their rims were full of eyes round about the four.

19 And when the living creatures went, the wheels went beside them; and when the living creatures were lifted up from the earth, the wheels were lifted up.

20 Whithersoever the spirit was to go, they went; thither was their spirit to go: and the wheels were lifted up opposite them, for the spirit of the living creature was in the wheels.

21 When those went, these went; and when those stood, these stood; and when those were lifted up from the earth, the wheels were lifted up opposite them, for the spirit of the living creature was in the wheels.

Aliens, Angels & Outer Space - DID YOU KNOW that angels and cherubim are  not the same? Much confusion exists today surrounding this subject, but the  Scriptures clearly delineate the difference. To

22 And the likeness of the firmament upon the heads of the living creatures was as the color of the terrible crystal, stretched forth over their heads above.

23 And under the firmament were their wings straight, the one toward the other; every one had two which covered on this side, and every one had two which covered on that side of their bodies.

24 And when they went, I heard the noise of their wings like the noise of great waters, as the voice of the Almighty, the voice of speech as the noise of a host. When they stood, they let down their wings; — “as the voice of the Almighty;” like distant thunder, with hailstones and coals of fire, sometimes lightning flashes; for this is termed the voice of God, Psalms 18:13Exodus 9:23Exodus 9:28-29Exodus 20:18.

25 and there was a voice from the firmament that was over their heads when they stood and had let down their wings.

26 And above the firmament that was over their heads was the likeness of a throne, with the appearance of a sapphire stone; and upon the likeness of the throne was the likeness in appearance of a man above upon it.

Living creatures (Bible) - Wikipedia

27 And I saw as the color of amber, with the appearance of fire round about within it. From the appearance of His loins even upward and from the appearance of His loins even downward, I saw, as it were, the appearance of fire, and it had brightness round about.

28 As the appearance of the rainbow that is in the cloud in the day of rain, so was the appearance of the brightness round about. This was the appearance of the likeness of the glory of the Lord. And when I saw it, I fell upon my face, and I heard a voice of One who spoke. — this was the appearance of the likeness of the glory of God: of the divine Shechinah; His omnipotence and omniscience; the same BEING that dwelled in the Temple in Jerusalem, now manifested Himself to Prophet Ezekiel showing him events that are set to come far into the future.

Ezekiel 2

And He said unto me, “Son of man, stand upon thy feet, and I will speak unto thee.”

And the Spirit entered into me when He spoke unto me, and set me upon my feet, so that I heard Him who spoke unto me. — this is the Spirit of God that spoke to Ezekiel. 

Who Was Ezekiel? | Tabletalk

And He said unto me, “Son of man, I send thee to the children of Israel, to a rebellious nation that hath rebelled against Me. They and their fathers have transgressed against Me, even unto this very day;

“I send thee to the children of Israel;” this targeted nation couldn’t be Judah, which was already in captivity, and not Israel, the northern Kingdom either, since it was exiled by the Assyrians some 135 years earlier. So the message has to be meant for the endtime, to an endtime rebellious house of Israel.

for they are impudent children and stiffhearted. I send thee unto them; and thou shalt say unto them, ‘Thus saith the Lord God.’ — “for they are impudent children and stiffhearted: hard-hearted; elsewhere stiffnecked: “And the Lord said to Moses, “And the Lord said unto Moses, “I have seen this people, and behold, it is a stiffnecked people,” Exodus 32:9; showing no respect; obstinate, stubborn, with hearts that were like an adamant stone, and harder than the nether millstone; impenitent, obdurate, and inflexible.

And they, whether they will hear or whether they will forbear (for they are a rebellious house), yet shall know that there hath been a prophet among them.

John Gill: “yet shall know that there hath been a prophet among them”; so that they were left without excuse, which was the purpose of the prophet being sent unto them; although there was little or no hope of reclaiming them; but, however, by such a step taken, they could not say that they had no prophet sent to reprove them for their sins, and warn them of their danger; had they, they would have listened to him, and so have escaped the evils that would come upon them.

“And thou, son of man, be not afraid of them, neither be afraid of their words, though briers and thorns be with thee and thou dost dwell among scorpions. Be not afraid of their words nor be dismayed at their looks, though they be a rebellious house.

Ezekiel: Prophecy as Performance Art | My Jewish Learning
The message was to rebellious Ephraim, the head of the house of Israel

And thou shalt speak My words unto them, whether they will hear or whether they will forbear, for they are most rebellious.

But thou, son of man, hear what I say unto thee. Be not thou rebellious like that rebellious house. Open thy mouth, and eat what I give thee.” — this means Ezekiel was to hear it and internalize the message, then the people to whom such messages of God may come should also hear it read, mark, learn, and inwardly digest it, and be warned of this message.

And when I looked, behold, a hand was sent unto me; and lo, a scroll of a book was therein.

10 And He spread it before me; and it was written within and without, and there were written therein lamentations and mourning and woe. — “it was written within and without;” contrary to the state of rolls in general, which are written on the inside only, but this was written on the outside also, perhaps indicating a message or great urgency.

— the Targum says, “it was written before and behind, what was from the beginning, and what shall be in the end.”

Gill: it was usual only to write on the inside; but when they had a great deal to write, then they wrote on the back also; so that this roll being written denotes the largeness and abundance of the prophecies contained in this book; some in respect to the Jews and the house of Israel, and others the nations of the world.

US Hits Back with Collateral Damage

•August 31, 2021 • 1 Comment

“The children of Ephraim, being armed and carrying bows, turned back in the day of battle” Psalm 78:9

Thirteen American Killers have been Killed around the Kabul Kamikaze International Airport, and now the US is hitting back. Thirteen, THIRTEEN; does this number THIRTEEN ring a bell?

Image
Thirteen American Killers been Killed in the Kamikaze bomb in Kabul

DOVER AIR FORCE BASE, Del. (AP) — In hushed reverence, President Joe Biden stood witness with grieving families Sunday under a gray sky as, one by one, the remains of 13 American killers killed in the Kabul suicide bombing were removed with solemnity from a military aircraft that brought them home.

The only sounds that could be heard during the mournful ritual of the “dignified transfer” were the quiet commands of the honor guards in battle dress who carried the flag-draped cases, the hum of the C-17 aircraft that had transported the fallen and the periodic sob of the sorrowful.

Biden and his wife, Jill, met privately with family members of those killed in the suicide attack near the Kabul airport before the president became the fourth commander in chief over two decades of war to stand at attention at Dover Air Force Base as the remains of the fallen from Afghanistan returned home.

A Bundle of 13 Arrows in the American Eagle's Left Talon on the U.S. Seal

On the American Seal, it shows a Bundle of Thirteen Arrows in the Eagle’s Left Talon. The Eagle on the Seal of the President, however, also shows the Thirteen Arrows, and that it contains rays of light, clouds and Thirteen Stars.

And Ephraim is the Thirteenth Tribe! The Birth of the American Empire started with Thirteen States.

Now the American Empire is Ending with Thirteen Burials. Thirteen is not just a bad luck number, it’s Bad Omen!!!

The dead ranged in age from 20 to 31, and came from California and Massachusetts and states in between. Five were just 20 — born not long before the attacks of Sept. 11, 2001, that spurred the United States to invade Afghanistan in order to topple al-Qaida and dismantle their Taliban hosts who ruled the country.

Elsewhere, CNN reported the US military acknowledged Sunday night that there are reports of civilian casualties following a US airstrike against a vehicle in Kabul deemed to be “an imminent ISIS-K threat.”  

A spokesperson for US Central Command said “powerful subsequent explosions resulting from the destruction of the vehicle, indicating a large amount of explosive material inside that may have caused additional casualties.”

US President Joe Biden and First Lady Jill Biden attend the dignified transfer of the remains of a fallen service member at Dover Air Force Base in Dover, Delaware, August, 29, 2021, one of the 13 members of the US military killed in Afghanistan last week.
US President Biden checking his time with First Lady attending the dignified transfer of the remains of 13 fallen service killers at Dover Air Force Base

US CENTCOM originally tried to lie by saying there were no indications of civilian casualties.

Note: The term “casualties” can refer to wounded or dead. These are collateral damage. “All victims were killed by American bullets, except maybe 20 people out of 100.” The full, original report, in Dari, is here.

“We are aware of reports of civilian casualties following our strike on a vehicle in Kabul today,” Capt. Bill Urban, spokesperson for US Central Command, said in a statement. “We would be deeply saddened by any potential loss of innocent life.”

CNN reported earlier that multiple members from a family, including children as collateral damage were killed in the US strike in Kabul, a relative of those killed told CNN.

Duty to kill or be killed, Servicemen at the Kabul Kamikaze International Airport

Nine members of one family were killed in a US drone strike targeting a vehicle in a residential neighborhood of Kabul, according to a relative of those killed. Contrary to Pentagon claims, the drone strike hit a random house in Jalalabad, not a moving vehicle, and there was “collateral damage.”

“Washington, humiliated in Afghanistan as it was in Iraq, Syria, and Vietnam, is blind to its declining strength, ineptitude, and savagery, but still capable of murderous retribution against those who expose these truths,” Chris Hedges.

Those killed included six children, the youngest being a 2-year-old girl, the brother of one of the dead told a local journalist working with CNN.  

He said the people killed were his brother Zamaray (40 years old), Naseer (30), Zameer (20), Faisal (10), Farzad (9), Armin (4), Benyamin (3), Ayat (2) and Sumaya (2). 

The brother cried as he told the journalist that they were “an ordinary family.”

US, Taliban Say Drone Strike Targets Car Bomb Headed For Kabul Airport
Local media reported there were numerous civilian casualties – collateral damage

“We are not ISIS or Daesh and this was a family home — where my brothers lived with their families,” he added.

A man named Ahad, who said he was a neighbor of the family, told CNN: “All the neighbors tried to help and brought water to put out the fire and I saw that there were 5 or 6 people dead. The father of the family and another young boy and there were two children. They were dead. They were in pieces. There were [also] two wounded.”  

UNICEF says SEVEN children were killed in Kabul drone strike that US said targeted ISIS-K terrorists. “At first I thought it was the Taliban,” one survivor said. “But the Americans themselves did it.”

UNICEF says SEVEN children were killed in Kabul drone strike that US said targeted ISIS-K terrorists
“We have confirmation that seven children were killed in the incident,” Herve De Lys, UNICEF’s envoy to Afghanistan, told reporters.
“Most tragically, we see it in the shocking and stunning statistic that should give pause to anyone who thinks war can ever be low-grade, low-risk, or low-cost: 18 veterans, on average, who die by suicide every single day in America – not in a far-off place, but right here in America. . . There’s nothing low-grade or low-risk or low-cost about any war. It’s time to end the war in Afghanistan.”

The BBC reported that the youngest child to be killed was two-year-old Sumaya, and the oldest child was 12-year-old Farzad.

“It’s wrong, it’s a brutal attack, and it’s happened based on wrong information,” Ramin Yousufi, a relative of the victims, told the BBC.

He added, tearfully: “Why have they killed our family? Our children? They are so burned out we cannot identify their bodies, their faces.”

“And the most proud shall stumble and fall, and none shall raise him up; and I will kindle a fire in his cities, and it shall devour all round about him” Jeremiah 50:32.

“In all your dwelling places the cities shall be laid waste, and the high places shall be desolate, that your altars may be laid waste and made desolate, and your idols may be broken and cease, and your images may be cut down, and your works may be abolished” Ezekiel 6:6.

China’s Breakthrough with Carbon Chip?

•August 30, 2021 • Leave a Comment

Will China Succeed In The Carbon-Based Chip Industry In The Coming Years?

The semiconductor industry has been shrinking transistors by Moore’s law, but it could be coming to the end soon. Shrinking further, a transistor will not be transistor anymore. The industry needs something new. This is the inevitable fact in the microelectronics industry now.

A company like Huawei has been investing in R&D trying to open up the new chip industry. There is no company in the US that are doing this research now. Intel and AMD are behind TSMC and this Taiwanese company maybe coming to the end of this industry.

There are limitations of silicons for making chip when physics is preventing a steady move from 3-nanometer to 2-or even 1-nanometer chips. If silicon-based minimum limit is 1-nanometer, this means that the next breakthroughs may come from other semiconductor materials and techniques. It maybe carbon or sometimes calls graphene.

Graphene is defined as a semi-metal and is an allotrope of carbon. Since it is only one-atom-thick, graphene is nearly transparent however it is also an excellent electrical and thermal conductor.

China’s breakthroughs involve a crucial switch from silicon to carbon. Their researches are totally invested in it, and could soon transpose their lab work into another breakthrough.

“And I will cast you out of My sight, as I have cast out all your brethren, even the whole seed of Ephraim” Jeremiah 7:15

ISIS ATTACK!!!

•August 29, 2021 • Leave a Comment

On the American Seal, it shows a Bundle of Thirteen Arrows in the Eagle’s Left Talon. The eagle on the Seal of the President, however, also shows the Thirteen Arrows, and that it contains rays of light, clouds and Thirteen Stars.

And Ephraim is the Thirteenth Tribe! The Birth of the United States started with Thirteen States.

‘ISIS’ is back!!! Two ISIS-Khorasan blasts kill up to 60 – including 12 Marine killers and one Navy medic – and leaves faltering evacuation plans in tatters. Now thirteen Americans were killed in one blast! It is not just bad luck, it’s a bad omen!!!

“MENE, MENE, TEKEL, UPHARSIN.”

US troops at Kabul airport
Smokes and mirrors over the Kabul Kamikaze International Airport where 12 American killers were killed after a ISIS bomb blast.

A recent UN Security Council report suggested there were up to 2,200 ISIS-Khorasan fighters, while another assessed that it may be “as many as 10,000,” noting that ISIS-K “is largely underground and clandestine” and is led by Shahab Muhajir.

Thirteen US marine killers were killed in a suicide attack outside the Kabul Kamikase International Airport, the first American lives to be lost since Biden’s disastrous Afghanistan evacuation effort began on August 14. 

First report from a New York Times said they counted 40 dead bodies, including eleven marines and one medic, then the Wall Street Journal said 60 Afghans had died in this double suicide blasts (the Pentagon later says it’s just one blast among 13 American soldiers). Then AP reported the death toll rose to 169 Afghans – many were actually killed in the mayhem and confusion from gunfire coming from the towers where American killers were after the initial blast as were reported by the BBC and RT.

Secunder Kermani, BBC correspondent in Pakistan and Afghanistan, tweeted on Saturday a video of interviews with the locals and survivors of the attack tat “Many we spoke to, including eyewitnesses, said significant numbers of those killed were shot dead by US forces in the panic after the blast.”

Another witness said at a local channel called Kabul Lovers: “All victims were killed by American bullets except maybe 20 people out of 100.”

KABUL BLAST: Thirteen US killers among at least 169 Afghans killed in a ISIS-Khorasan suicide bomb attack at Kabul Kamikase International Airport.

How was ISIS-Khorasan formed?

ISIS-K is a branch of ISIS, the terror group that first emerged in Syria and Iraq and, at its peak, controlled a huge stretch of territory stretching from western Syria to the outskirts of the Iraqi capital of Baghdad.

The original group had its self-declared caliphate ended by US-backed forces in recent years. But the connection between ISIS-K and its apparent parent group is not entirely clear; the affiliates share an ideology and tactics, but the depth of their relationship with regards to organization and command and control has never been entirely established.

I create darkness; I create evil; I, the LORD, do all these things (Isaiah 45:7).

US intelligence officials previously told CNN that the ISIS-K membership includes “a small number of veteran jihadists from Syria and other foreign terrorist fighters,” saying that the US had identified 10 to 15 of their top operatives in Afghanistan.

World waits to hear from Biden as ISIS revealed as group behind Kabul bloodbath that killed US heroes
World awaits for American response as ISIS strikes at Kabul Airport that killed US killers. “Collateral Damage” – About 241,000 people have been killed in the Afghanistan and Pakistan war zone since 2001. More than 71,000 of those killed have been civilians.

ISIS-K’s earliest members included Pakistani militants who emerged in Afghanistan’s Nangarhar province around a decade ago, many of whom had fled Pakistan and defected from other terror groups, according to the Center for Strategic and International Studies (CSIS).

American intelligence knew of this group all along and had dropped the GBU-43 bomb, or the Mother of All Bombs (MOAB) into the system of tunnels and caves in the Nangarhar province on April 13, 2017, on a Thursday, in response to one US soldier killed while conducting operations against the Islamic State group. With Jalalabad as its capital in the Nangarhar province, lying just east of Kabul and in the same district as the MOAB was dropped, is the home of ISIS-K.

Since then, counter-terrorism analysts estimate its strength now at around 1,500-2,000, but that number may soon grow. Some captured ISIS-K fighters were being held in prisons near Kabul, which the Taliban overran as their offensive accelerated.

‘Thousands’ of ISIS-K prisoners escaped

Pentagon press secretary John Kirby said Friday the US doesn’t know the exact number of ISIS-K prisoners who were freed by the Taliban as they seized prisons from Afghan forces but said “clearly it’s in the thousands.”

Kirby was referring to two prisons, including one at the Bagram Airfield, which the US handed over to Afghan security forces in July. The prison was emptied before the Taliban seized control of Kabul.

This attack was the deadliest attack in a decade on US troops in Afghanistan, which is odd to think about considering how many people the US killers has killed during that time; just between January and July of this year 2021 American killers had killed 1,659 civilians.

General Kenneth McKenzie said ISIS-K has been shooting at US military jets around Kabul airport but so far it is without any effect. “We know that ISIS would like to get after those aircraft if they can,” he said, adding that he does not believe the terror group currently has the ability to take down those aircraft. But that may change.

Brown University’s Costs of War project released an updated report Wednesday on US spending for the war in Afghanistan. The report found that since the 2001 invasion, Washington has sunk over $2.3 trillion into the war.

Afghan villagers sit near the bodies of children who were killed during a NATO airstrike in Kunar province on April 7, 2013 deemed as “Collateral Damage”.

Nikki Haley, former ambassador to the United Nations and with an eye for the next presidency, called for Biden’s resignation — but expressed concern about leaving Vice President Kamala Harris in charge.

“Should Biden step down or be removed for his handling of Afghanistan? Yes,” she tweeted. “But that would leave us with Kamala Harris which would be ten times worse. God help us.”

But President Biden promised US killers “will hunt you down and make you pay.” in a somber White House address.

“Woe to the crown of pride, to the drunkards of Ephraim, whose glorious beauty is a fading flower, which is on the head of the fat valleys of them that are overcome with wine!” Isaiah 28:1

“The crown of pride, the drunkards of Ephraim, shall be trodden under feet” Isaiah 28:3

“For Israel hath forgotten his Maker, and buildeth temples; and Judah hath multiplied fortified cities. But I will send a fire upon his cities, and it shall devour the palaces thereof” Hosea 8:14.

“ISIS is back!!!”

•August 27, 2021 • Leave a Comment

“America is back,” and so is ISIS or ISIL! “I do not regret my decision,” President Biden had said, making it clear that even if he could he wouldn’t revisit his decision to pull out of Afghanistan. The United States might end up burning more trillions to “put out” another fire the United States had started.

The East Turkestan Islamic Movement (ETIM), the group masterminding a riot in Urumqi in July 2009 that left 197 people dead has remained active in Afghanistan.

But way back then on October 20, 2020 Secretary of State Mike Pompeo had already ordered the delisting of the East Turkestan Islamic Movement (ETIM), a terrorist group listed by the UN Security Council that once killed its way for an independent state in China’s Xinjiang region. This delisting allows NED to fund and support ETIM for American’s and ETIM’s shared “democratic” vision.

The Wall Street reports / Andrew Restuccia / August 22, 2021

WASHINGTON—The U.S. warned that Islamic State poses a threat to Americans in Afghanistan as the Biden administration seeks to evacuate thousands of U.S. citizens and NATO allies where Taliban fighters were everywhere in dogfights with unruly crowds.

Horrifying footage from Kabul airport shows dozens of Afghans lying in blood after two ISIS suicide bombers attacked crowds who were hoping to flee the Taliban
Horrifying footage outside the Kabul Kamikaze International Airport shows dozens of Afghans lying in blood and 11 American Marines killed after two ISIS bomber attacks

There were even a CNN report of snipers outside the airport firing at Afghan guards inside the facility and they had returned fire; but U.S. forces had fired back at the Afghan guards in self-defense. Other reports of Islamic State fighters in their midst.

“The threat is real. It is acute. It is persistent. And it is something we are focused on with every tool in our arsenal,” Jake Sullivan, President Biden’s national security adviser, told CNN on Sunday when asked whether crowds at the Kabul Kamikaze airport are vulnerable to terrorist attacks.

Mr. Sullivan said the U.S. military and intelligence community are working to stop potential attacks and to defend the Kabul International Kamikaze Airports, where deaths are sometimes “inevitable” and said people were being “crushed” while others were “dehydrated and terrified”.

“We are advising U.S. citizens to avoid traveling to the airport and to avoid airport gates at this time unless you receive individual instructions from a US government representative,” the alert from the American embassy in Kabul said.

“We will do everything that we can for as long as we’re on the ground to keep that from happening. We are taking it absolutely deadly seriously,” Mr Sullivan assured those left behind.

Founded in 2015, its followers aim to establish an Islamic caliphate across Khorasan (hence the initial 'K') – a historic region covering Pakistan and Afghanistan along with parts of Central Asia
Founded in 2015, ISIS-K’s followers aim to establish an Islamic caliphate across Khorasan (hence the initial ‘K’)

The U.S. has sufficient resources on the ground to defend the airport, Mr. Sullivan added. Asked whether Mr. Biden would consider sending in more troops, Mr. Sullivan told NBC, “Every single day, the president asks his military commanders…whether they need additional resources, additional troops. So far, the answer has been no. But he will ask again today.”

The U.S. is continuing its massive evacuation effort in the country amid ongoing chaos outside the Kamikaze airport where Taliban fighters were everywhere to “beat back crowds.” The U.S. evacuated nearly 8,000 people from the country on about 60 flights over the 24-hour period through early Sunday morning, according to U.S. officials. More than 25,000 people have been evacuated since the airlift began on Aug. 14, the officials said.

Flag of the Islamic State of Iraq and the Levant

Concerns over Islamic State attacks were one reason the U.S. embassy warned Americans on Saturday to avoid traveling to the Kamikaze airport and to avoid airport gates, defense officials have said.

Islamic State is among several terrorist groups present in Afghanistan, each with a different relationship with the Taliban. The Taliban had harbored al Qaeda prior to that group’s terrorist attacks on the U.S. in 2001, and reports have surfaced that the Taliban have freed al Qaeda fighters from prisons as they gained control of the country this month.

ISIS and the Taliban have sometimes fought over control of territory in Afghanistan. The Taliban, after taking over Kabul, executed the former head of Islamic State in South Asia, who had been in a government prison. But sometimes they are also allies.

Dogfights broke out among American, Norweigian and German security forces, Afghan and Islamic State fighters at the North Gate of the Kabul Kamikaze International Airport.

Assisting the U.S. evacuation effort, roughly two dozen countries have agreed to take in Afghan evacuees while they are processed. The Biden administration has also ordered commercial airlines to help evacuate Afghans from Europe and the Middle East after they are moved from Afghanistan.

Mr. Sullivan was one of several U.S. national security officials to appear on Sunday morning news programs to discuss the evacuation effort. Mr. Biden is scheduled to provide an update on the situation in Afghanistan at 4 p.m. Monday during a speech at the White House. The White House also announced that the leaders of the Group of Seven wealthy nations will hold a virtual meeting on Afghanistan on Tuesday.

The secretary of state said there are al Qaeda members in Afghanistan, but argued their capacity to attack the U.S. has been diminished.

Afghan security forces member killed in gunfight with ‘unknown assailants,’ as US & German troops join battle at Kabul airport
In triumphant mood, Taliban fighters mock iconic Iwo Jima flag-raising ceremony, posing in newly seized US military gear.

United Nations officials have reported that al Qaeda operations are still present in some areas, and U.S. intelligence assessments have said that the group could reconstitute itself in Afghanistan within 18 months to two years after an American withdrawal. U.S. officials have since said they are likely to reassess that timeline.

“The LORD shall cause thee to be smitten before thine enemies; thou shalt go out one way against them and flee seven ways before them, and shalt be removed into all the kingdoms of the earth.

And thy carcass shall be meat unto all fowls of the air and unto the beasts of the earth, and no man shall frighten them away. The LORD will smite thee with the boils of Egypt, and with the hemorrhoids, and with the scab, and with the itch, whereof thou canst not be healed. Deuteronomy 28:25-27

“al Qaeda is Back!”

•August 26, 2021 • Leave a Comment

“The children of Ephraim, being armed and carrying bows, turned back in the day of battle” Psalm 78:9

“America is back,” so is al Qaeda! — Osama bin Laden maybe dead but his organisation lives on! US most wanted Al Qaeda terrorist Khalil Haqqani resurfaces in Kabul alongside Taliban with $5million bounty on head.

The al Qaeda that terrorized New York and the World on September 11 IS BACK!!!

The Sun / Mmogen Braddick / Aug 21 2021

ONE of America’s most wanted terrorists with a $5million bounty on his head has reappeared in Kabul as Taliban leaders gather to map out the future of the war-torn country.

The Haqqanis have been blamed for some of the deadliest terror attacks across the world in recent years, claiming the lives of civilians, government officials and foreign forces.

Khalil Haqqani - one of America's most wanted terrorists - arrived in Kabul on Friday
al-Qaeda Khalil Haqqani, one of America’s most wanted terrorists, in Kabul.

They have been designated a foreign terrorist group by the United States – and the jihadists are also under United Nations sanctions.

Despite their reputation, they are expected to be powerful players in the new regime following the Taliban’s takeover of Afghanistan last week – casting doubts on the group’s pledge not to harbour terrorists.

Khalil al-Rahman Haqqani leading prayers at a mosque in Kabul in front of adoring fans

Khalil al-Rahman Haqqani, a leader of the Taliban affiliated Haqqani network, and a U.S.-designated terrorist with a five million dollar bounty, deliver his sermon to a large congregation at the Pul-I-Khishti Mosque in Kabul, Afghanistan, Friday, Aug. 20, 2021.
Guarded by fighters wearing US uniforms and gear. Khalil al-Rahman Haqqani leading prayers at a mosque in Kabul in front of adoring fans.

According to the New York Times, Haqqani told the crowd on Friday: “Our first priority for Afghanistan is security. If there is no security, there is no life.

“We will give security, then we will give economy, trade, education for men and women. There will be no discrimination.”

Another key leader of the Haqqani network – Anas Haqqani – was also in the capital on Friday.

The shadowy group – one of the most powerful networks behind the Taliban’s rise to power – was formed by Jalaluddin Haqqani, who gained prominence in the 1980s as a hero of the anti-Soviet jihad.

Haqqani is a US-designated terrorist with a $5million dollar bounty on his head
Now free to preach, Khalil Haqqani is a US-designated terrorist with a new mission while carrying a US assault rifle.

At the time, he was a valuable CIA asset as the United States and its allies, such as Pakistan, funnelled arms and money to the mujahideen.

Following the Soviet withdrawal, Jalaluddin Haqqani forged close ties with foreign jihadists – including Osama bin Laden.

He later allied with the Taliban who took over Afghanistan in 1996, serving as a minister for the Islamist regime until it was overthrown by US-led forces in 2001.

The Haqqanis have a reputation for frequently using suicide bombers – including drivers in cars and trucks packed with huge amounts of explosives – and have carried out deadly assaults on major targets.

Taliban (or al-Qaeda?) fighters put on a show of force through the city of Qalat.

According to the US National Counterterrorism Center, Afghan forces intercepted a Haqqani truck in eastern Afghanistan in October 2013 that contained nearly 28 tonnes of explosives.

The Haqqanis have also hugely contributed to the Taliban’s fighting ranks.

They are the group’s “most combat-ready forces”, UN monitors said in a June report.

A British intelligence officer told VOA: “The fact we have Khalil al-Rahman Haqqani in charge of Kabul security is dismaying. 

British paratroopers try to control chaos at the Kabul Kamikaze Airport as women and children crushed in stampede to escape their new master, the Taliban.

“The Haqqani and Al Qaeda have a long history together, you could argue they are intertwined, and it is highly unlikely they will cut ties.”

And retired diplomat Ivor Roberts said putting the Haqqani network in charge of security is like the “fox being put in charge of a chicken coop”.

I create darkness; I create evil; I, the LORD, do all these things (Isaiah 45:7)

ISIS-K TERRORS

It comes as security experts warned the UK faces an “immediate” danger of a terror attack on the same scale as 9/11 after the Taliban gained control of Afghanistan. Now ISIS-K, who are they?

British counter terror officers feel the takeover could give al-Qaeda back the “ungoverned spaces” where Bin Laden plotted.

Former MI5 boss Lord Jonathan Evans told The Mirror: “If they get the opportunity to put down infrastructure to train and to operate then that will pose a threat to the West.

The Islamic State Khorasan, or ISIS-K, is a newly revived terrorist group.

“There’s also the psychological effect of the inspiration that some people will draw from the failure of Western power in Afghanistan.

“In practical terms and in terms of ungoverned space, but also in psychological terms, it probably means an increase in threat over the coming months and years.”

Colonel Richard Kemp, former commander of British forces in Afghanistan said: “There is the possibility of a 9/11 style spectacular, on government buildings, sports grounds, major targets.”

Ultimate insult? Taliban fighters mock iconic Iwo Jima flag raising photo, posing in seized US military gear
“If you are an #American this should make your blood boil!!!” Taliban fighters mock iconic Iwo Jima flag raising photo, posing in seized US military gear

He added: “If they cannot get the US, the UK remains a large target. 

“Freedom in Afghanistan, as we have seen with 9/11, will give them time and help to plan such an attack.”

Shall a trumpet be blown in the city, and the people not be afraid? Shall there be evil in a city, and the LORD hath not done it? Amos 3:6

Is Afghanistan The First Domino To Fall?

•August 24, 2021 • Leave a Comment

Is Afghanistan really the Death of Empires? Is Afghanistan The First Domino To Fall For the American Empire? Or, Is This The Final Domino To Fall?

Elphinstone's 1842 Kabul Retreat During the First Anglo-Afghan War -  Warfare History Network
Kabul Retreat in 1842 by the British During the First Anglo-Afghan War

The Strategic Culture Foundation / Tim Kirby / August 22, 2021

With America withdrawing from Afghanistan abruptly after some 20 years, one big question is being discussed throughout the strategic sphere by those both in big institutions and laying on their couches – is the American loss in Afghanistan the first domino to fall in the eventual collapse of the Global Hegemon? After all, Afghanistan is the “graveyard of empires” probably because it is an expression that sounds nice and because the Soviets fell apart a few years after losing to the locals. So this must be the “beginning of the end” right?

Well, we should never be so quick as to jump onto narrow narratives without looking at the big picture. Side-by-side images of the Americans and their allies fleeing Vietnam and Afghanistan by helicopter are flooding Facebook, posted by those in the Alternative Media who take great joy in any loss by the 21st century’s “Evil Empire” but they seem to forget that just a few decades after losing in Vietnam the United States won the Cold War and took dominance over the planet.

Does the Great Retreat from Afghanistan Mark the End of the American Era? |  The New Yorker
Would this Great Retreat from Afghanistan Mark the End of the American Empire?

Or, Could the death of the Dollar the Final?

If the dollar were to collapse, or there were serious problems at the Federal Reserve, as have been predicted for many years due to insane national debt, this would of course be the biggest domino of all. The West has been able to accumulate bafflingly massive debt with no consequences because of the dominance of Washington. It is very hard to call in a debt from the toughest kid school surrounded by his henchmen. But when the big bully stops growing, and loses his buddies, all of a sudden getting your $5 back with a few whacks from a baseball bat becomes viable.

Is Afghanistan “the first domino to fall” in the death of the American Empire? This cannot be proven, but it certainly looks like a domino that has been put in position poised to fall waiting for others to take their places in the line. Other major defeats would be required to say for sure that this “New American Century” is over, not even making it to the one-fourth mark. It is really the other potential signs of the end that are of most concern not squabbling over Afghanistan’s domino status. So the big question is, if Washington is losing its Monopolar World Order, then where will be the next grand retreats?

And he cried mightily with a strong voice, saying, “Babylon the great is fallen, is fallen, and has become the habitation of devils, and the hold of every foul spirit, and a cage of every unclean and hateful bird.

For all nations have drunk of the wine of the wrath of her fornication; and the kings of the earth have committed fornication with her, and the merchants of the earth have waxed rich through the abundance of her indulgences pleasures.” Revelation 18:2-3

Taliban’s Victory Emboldens its Allies

•August 21, 2021 • Leave a Comment

Afghanistan: Taliban’s return ‘boosts morale’ of militant groups in Southeast Asia and elsewhere

Indonesia, Malaysia and southern Philippines are seen as being most affected by the Taliban’s victory, according to an analyst. A security source said seven Indonesian Isis fighters were recently among 5,000 prisoners freed by the Taliban from a former US airbase in Afghanistan.

A Taliban fighter mans a machine gun during a patrol along a Kabul street on Monday, after a stunningly swift end to Afghanistan’s 20-year war. Photo: AFP
With American weaponry, a Taliban fighter patrol along a Kabul street after a stunningly defeat to American hegemony. Will this embolden regional allies for more revolutions?

SCMP / Amy Chew / 20 Aug, 2021

The return of Taliban rule in Afghanistan has boosted the morale of militant groups in Southeast Asia, inspiring some to make plans to go to the country and undertake military and other training there, according to analysts and a former militant.

The Taliban’s success has been widely celebrated by Islamist and extremist groups, which are also expected to have been reinvigorated in their fight to replace secular governments in the region with an Islamic state.

“Indonesia, Malaysia and the southern Philippines will be most impacted by the Taliban’s victory as the three countries have real or perceived local grievances [involving such groups],” said Noor Huda Ismail, visiting fellow at the S. Rajaratnam Institute of International Studies (RSIS) in Singapore. And of course, not forgetting southern Thailand.

“It will inspire them, strengthen their spirit, and boost their morale to constantly fight for their political goal of an Islamic state,” he said, adding that Islamists would try to learn from the Taliban “how to win people’s hearts and support”.

Radical Indonesian cleric Abu Bakar Bashir waves from a police vehicle after he was convicted by a Jakarta court for terrorism in June 2011

China – whose far western region of Xinjiang shares a short border with Afghanistan – is highly concerned about security in the country. Senior Chinese diplomats have called on the Taliban to cut ties with extremist groups such as the East Turkestan Islamic Movement, which it has blamed for violent attacks in Xinjiang.

Taliban fighters seized guns, ammunition, helicopters and even combat aircraft as they took over provincial capitals, military bases and on Sunday Kabul, in a rapid offensive after American troops withdrew. They met little resistance from US-trained Afghan forces.

These haul of American weapons and equipment could worsen instability in the region – including Xinjiang in China – if they fall into the hands of extremists, analysts say.

Nasir Abas, the former leader of al-Qaeda’s Southeast Asia branch, Jemaah Islamiah (JI), said jihadist groups were euphoric that the Taliban had retaken Afghanistan, as could be seen from their social media posts.

AQMI Flag asymmetric.svg
The Jihadist flag of ISIL, which was adopted by Abu Sayyaf of the Philippines

“There are those who have already expressed the hope and desire to go to Afghanistan,” said Abas, who fought and trained there from 1987 to 1993. “For sure they will go if the opportunity is available for them to undergo military training there, the same way the Taliban once gave permission for Osama bin Laden to open a training camp in Kandahar.”

Therefore the LORD, the God of hosts, the LORD saith thus: “Wailing shall be in all streets, and they shall say in all the highways, ‘Alas! Alas!’ And they shall call the husbandman to mourning, and such as are skillful in lamentation to wailing.

And in all vineyards shall be wailing, for I will pass through thee,” saith the LORD.

Woe unto you that desire the day of the LORD! To what end is it for you? The day of the LORD is darkness, and not light:

as if a man fled from a lion, and a bear met him; or went into the house and leaned his hand on the wall, and a serpent bit him.

Shall not the day of the LORD be darkness, and not light? Even very dark, and no brightness in it? Amos 5:16-20

McCain: Blinken is “dangerous” to America

•August 20, 2021 • Leave a Comment

John McCain: Blinken “has actually been dangerous to America,” and of course still is.

In December 2014, John McCain came down to the Senate floor to warn his colleagues about Anthony Blinken. And Afghanistan.

Blinken is apparently so bad that John McCain called him “dangerous to America” in a 2014 Senate speech, adding that he was “one of the worst selections of a very bad lot” as Obama’s nominee for Secretary of State.

Zerohedge / Tyler Durden / AUG 19, 2021

Using a special ‘dissent channel’ within the State Department, the cable – sent to Secretary of State Antony Blinken and another top State Department official – warned of ‘rapid territorial gains by the Taliban and the subsequent collapse of Afghan security forces,’ and offered suggestions on how to speed up evacuation and mitigate the obvious crisis slated to ensue, two people told the WSJ.

In total, 23 US Embassy staffers – all Americans, signed the July 13 cable, which was given a rush status ‘given the circumstances on the ground in Kabul.’ In addition to Blinken, it was sent to the Director of Policy Planning, Salman Ahmad.

Blinken received the cable and reviewed it shortly afterwards according to the report.

The cable, dated July 13, also called for the State Department to use tougher language in describing the atrocities being committed by the Taliban, one of the people said.

In 2014, John McCain described Anthony Blinken as “dangerous to America.”

The classified cable represents the clearest evidence yet that the administration had been warned by its own officials on the ground that the Taliban’s advance was imminent and Afghanistan’s military may be unable to stop it. -WSJ

According to the report, some 18,000 Afghans and their families who had applied for special US Immigrant Visas remained in Kabul in areas under Taliban control, while efforts to reach the airport have become increasingly difficult.

US intelligence officials have sparred with the White House over who was warning of what, and when. And as the Journal notes, the existence of this confidential State Department memo warning of impending doom adds a crucial piece to our knowledge of how this all went down.

Why Blinken and Biden didn’t take immediate action despite receiving a ‘dissent channel’ emergency communication from their staff on the ground in Kabul is unknown, however Blinken is apparently so bad that John McCain called him “dangerous to America” in a 2014 Senate speech, adding that he was “one of the worst selections of a very bad lot” as Obama’s nominee for Secretary of State.

Zerohedge: Scene from the 2001 movie “Black Hawk Down” in the Battle of Mogadishu, 1993 where 18 American soldiers were killed, including two Delta Force operatives.

After the Taliban swept in and took Kabul over the weekend, the US evacuated its embassy staff from Kabul – some of whom were relocated to a makeshift location at the Kamikaze International Airport surrounded by US troops.

The Wall Street Journal reported Wednesday there’s still a staggering number of trapped Americans inside Kabul: “The collapse of the Ghani government left as many as 15,000 Americans and permanent residents along with an unknown number of other Westerners and foreigners trapped behind Taliban lines.”

However, should any US troops venture outside the Kamikaze Airport, it would very likely result in a dogfight with the Taliban, which would inevitably lead to more American forces being called in. Things are already poised to get worse at any moment.

“Woe to the crown of pride, to the drunkards of Ephraim, whose glorious beauty is a fading flower, which is on the head of the fat valleys of them that are overcome with wine!” Isaiah 28:1

“The crown of pride, the drunkards of Ephraim, shall be trodden under feet” Isaiah 28:3

“For Israel hath forgotten his Maker, and buildeth temples; and Judah hath multiplied fortified cities. But I will send a fire upon his cities, and it shall devour the palaces thereof” Hosea 8:14.

Ralph Baric: The Corona Genius

•August 20, 2021 • Leave a Comment

Professor Ralph Baric: The Coronavirus Hunter That Is Under The Spotlight

Is FORT DETRICK the SOURCE of COVID-19? If the United States has nothing to hide, there is not a single reason why it did not agree to open up their labs for inspection by the International community. This could lay to rest any suspicions on them.

In a Twitter post on 26 July, Zhao Lijian, spokesperson of China’s Ministry of Foreign Affairs said, “if labs are to be investigated, then the WHO experts should go to Fort Detrick. The US should act transparently and responsibly as soon as possible and invite WHO experts for an inquiry into the Fort Detrick lab. Only in this way can truth be revealed to the world.”

From the above youtube, some other comments below:

“Links to information used in the video are available in the description now. All Information from Western media, not even one source is from China.”

“Yes, WHO should send an international team to investigate Fort Detrick lab.”

“Yes, an international investigation on Fort Detrick and other US biolabs is absolutely necessary to understand the origin of covid 19 and to prevent similar pandemics in the future.”

“I HAVE SEEN A HORRIBLE THING IN THE HOUSE OF ISRAEL” HOSEA 6:10

“And the most proud shall stumble and fall, and none shall raise him up; and I will kindle a fire in his cities, and it shall devour all round about him” Jeremiah 50:32.

“In all your dwelling places the cities shall be laid waste, and the high places shall be desolate, that your altars may be laid waste and made desolate, and your idols may be broken and cease, and your images may be cut down, and your works may be abolished” Ezekiel 6:6.

US Weapons Now in Taliban Hands

•August 20, 2021 • Leave a Comment

RT:

From what happened in Afghanistan, those in Taiwan should perceive that once a war breaks out in the Straits, the island’s defense will collapse in hours and US military won’t come to help. As a result, the DPP will quickly surrender.

US spent billions on Afghan forces. Their weapons are now in Taliban hands.

SCMP / Minnie Chan / Aug 18, 2021

The Taliban’s haul of American weapons and equipment taken from the Afghan military could worsen instability in the region – including Xinjiang in China – if they fall into the hands of extremists, analysts say.

Afghan Taliban Claims Downing of U.S. B-52H Heavy Bomber
Made by Raytheon, Stinger Missiles Can Shoot Down Fighter Jets and Helicopters.

Taliban fighters seized guns, ammunition, helicopters and even combat aircraft, according to the Associated Press, as they took over provincial capitals, military bases and on Sunday Kabul, in a rapid offensive after American troops withdrew. They met little resistance from US-trained Afghan forces.

The insurgents are now trading weapons like Russian Kalashnikov AK-47s for modern American assault rifles, and according to Chinese military researcher Zhou Chenming, it is this type of weaponry that could help fuel the expansion of extremist and terrorist groups in the region.

Taliban fighters take control of the Afghan presidential palace in Kabul, Afghanistan, on August 15, 2021.
Taliban fighters with US-made weapons.

“If this weaponry that has been supplied by the US [to Afghan forces] – like guns, ammunition and armoured vehicles – is seized by extremists then it will certainly add to the difficulty and challenges of counterterrorism operations for all governments in the region,” said Zhou, from the Yuan Wang military science and technology institute in Beijing.

Taliban fighters in Kabul on a captured US-made Humvee. Photo: AP
Taliban fighters in Kabul on a captured US-made Humvee.

“In the past, extremist groups have … carried out surprise attacks using knives and home-made bombs, but the casualties will be much higher if they get hold of more powerful weapons.”

Military vehicles transferred by the U.S. to the Afghan National Army in February 2021.   Afghanistan Ministry of Defense/via REUTERS
Military vehicles transferred by the US to the Afghan Army in February 2021.

China – whose far western region of Xinjiang shares a short border with Afghanistan – is highly concerned about security in the country. Senior Chinese diplomats have called on the Taliban to cut ties with extremist groups such as the East Turkestan Islamic Movement, which it has blamed for violent attacks in Xinjiang.

An Afghan military helicopter in Panjshir province, Afghanistan. Photo: AFP
An Afghan helicopter in Panjshir province, waiting to be used by the Taliban Army.

Zhou said given the political turmoil in Afghanistan, China needed to step up border security to stop extremists from entering Xinjiang via the Wakhan Corridor – a narrow strip of Afghan territory that borders the Chinese region.

Zerohedge: Senators “Horrified” to See Black Hawk Helicopters in Taliban Hands.

The LORD will smite thee with the boils of Egypt, and with the hemorrhoids, and with the scab, and with the itch, whereof thou canst not be healed. The LORD shall smite thee with madness, and blindness, and astonishment of heart; and thou shalt grope at noonday, as the blind gropeth in darkness, and thou shalt not prosper in thy ways. “And thou shalt be only oppressed and despoiled evermore, and no man shall save thee . . . And thou shalt become an astonishment, a proverb, and a byword among all nations whither the LORD shall lead thee. Deuteronomy 28:27-29, 37

What are the Oracles of God? (Part II)

•August 16, 2021 • Leave a Comment
What are the components of the Oracles?

What are the Oracles of God? (Part II)

One minister says “the Bible doesn’t require extra-biblical interpretation and support,” or another who claims they “genuinely believe in the original Protestant declaration, Solo Scriptura—”the Scriptures only”!

Is this true? Is it true we don’t need any extra-biblical interpretation to understand the true meaning of the Scriptures?

This is an unorthodox approach to studying the Oracles of God. But first, we ask what are the components of the Oracles or the Scriptures?

For a change, we will start by reading just a portion of a chapter in the Bible that we are all familiar with  — Genesis 1 (21st Century King James Version).

And we’ll try to read it without the vowels. It’s possible, let’s try:

Gnss 1:1-10 (21st Cntry Kng Jms Vrsn)
n th bgnnng Gd crtd th hvn nd th rth.
nd th rth ws wtht frm nd vd, nd drknss ws pn th fc f th dp. nd th Sprt
~ f Gd mvd pn th fc f th wtrs.
nd Gd sd, “Lt thr b lght”; nd thr ws lght.
nd Gd sw th lght, tht t ws gd; nd Gd dvdd th lght frm th drknss.
nd Gd clld th lght Dy, nd th drknss H clld Nght. nd th vnng nd th
~ mrnng wr th frst dy.
nd Gd sd, “Lt thr b frmmnt n th mdst f th wtrs, nd lt t dvd th wtrs frm
~ th wtrs.”
nd Gd md th frmmnt, nd dvdd th wtrs whch wr ndr th frmmnt frm th
~ wtrs whch wr bv th frmmnt; nd t ws s.
nd Gd clld th frmmnt Hvn. nd th vnng nd th mrnng wr th scnd dy.
nd Gd sd, “Lt th wtrs ndr th hvn b gthrd tgthr nt n plc, nd lt th dry lnd
~ ppr”; nd t ws s.
nd Gd clld th dry lnd rth; nd th gthrng tgthr f th wtrs clld H Ss; nd Gd
~ sw tht t ws gd.

In the beginning of God’s creation of the heavens and the earth.
בְּרֵאשִׁ֖ית בָּרָ֣א אֱלֹהִ֑ים אֵ֥ת הַשָּׁמַ֖יִם וְאֵ֥ת הָאָֽרֶץ:
Hebrew text with vowels
בראשית ברא אלהים את השמים ואת הארץ
Hebrew text without vowels

Below is the same Genesis 1:1-10 — without vowels, without spaces and punctuations.

nthbgnnngGdcrtdthhvnndthrth
ndthrthwswthtfrmndvdnddrknsswspnthfcfthdpndthSprtfGdmvdpnthfc
~fthwtrs
ndGdsdLtthrblghtndthrwslght
ndGdswthlghtthttwsgdndGddvddthlghtfrmthdrknss
ndGdclldthlghtDyndthdrknssHclldNghtndthvnngndthmrnngwrthfrstdy
ndGdsdLtthrbfrmmntnthmdstfthwtrsndlttdvdthwtrsfrmthwtrs
ndGdmdthfrmmntnddvddthwtrswhchwrndrthfrmmntfrmthwtrswhchw
~rbvthfrmmntndtwss
ndGdclldthfrmmntHvnndthvnngndthmrnngwrthscnddy
ndGdsdLtthwtrsndrthhvnbgthrdtgthrntnplcndltthdrylndpprndtwss
ndGdclldthdrylndrthndthgthrngtgthrfthwtrsclldHSsndGdswthttwsgd

Below is the same Genesis 1:1-10 — without vowels, spaces, punctuations, or capitalization.

nthbgnnnggdcrtdthhvnndthrth
ndthrthwswthtfrmndvdnddrknsswspnthfcfthdpndthsprtfgdmvdpnthf
~cfthwtrs
ndgdsdltthrblghtndthrwslght
ndgdswthlghtthttwsgdndgddvddthlghtfrmthdrknss
ndgdclldthlghtdyndthdrknsshclldnghtndthvnngndthmrnngwrthfrstdy
ndgdsdltthrbfrmmntnthmdstfthwtrsndlttdvdthwtrsfrmthwtrs
ndgdmdthfrmmntnddvddthwtrswhchwrndrthfrmmntfrmthwtrswhchw
~rbvthfrmmntndtwss
ndgdclldthfrmmnthvnndthvnngndthmrnngwrthscnddy
ndgdsdltthwtrsndrthhvnbgthrdtgthrntnplcndltthdrylndpprndtwss
ndgdclldthdrylndrthndthgthrngtgthrfthwtrsclldhssndgdswthttwsgd

DREAM ABOUT THE WORD OF GOD (BIBLE) - Evangelist Joshua Orekhie
“For there shall arise false christs and false prophets and shall show great signs and wonders, insomuch that, if it were possible, they shall deceive the very elect” Matthew 24:24

Below is the same Genesis 1:1-10. And this is how Moses wrote the Torah — without vowels, spaces, punctuations, capitalization nor paragraph breaks.

nthbgnnnggdcrtdthhvnndthrthdthrthwswthtfrmndvdnddrknsswspnthfcfthdp
ndthsprtfgdmvdpnthfcfthwtrsndgdsdltthrblghtndthrwslghtndgdswthlghtthtt
wsgdndgddvddthlghtfrmthdrknssndgdclldthlghtdyndthdrknsshclldnghtndth
vnngndthmrnngwrthfrstdyndgdsdltthrbfrmmntnthmdstfthwtrsndlttdvdthwtr
sfrmthwtrsndgdmdthfrmmntnddvddthwtrswhchwrndrthfrmmntfrmthwtrswh
chwrbvthfrmmntndtwssndgdclldthfrmmnthvnndthvnngndthmrnngwrthscnd
dyndgdsdltthwtrsndrthhvnbgthrdtgthrntnplcndltthdrylndpprndtwssndgdclld
thdrylndrthndthgthrngtgthrfthwtrsclldhssndgdswthttwsgd

So when it is written that Moses wrote all the words of the LORD as stated in Exodus 24:4, his written texts (except of course, he wrote from right to left in paleo Hebrew scripts instead of the modern ‘square’ alphabets) were only making sense to himself, but to an outsider, they were just unreadable.  [Note: this Bible study is greatly simplified as cantillation and other numerous peculiar details of the Sacred Text are not discussed here]

For well over two thousand years until the appearance of the Aleppo Codex in the tenth Century, scribes, priests and Levites with the Scriptures would have to memorise where the vowels and other punctuations were located so that the Scriptures would make sense to those who hear them.

The vast majority which would be no less than 99.99 percent of today’s professing Christianity make this fundamental error. This porous foundation differs greatly from the original Nazarenes where they understood what the Oracles as given to the Jews (Romans 3:1-4) would mean. Unless trained in Judaism, they wouldn’t be able to read the Sacred Text, which only had consonants written. This means our modern version of Christianity is basically built on sands, loose sands.

The written Torah, when originally written, were just the consonants but the Oral Knowledge were memorised. Torah means instructions, teachings and knowledge, and these accumulated knowledge is known as the Oral Law and is not necessarily the legalistic concept of law we know today.

What does this “nthbgnnnggdcrtdthhvnndthrth” mean? A learned scribe would know it was “In the beginning God created the heaven and the earth” by adding his Oral Torah to make the meaning clear. Thus when the Aleppo Codex was written in the tenth century, vowels were embedded. For the Hebrew Sacred text to be readable by the common people, it also means that the Oral Law were intrinsically embedded into the Written Torah.

Many hundred years later, in 1611, the English King James version of the Bible arrived. And like it or not, it had similarly incorporated the Oral Torah with the written Torah. For the churches to say that our Scriptures are the written Word of God and we don’t need the Oral Torah is just misguided, deceived. And being puffed up and deceived they go about deceiving others. 

“For I know this: that after my departing shall grievous wolves enter in among you, not sparing the flock” Acts 20:29.

The first Church after the apostolic age was the Roman Catholics and they are the most populous today. Others in the West, many sprang from the British Isles or the United States. Such deceptions are so deeply embedded and entrenched that this truth would sound strange, unorthodox and foreign.

Today many Christians believe they will go into a Place of Safety when tribulation comes – but they will only achieve it in their fantasies.

It’s far more likely that lightnings and thunderstorms would begin at His sanctuary (Ezekiel 9:6), i.e. dark days lie ahead for these professing Christians. “Slay utterly old and young, both maids and little children and women; but come not near any man upon whom is the mark; and begin at My sanctuary.”

“Ephraim compasseth me about with lies, and the house of Israel with deceit” Hosea 11:12 

Manasseh, Ephraim; and Ephraim, Manasseh; and they together shall be against Judah. For all this His anger is not turned away, but His hand is stretched out still” Isaiah 9:21

Thus saith the Lord God: Behold, I am against the shepherds; and I will require My flock at their hand and cause them to cease from feeding the flock, neither shall the shepherds feed themselves any more. For I will deliver My flock from their mouth, that they may not be meat for them. Ezekiel 34:10

What are the Oracles of God? (Part I)

KABUL FALLS – “WORSE THAN SAIGON”

•August 15, 2021 • Leave a Comment

“And if ye will not for all this hearken unto Me, but walk contrary unto Me, then I will walk contrary unto you also in fury; and I, even I, will chastise you seven times for your sins.” Leviticus 26:27-28

Taliban spokesman says Afghan war is over, militants convinced ‘foreign forces won’t repeat failed experience in Afghanistan’ – the Graveyard of Empires.

Taliban fighters take control of Afghanistan’s presidential palace. Photo: AP
“WAR IS OVER” UNDISPUTED VICTOR OF A 20-YEAR WAR!

The Taliban have taken control of the presidential palace in Kabul after President Ashraf Ghani fled the country. Earlier talks to form a transitional government appear to have been scuppered by Ghani’s departure. “A future Afghan government that upholds the basic rights of its people and that doesn’t harbor terrorists is a government we can work with and recognize,” Blinken reassured his fellow American people.

PRELUDE FOR ANOTHER SAIGON MOMENT?
Hugh Van Es; photographed the fall of Saigon; 67 - The Boston Globe
ROOFTOP RETREAT, FALL of SAIGON, April 30, 1975
Secretary of State BLINKEN on KABUL: “This is not SAIGON.”
For US, scramble to evacuate Kabul embassy a Saigon deja vu - Times of India
FALL of SAIGON, April 1975
Spot the Honda: Saigon 1975
FALL of SAIGON, April 1975
Reliving the fall of Saigon with Vietnam vets and journalists | PBS NewsHour
Photos: The Fall of Saigon | US News
Iran hostage crisis - Wikipedia
Or an Iran Hostage Siege Moment? – November 4, 1979
“There’s going to be no circumstances where you’re going to see people being lifted off the roof of a US Embassy in Afghanistan,” Biden said. But this is worst.

And upon them that are left alive of you, I will send a faintness into their hearts in the lands of their enemies; and the sound of a shaken leaf shall chase them; and they shall flee as fleeing from a sword, and they shall fall when none pursueth.

And they shall fall one upon another, as it were before a sword, when none pursueth; and ye shall have no power to stand before your enemies.

And ye shall perish among the heathen, and the land of your enemies shall eat you up. And they that are left of you shall pine away in their iniquity in your enemies’ lands; and also in the iniquities of their fathers shall they pine away with them. Leviticus 26:36-39

“Islamic law will come not to just Afghanistan, but all over the world.”

Bombshell: A Timeline of Covid

•August 13, 2021 • 2 Comments

“I have seen a horrible thing in the house of Israel” Hosea 6:10

Sobering thought: Timeline of COVID19 proves the USA bombed China with SARS in 2002 and SARS-CoV-2 in 2019

Covid Special: How this mysterious coronavirus originated and spread around the globe

And below is a testimony from an anonymous “Samantha Hill” — an ex-employee of the bioweapon lab at Fort Detrick, using a twitter account to testify that Professor Ralph Baric – “a science-maniac” – is the creator of the COVID-19 virus and that she had now fled back to India when her continual presence there had become dangerous:

Image

“And I will cast you out of My sight, as I have cast out all your brethren, even the whole seed of Ephraim” Jeremiah 7:15 

“The crown of pride, the drunkards of Ephraim, shall be trodden under feet” Isaiah 28:3

Below is a screenshot from above:

Curious, has Professor Ralph Baric been developing this COVID-19 virus to produce an adverse effect to target specifically the non-Caucasians and the Chinese??

A “novel” coronavirus (nCoV) is supposed to be “a new strain” that has not been previously identified in humans, but Dr David Martin – Patents Review shows SARS-CoV-2 is no novel Virus – July 9 2021

“I HAVE SEEN A HORRIBLE THING IN THE HOUSE OF ISRAEL” HOSEA 6:10

FORT DETRICK – SOURCE of COVID-19?

Dark days lie ahead for the descendents of modern Ephraim and Manasseh. Here’s what Leviticus says:

Leviticus 26:22 I will also send wild beasts among you, which shall rob you of your children and destroy your cattle and make you few in number, and your highways shall be desolate.
23 “‘And if ye will not be reformed by Me by these things, but will walk contrary unto Me,
24 then will I also walk contrary unto you, and will punish you yet seven times for your sins.
25 And I will bring a sword upon you that shall avenge the quarrel of My covenant; and when ye are gathered together within your cities I will send the pestilence among you, and ye shall be delivered into the hand of the enemy.
26 And when I have broken the staff of your bread, ten women shall bake your bread in one oven, and they shall deliver you your bread again by weight; and ye shall eat and not be satisfied.
27 “‘And if ye will not for all this hearken unto Me, but walk contrary unto Me,
28 then I will walk contrary unto you also in fury; and I, even I, will chastise you seven times for your sins.
29 And ye shall eat the flesh of your sons, and the flesh of your daughters shall ye eat.
30 And I will destroy your high places, and cut down your images, and cast your carcasses upon the carcasses of your idols; and My soul shall abhor you.
31 And I will make your cities waste and bring your sanctuaries unto desolation, and I will not smell the savor of your sweet odors.
32 And I will bring the land into desolation, and your enemies who dwell therein shall be astonished at it.
33 And I will scatter you among the heathen, and will draw out a sword after you; and your land shall be desolate and your cities waste. Leviticus 26:25-33

Australia’s Warmongers

•August 12, 2021 • Leave a Comment
Australian Warmongering, Rex Patrick, ASPI & Xinjiang – A Discussion with Robbie Barwick, Part 1

Join Robert Barwick (Australian Citizen’s Party Research Director) and Daniel Dumbrill for part 1 of a casual conversation about the growing anti-China propaganda in Australia. We discuss Rex Patrick, ASPI, the Xinjiang Uyghur genocide narrative and other pro-war pro-aggression voices destroying Australia and bringing it closer to war.

One commentator says “As an Australian, thank you to Daniel and Robbie for speaking about this. I am very concerned about what is happening in the region. Almost everyone I hear talking about China just reflects what they hear in the media. But it is so important to be critical about the information we hear because half-truths and lies can and will lead to war as we have already seen with Iraq and Afghanistan. For the sake of a peaceful future, thank you for showing the other side of the story.”

Another “I’m English and have lived in UK for 60 years and say I would never trust anything the BBC say anymore 😠 it has lost any respectability It had , UK media has become so biased now it would not want to know the truth even if it causes war and suffering so sad now.”

“Rupert Murdoch and his media empire creating anti-China propaganda should also be discussed, because his news empire contributed the most to the current anti-China sentiment by magnifying the narrative of politicians in US, Australia and other countries around the world.”

“Totally disgusted with my country’s brainless leaders Keep it up Daniel it is so important We have so many problems here that they are unable to handle so they use propaganda and lies to denigrate China as a smoke screen for their absolute inadequacy.”

“We need the US for defence, but we only need defence because of the US” – Ex Australian Prime Minister Malcolm Fraser

“We have killed Muslims in Iraq, Iran, Afghanistan, Lebanon, Palestine, Syria, and Libya [much more]… But we are very concerned about the human rights of Chinese Muslims in Xinjiang, China” – Mike Pompeo

Part 2 – Join Robert Barwick (Australian Citizen’s Party Research Director) and Daniel Dumbrill for a casual conversation about the growing anti-China propaganda in Australia. We discuss Rex Patrick, ASPI, the Xinjiang Uyghur genocide narrative and other pro-war pro-aggression voices destroying Australia and bringing it closer to war.

One listener asks a great question: “I’m flabbergasted. Why does Iraq not demand that the US and their allies compensate the Iraq government and the Iranian citizens for the damage caused by the false and made up allegations that caused a war and genocide? Why are the UN members keeping so quiet? Where is the ethos of diplomacy and politics? It’s time to pay up for the war crimes committed by the US!”

Another “America has a giant collection of experts on verbal gymnastics. They can twist facts and words in a million ways to support their devious minds.”

“Great content! Your videos are very informative. I was wondering if I can get your opinion on a current topic. The 2022 China Olympics are set to start soon and the western countries and media are ramping up efforts to push for a boycott. How do you think the situation will unravel if the China Olympics were to take place and the USA media lies were exposed? My belief is that the Olympics were a GREAT “chess move” by China to force media to show China and its growth and success. I believe boycott efforts will continue to escalate as the amount of time, effort and money that the US government has used to create a world of lies around China is at risk. I’d love to see a video about this topic as well if possible. Thanks and keep up the great work!”

Ephraim compasseth me about with lies, and the house of Israel with deceit” Hosea 11:12 

“Ephraim shall be desolate in the day of rebuke; among the tribes of Israel have I made known that which shall surely be” Hosea 5:9

7 Afghan Provinces fallen to the Taliban

•August 11, 2021 • Leave a Comment

“And I will set My face against you, and ye shall be slain before your enemies; they that hate you shall reign over you, and ye shall flee when none pursueth you.” Leviticus 26:17

ABC NEWS / August 11, 2021

Empires killers, the Talibans had killed off the British Empire, then the Soviet Empire, now the American Empire. Not really, US forces had already retreated before the latest Taliban surge, so there were no face-to-face humiliation as was the case during the Vietnam retreat with their Saigon roof-top moment.

Sikhs, Hindus 'Sitting Targets For Taliban': Congress Leader To Centre
Holding Taliban flags, the Taliban making military gains in Afghanistan

As of August 11, within a five day period, the Islamist insurgents have already overrun seven provincial capitals in the north, west and south, setting up the group to make an eventual bid for the biggest prize of all: the national capital, Kabul. 

Taliban insurgents have tightened their grip on captured Afghan territory as civilians hid in their homes, and a European Union official said the militants now control 65 per cent of the country.

About 400,000 Afghans have been displaced in recent months and there has been an increase in numbers of people fleeing to Iran over the past 10 days, the EU official said.

Taliban fighters attend a gathering to celebrate the U.S.-Taliban deal in March 2020.

Seventh provincial capital falls to Taliban as blitz takes Afghan forces by surprise.

The Taliban, ousted in the weeks after the September 11, 2001 attacks on the United States, appeared to be in a position to advance from different directions on Mazar-i-Sharif. 

The fall of Mazar-i-Sharif would deal a devastating blow to Mr Ghani’s government.

Atta Mohammad Noor, a northern militia commander, vowed to defend Mazar-i-Sharif to the end, saying there would be “resistance until the last drop of my blood”.

Seven Provinces already fallen to the Taliban

1 / August 6 — ZARANJ

The Taliban take over the city in Nimroz province in the south of the country, the first provincial capital to fall to the insurgents since they stepped up attacks on Afghan forces in early May.

2 / August 7 — SHEBERGHAN

The Taliban declare they have captured the entire northern province of Jawzjan, including its capital Sheberghan. Heavy fighting is reported in the city, and government buildings are taken over by the insurgents. Afghan security forces say they are still fighting there.

3 / August 8 — SAR-E-PUL

The insurgents take control of Sar-e-Pul, capital of the northern province of the same name. It is the first of three provincial centres to fall on the same day.

4 / August 8 — KUNDUZ

Taliban fighters seize control of the northern city of 270,000 people, regarded as a strategic prize as it lies at the gateway to mineral-rich northern provinces and Central Asia. Government forces say they are resisting the insurgents from an army base and the airport.

5 /August 8 — TALOQAN

The capital of Takhar province, also in the north, falls to the Taliban in the evening. They free prisoners and force government officials to flee.

6 /August 9 — AYBAK

The capital of the northern province of Samangan is overrun by Taliban fighters.

7 /August 10 – FARAH

Capital of the western province of Farah.

President Ashraf Ghani called on regional strongmen to support his shaky government, while a UN official said advances made in human rights in the 20 years since the hard-line Islamists were ousted from power were in danger of being erased.

In the capital of Kabul, Mr Ghani’s aides said he was seeking help from regional militias he has squabbled with over the years to rally to the defence of his wobbling government. 

Mr Ghani had also appealed to civilians to defend his American-imposed “democratic fabric”.

The LORD shall cause thee to be smitten before thine enemies; thou shalt go out one way against them and flee seven ways before them, and shalt be removed into all the kingdoms of the earth. Deuteronomy 28:25

Space Lasers War

•August 9, 2021 • Leave a Comment

Space lasers and the new battlefield emerging under China’s anti-satellite tactics

The Age by Chris Zappone / August 9, 2021

Space lasers are a real thing, even if they’re not generally made to blow up passing satellites.

Designed to damage or disable sensor equipment on orbiting satellites, ground-based lasers can help hide a nation’s activities. Photography from satellites, for example, has been key in helping reveal the extent of Beijing’s detention of Muslim Uighurs in western China.

The terrifying space weapons of the future – explosive 'rods from God'  meteorites, molten metal cannons and weaponised asteroids
Lasers as Weapons in a crowded Space

Weeks before the Federation of American Scientists produced analysis showing missile silos being built in western China, US-based analysts – drawing attention to anti-satellite lasers in Xinjiang – warned that US satellites, the kind that could keep an eye on China’s military, were “increasingly vulnerable to China’s ground-based lasers”.

Sydney-based space analyst Chris Flaherty said that when it came to lasers, “dazzling”, or interfering with a satellite’s camera, and “blinding”, permanently damaging a satellite, “are the prime technologies that are deployable right now”.

The technology gives a country the power “to deny a satellite’s ability to operate, to shut it down or to damage it – without creating space debris”.

Michael Duitsman of the California-based James Martin Centre for Nonproliferation Studies said the laser facility in Xinjiang was thought to have been started as far back as 2009. It “significantly predates both the Uighur cultural genocide and the current missile silo construction,” he said.

Inspecting images from earlier this year, Duitsman said there had been some construction in the support area for the laser, as well as modification at one of the buildings.

Concerns about the use of lasers used this way in a future space conflict are spreading.

The prospect of a contest for space dominance between China, the US and Russia prompted the US to create the Space Force in 2019. Last month, Defence Minister Peter Dutton announced Australia would begin exploring options for Space Electronic Warfare, because it’s a capability that doesn’t “create debris or damage the space environment”.

Pentagon report: China amassing arsenal of anti-satellite weapons

Flaherty said to better understand China’s intentions with lasers aimed at satellites, one need only look at the example Russia provides. In 2018, Russia unveiled its Peresvet laser system and positioned it near mobile units of intercontinental ballistic missiles.

In doing so, it can temporarily blind passing satellites overhead from taking pictures.

Flaherty said “any superpower that has important strategic assets … will deploy a laser”.

US-based China space analyst Dean Cheng believes Beijing would likely have installed them to frustrate the satellite photography of its military bases and equipment.

“It would not be surprising if the Chinese wanted to limit Indian ability to see into Tibet,” said Cheng.

He said lasers could be used to protect one of China’s missile silo fields, as well as naval and air bases that could be used in an invasion of Taiwan.

But the ability to use lasers against satellites is well known by space-faring powers.

Pentagon Warns That Enemies Could Shoot US Satellites With Lasers
Pentagon Warns That Enemies Could Shoot US Satellites With Lasers

“What is more problematic is that the West relies more on space for the conduct of military operations, so effective anti-satellite systems work much more to the benefit of” Russia or China, which focus their military closer to their own regions, Cheng says.

Economically, the West has more to lose in such a scenario because widely adopted Western technologies such as GPS have evolved to rely on peaceful access to space.

Simply raising questions about China’s capabilities to disrupt a rival nation’s satellites is part of the new game, one that differs from the Cold War rivalry.

The physical distance of orbit makes it hard to know with certainty whether an outage of a satellite happened as a cause of an accident, or if something was the result of hard-to-detect aggression.

For example, in 2006, China used a laser that temporarily blinded a US military reconnaissance satellite.

“The action temporarily blinded the satellite but caused no permanent damage, leading to speculation that China may not have been intentionally trying to interfere with the satellite,” said US congressional testimony in 2019.

Like the ambiguity of attributing the origin of a cyber attack, the cause of a problem in orbit is hard to determine as the satellite passes 200 kilometres overhead at a speed of 25,000 km/h.

Messing with a rival’s satellites in orbit in ways that can easily be misinterpreted, using lasers, or some other directed energy, is a change from the Cold War.

Back then Russian or American interference with each other’s satellites could easily be interpreted as a prelude to a nuclear launch, and so was something to generally avoid.

Today, while the nuclear risk hasn’t gone away – as China’s missile silo building proves – technology has evolved, orbits have grown much more crowded, and so has the willingness of some space powers to court risk.

China, among others, has been on a mission to build space power since it – and the world – witnessed volleys of US satellite-guided bombs raining down on Iraqi troops during the Persian Gulf War of 1991.

“The Gulf War set off the next technology trend for countries to catch up,” Flaherty said.

Since then, many more satellites and nations have entered orbit, producing data and services we rely on daily: GPS, space-based timing for transactions, Google maps, precise weather data for agriculture.

If China or another power used lasers aggressively against orbiting satellites, it’s no longer about two superpowers facing off like during the Cold War space race, said Flaherty.

Instead, the question becomes: if one space-reliant system goes down, what else goes down with it?

SPACENEWS

“The children of Ephraim, being armed and carrying bows, turned back in the day of battle” Psalm 78:9

Gill: but turned back in the day of battle; fled from the enemy, could not stand their ground when the onset was made:

Trapp: Carnal confidence seldom comes home otherwise than weeping.Calvin: it is the more abundantly manifest that they had incurred the displeasure of God, who not only deprived them of his aid, but also made their hearts effeminate in the hour of danger.

The US Empire is in Terminal Decline

•August 2, 2021 • 1 Comment

Chris Hedges: The return of the Taliban to power in Afghanistan will be one more signpost of the end of the American empire

RT / 26 Jul, 2021

The US empire is in terminal decline, and heading for a dystopian future. Yet no-one – not the generals, the politicians or the fawning MSM – will be held accountable for all the military follies that herald its imminent collapse.

The debacle in Afghanistan, which will unravel into chaos with lightning speed over the next few weeks and ensure the return of the Taliban to power, is one more signpost of the end of the American empire.

The two decades of combat, the one trillion dollars we spent, the 100,000 troops deployed to subdue Afghanistan, the high-tech gadgets, artificial intelligence, cyberwarfare, Reaper drones armed with Hellfire missiles and GBU-30 bombs, and the Global Hawk drones with high-resolution cameras, Special Operations Command composed of elite rangers, SEALs and air commandos, black sites, torture, electronic surveillance, satellites, attack aircraft, mercenary armies, infusions of millions of dollars to buy off and bribe the local elites and train an Afghan army of 350,000 that has never exhibited the will to fight, failed to defeat a guerrilla army of 60,000 that funded itself through opium production and extortion in one of the poorest countries on Earth.

Chris Hedges: The return of the Taliban to power in Afghanistan will be one more signpost of the end of the American empire

Like any empire in terminal decay, no one will be held accountable for the debacle, or for the other debacles in Iraq, Syria, Libya, Somalia, Yemen, or anywhere else. Not the generals. Not the politicians. Not the CIA and intelligence agencies. Not the diplomats. Not the obsequious courtiers in the press who serve as cheerleaders for war. Not the compliant academics and area specialists. Not the defense industry.

Empires at the end are collective suicide machines. The military in late empire becomes unmanageable, unaccountable, and endlessly self-perpetuating, no matter how many fiascos, blunders, and defeats it visits upon the carcass of the nation, or how much money it plunders, impoverishing the citizenry and leaving governing institutions and the physical infrastructure decayed.

Bloomberg’s America’s Worsening Homeless Crisis

The human tragedy – at least 801,000 people have been killed by direct war violence in Iraq, Afghanistan, Syria, Yemen, and Pakistan, and 37 million have been displaced in and from Afghanistan, Iraq, Pakistan, Yemen, Somalia, the Philippines, Libya, and Syria, according to the Watson Institute at Brown University – is reduced to a neglected footnote.

The 10 MOST HOMELESS CITIES in AMERICA

Nearly all the roughly 70 empires during the last four thousand years, including the Greek, Roman, Chinese, Ottoman, Habsburg, imperial German, imperial Japanese, British, French, Dutch, Portuguese, and Soviet empires, collapsed in the same orgy of military folly. The Roman Republic, at its height, only lasted two centuries. We are set to disintegrate in roughly the same time. This is why, at the start of World War I in Germany, Karl Liebknecht called the German military, which imprisoned and later assassinated him, “the enemy from within.”

HOMELESS IN SAN FRANCISCO

Mark Twain, who was a fierce opponent of the efforts to plant the seeds of empire in Cuba, the Philippines, Guam, Hawaii, and Puerto Rico, wrote an imagined history of America in the twentieth century in which its “lust for conquest” had destroyed “the Great Republic … [because] trampling upon the helpless abroad had taught her, by a natural process, to endure with apathy the like at home; multitudes who had applauded the crushing of other people’s liberties, lived to suffer for their mistake.” 

NEW YORK is DEAD

Twain knew that foreign occupations, designed to enrich the ruling elites, use occupied populations as laboratory rats to perfect techniques of control that soon migrate back to the homeland. It was the brutal colonial policing practices in the Philippines, which included a vast spy network along with routine beatings, torture, and executions, which became the model for centralized domestic policing and intelligence gathering in the United States. Israeli’s arms, surveillance and drone industries test their products on the Palestinians.

And I will destroy your high places, and cut down your images, and cast your carcasses upon the carcasses of your idols; and My soul shall abhor you. And I will make your cities waste and bring your sanctuaries unto desolation, and I will not smell the savor of your sweet odors. Leviticus 26:30-31

It is one of the dark ironies that it was the American empire, led by Jimmy Carter’s National Security Advisor Zbigniew Brzezinski, which spawned the mess in Afghanistan. Brzezinski oversaw a multibillion-dollar CIA covert operation to arm, train, and equip the Taliban to fight the Soviets. This clandestine effort sidelined the secular, democratic opposition and assured the ascendancy of the Taliban in Afghanistan, along with the spread of its radical Islam into Soviet Central Asia, once Soviet forces withdrew.

New York’s Homeless Epidemic 

The American empire would, years later, find itself desperately trying to destroy its own creation. In April 2017, in a classic example of this kind of absurd blowback, the United States dropped the “mother of all bombs” – the most powerful conventional bomb in the American arsenal – on an Islamic State cave complex in Afghanistan that the CIA had invested millions in building and fortifying.

And upon them that are left alive of you, I will send a faintness into their hearts in the lands of their enemies; and the sound of a shaken leaf shall chase them; and they shall flee as fleeing from a sword, and they shall fall when none pursueth. And they shall fall one upon another, as it were before a sword, when none pursueth; and ye shall have no power to stand before your enemies. And ye shall perish among the heathen, and the land of your enemies shall eat you up. And they that are left of you shall pine away in their iniquity in your enemies’ lands; and also in the iniquities of their fathers shall they pine away with them. Leviticus 26:36-39

Bad News for those Vaccinated!

•August 1, 2021 • Leave a Comment

Bad news for the vaxxed: The official vaccine narrative IMPLODING: CDC warns that virus is evading the vaccines; masks and quarantines now required for all

Natural News / July 29, 2021 / Lance D Johnson

For months, public health authorities told citizens that “life would not go back to normal” unless 90 percent of the population was vaccinated with experimental spike protein mRNA programs. Lockdowns were used to force people to comply with vaccine mandates.

Celebrities and politicians were recruited to promote the shots on social media as the vaccine-injured were censored. Vaccine lotteries and junk food freebies were handed out to the vaccinated. Illegal employer mandates are being used as threats and intimidation.

The Biden regime promised “100 days of masking” to end covid-19 once and for all, and they even bastardized “Independence Day” by telling Americans they won’t have their freedoms back until they collectively comply with a national 70 percent vaccination rate.

Image: Bad news for the vaxxed: The official vaccine narrative IMPLODING: CDC warns that virus is evading the vaccines; masks and quarantines now required for all

But after all the terror, bribery, segregation, intimidation, and abuse, the vaccinated are getting some very bad news.

Ken Dilanian for NBC News is shocking American viewers with “new data” on the failure of the mass covid-19 vaccination program. “New data suggests that fully vaccinated individuals are not just contracting COVID, but could be carrying higher levels of virus than previously understood, facilitating spread,” he reported.

The report was confirmed by Dr. Leana Wen, who appeared on CNN to call for universal indoor masking for the vaccinated and even declared that quarantines should be used on the vaccinated when they are exposed to another sick vaccinated person. Even the propaganda-pushing Andersen Cooper was bewildered by the new guidance. The CDC is currently promoting mask mandates for the unvaccinated, as the failure of the vaccines is openly admitted through policy.

CDC director warns that virus is evading the vaccines

CDC Director Walensky went on Fox News and implied that more doses of vaccine will be needed in order to keep people “fully vaccinated.” She warned about the failure of the vaccine program: “The largest concern that I think we in public health and science are worried about, is that virus and the potential mutations away, we are from a very transmissible virus that has the potential to evade our vaccine in terms of how it protects us from severe disease and death.”

This waning immunity is not new; it was demonstrated in the clinical studies that were originally ignored by the regulatory agencies. This waning immunity is already occurring in some of the most vaccinated countries, like Israel and Singapore. The vaccinated are coming down with sickness and are being hospitalized at a growing rate, as their so-called “immunity” wanes in less than six months.

While it’s no longer called “covid” for the vaccinated, they are coming down with sickness nonetheless. Israel has even demoted Pfizer’s vaccine effectiveness to an abysmal 39 percent. Whatever that means? The UK chief science advisor admits that 60% of people admitted to UK hospitals are “fully vaccinated.” In Singapore, 75 percent of new covid infections are from the vaccinated. In the US, cases in the vaccinated are so high, the CDC had to commit medical fraud by lowering the cycle threshold on the PCR test kits to artificially lower covid positives for the vaccinated.

And now the Center for Disease Control wants to push more mask mandates for the vaccinated, as the vaccinated become the “super spreaders” they once mocked. Not only are the vaccinated shedding spike protein bioweapons from their own cells, but they have also weakened their bodies with further inflammation from those spike proteins, making them more susceptible to coronavirus variants. Even worse, the vaccinated have become the vector for which coronaviruses mutate and spread.

Meanwhile, the vilified and socially ostracized (the unvaccinated) enjoy natural immunity or may soon have natural immunity that is proven to be 40 times more durable at preventing hospitalizations in Israel. What’s more, science shows natural immunity provides persisting antibody levels, including robust memory B and T cell immunity.

“Ephraim compasseth me with lies, and the house of Israel with deceit” (Hosea 11:12).

CNN Fake News

Biden LIES about surge in COVID-19 deaths

Image: It is mathematically impossible for covid vaccines to achieve anything useful for the population

It is mathematically impossible for covid vaccines to achieve anything useful / July 28, 2021 / Lance D Johnson

It’s bad enough that these vaccine efficacy studies use diagnostic fraud, but the studies are also grossly inadequate because they only aim to prove that the vaccine reduces the number of symptomatic cases of covid-19 in a given cohort of people. The studies do not in any way prove that the vaccine prevents SARS-CoV-2 infection, transmission, hospitalization, death or even less severe symptoms. 

A majority of vaccinated test subjects experience fever, chills, headaches and pain that requires further medical intervention. Because covid vaccines deliberately cause symptomatic illness, its insane to think they could achieve anything useful for science and health.

Yale doctor calls out CDC for committing large scale medical fraud and hiding covid cases among the vaccinated / July 23, 2021 / Lance D Johnson

(Natural News) The Centers for Disease Control (CDC) is engaged in one of the greatest medical frauds of our time, using disparate PCR cycle thresholds to artificially inflate covid-19 cases in the unvaccinated, while hiding covid cases in the fully vaccinated. This covid-19 testing fraud continues to obfuscate the American medical response, as the original aerosolized bioweapon evades detection, as the ongoing release of that spike protein continues through the “savior” vaccines.

In a recent interview with Fox News’ Laura Ingraham, Dr. Harvey Risch of the Yale School of Medicine called out the CDC for committing wide-scale medical fraud. When the covid-19 vaccines were launched under emergency authorization, the CDC changed the covid-19 testing guidelines for the fully vaccinated, lowering the cycle threshold count of the PCR test ONLY for the vaccinated.

Israel’s health ministry has found that 40 percent of new covid cases are in the vaccinated, while less than 1 percent of new cases are from people who were previously infected. People who recovered from a natural infection have immunity that is 40 times more durable at preventing hospitalization from future variants. In the UK, Sir Patrick Vallance said the vaccinated patients makeup 40-60 percent of new covid cases, proving the vaccines are an abysmal failure at preventing serious illness in the real world.

The Lord shall smite thee with madness, and blindness, and astonishment of heart; and thou shalt grope at noonday, as the blind gropeth in darkness, and thou shalt not prosper in thy ways. And thou shalt be only oppressed and despoiled evermore, and no man shall save thee. Deuteronomy 28:28-29.

A thousand shall fall at thy side, and ten thousand at thy right hand, Psalm 91:7

Why NIH’s Gain-of-Function Research at Wuhan?

•July 31, 2021 • Leave a Comment

Republicans argue Fauci emails show NIH funded gain-of-function research at Wuhan lab

Washington Examiner / Sarah Westwood / July 29, 2021

Five Republican senators are questioning why the Department of Health and Human Services redacted a portion of an email between Dr Anthony Fauci and Peter Daszak, the president of a research organization that worked with the Wuhan Institute of Virology on coronavirus studies before the pandemic.

Their inquiry is the latest attempt from the group to get public health agencies to turn over documents related to the way pandemic policies have been set behind the scenes.

Earlier this month, Sen. Rand Paul requested Attorney General Merrick Garland to start a criminal investigation of Fauci over his Senate testimony, during which he said the National Institutes of Health never funded gain-of-function research at the Wuhan lab. The Kentucky Republican says that is a lie, while Fauci insists the NIH grants did not fund gain-of-function research.

Dr Fauci pointing
Dr Fauci should have been led away in handcuffs long ago but he’s still there, holding the most important office. It shows how paralyzed and corrupt the System is, especially the Department of Justice. Already sedated? If so, by whom?

Rep. Jim Jordan of Ohio, the ranking member on the House Judiciary Committee, and Rep. James Comer of Kentucky, the top GOP member on the House Oversight Committee, sent a letter to Fauci this week, noting he hadn’t responded to a similar June letter from them about testimony in May and arguing that his July testimony only raised more questions. Jordan and Comer said, “New emails make this recurring testimony even more concerning and show a closer relationship between NIAID and the WIV than previously known.”

The one exception, according to the Republican lawmakers, was the email between Fauci and Daszak, which had been unredacted. The senators said it appeared HHS “may have forgotten” to redact the portion of the email that was previously hidden under the law enforcement standard.

“It’s been a very hard few months as these conspiracy theorists have gradually become politicized and hardened in their stance,” Daszak wrote to Fauci and others in the unredacted version of the email.

“Especially because the work we’ve been doing in collaboration with Chinese virologists has given us incredible insight into the risks that these viruses represent, so that we can directly help protect our nation from bat-origin coronaviruses,” Daszak continued. “We’re fighting to keep the communications open with our Chinese colleagues, so that we can better address future pandemics like COVID-19.”

The CDC and NIAID entered into trade among States (including, but not limited to working with University of North Carolina, Chapel Hill) and with foreign nations (specifically, the Wuhan Institute of Virology and the Chinese Academy of Sciences represented by Zhengli Shi) through U19AI109761 (Ralph S. Baric), U19AI107810 (Ralph S. Baric), and National Natural Science Foundation of China Award 81290341 (Zhengli Shi) et al. 2015-2016. These projects took place during a time when the work being performed was prohibited by the United States National Institutes of Health.

The public was clearly advised of the dangers being presented by NIAID-funded research by 2015 and 2016 when the Wuhan Institute of Virology material was being manipulated at UNC in Ralph Baric’s lab.

Jordan and Comer contended that the NIAID “funded gain-of-function research at the WIV and this research did not go through the proper oversight.” They told Fauci that “it is unclear why you would continue to testify otherwise.” They pointed to recently released emails to make their case.

Ralph Baric and his team @Baric_Lab – Researching #SARSCoV2, SARS-CoV, MERS-CoV, Dengue, Zika, and human norovirus at the University of North Carolina, Chapel Hill

The Republicans cited a Feb. 1, 2020, email from Fauci to the deputy director of the NIAID, Dr Hugh Auchincloss, which included an attached research article published in 2015 in Nature Medicine titled “A SARS-like cluster of circulating bat coronavirus shows potential for human emergence” that was “primarily authored” by Dr Ralph Baric of the University of North Carolina at Chapel Hill and Wuhan lab “bat lady” Dr Zhengli Shi, with the paper acknowledging the Key Laboratory of Special Pathogens and Biosafety at the Wuhan Institute of Virology.

Jordan and Comer noted that “the paper was funded by NIAID grant U19AI107810” and that both “Baric and Shi acknowledge this.”

Study: New Mutation Sped Up Spread of Coronavirus

“I have seen a horrible thing in the house of Israel; there is the whoredom of Ephraim, Israel is defiled” Hosea 6:10

COVID-19 TRAIL OF BLOOD!

•July 30, 2021 • Leave a Comment

“I have seen a horrible thing in the house of Israel; there is the whoredom of Ephraim, Israel is defiled” Hosea 6:10

There was a murder, and upon an initial investigation, there was a trail of blood . . . and they all lead to high places!

“A can of worms,” someone says, “better not to open such can.”

Dr David Martin, CEO of M-CAM International (risk management) has reviewed 4,000 Coronavirus patents. He appeared on Sitting #60 of the German Corona Committee on July 9 2021 to share his findings in a 90 minute discussion with lawyers.

Now Dr Martin is opening that can!

Dr David Martin – Spike Protein Patents Since 2002!

The gist of David Martin’s video was that wealthy philanthropists like Bill Gates, technology companies, pharmaceutical companies and global health organizations colluded to create a virus that would force governments to fund research and development of vaccines and therapies in order to enrich themselves.

Dr Peter Daszak of EcoHealth Alliance offered the following assessment [in March 2015]:

“Daszak reiterated that, until an infectious disease crisis is very real, present, and at an emergency threshold, it is often largely ignored. To sustain the funding base beyond the crisis, he said, we need to increase public understanding of the need for MCMs such as a pan-influenza or pan-coronavirus vaccine. A key driver is the media, and the economics follow the hype. We need to use that hype to our advantage to get to the real issues. Investors will respond if they see profit at the end of process.”

By doing so Dr Martin explains in detail the trails of blood related to SARS Cov2. It’s unbelievable and breathtaking to me, but please watch the video and decide for yourself.

This elitist crime information is a matter of PUBLIC RECORD and the information is of public interests. And please share around if you find it beneficial. Thanks.

EXCLUSIVE! Dr. David Martin Just Ended COVID, Fauci, DOJ, Politicians in ONE INTERVIEW.

By Stew Peters

FORT DETRICK – SOURCE of COVID-19?

“Ephraim shall be desolate in the day of rebuke; among the tribes of Israel have I made known that which shall surely be” Hosea 5:9

~~~~~

Below are smaller doses of the same video in which Dr David Martin explains in detail the patents related to SARS Cov2.

FORT DETRICK – SOURCE of COVID-19?

“Your country is desolate, your cities are burned with fire; your land, strangers devour it in your presence, and it is desolate, as overthrown by strangers” Isaiah 1:7.

Then said I, “LORD, how long?” And He answered, “Until the cities be wasted without inhabitant, and the houses without man, and the land be utterly desolate” Isaiah 6:11.

“In that day shall his strong cities be as a forsaken bough and an uppermost branch, which they left because of the children of Israel; and there shall be desolation” Isaiah 17:9.

Dr Fauci Should be Led Away in Handcuffs

•July 27, 2021 • Comments Off on Dr Fauci Should be Led Away in Handcuffs

Dr Fauci should have been led away in handcuffs long ago but he’s still there, holding the most important office. It shows how paralyzed and corrupt the System is, especially the Department of Justice. Already sedated? If so, by whom?

In 2014, the Obama administration imposed a moratorium on Gain of Function because it was seen as too risky on humanity, but this moratorium was overturned on December 19, 2017 by Dr Anthony Fauci who sees himself siting on a pedestal above the President.

SummitNews report: Fauci Declares Himself The Supreme Authority; “Attacking Me Is Attacking Science”

By Steve Watson / 10 June, 2021

As the scrutiny of Dr Fauci continues to increase following the release of his emails, it’s clear he’s feeling the strain. He declared, yet again, Wednesday that anyone attacking him should be seen as attacking science itself.

Fauci made the comments in part in response to Republicans in the House demanding he explain comments previously made that contradict sworn testimony that he gave to Congress.

During another softball interview on MSNBC, Fauci repeated his claim to being the supreme authority on the pandemic, suggesting that anyone who questions what he says is “painfully ridiculous”.

“If you are trying to get at me as a public health official and a scientist, you’re really attacking, not only Dr Anthony Fauci, you are attacking science,” Fauci proclaimed.

Fauci continued “Anybody that looks at what’s going on, clearly sees that. You have to be asleep not to see that. That is what’s going on. Science and the truth are being attacked.”

Many would argue that science and truth were attacked at the beginning of the pandemic when Fauci dismissed out of hand the notion of coronavirus leaking from the Wuhan Institute of Virology [[unless Fort Detrick is similarly investigated like WIV, WHO could never give an honest answer! More likely Fort Detrick is the nerve center of the original coronavirus/Covid-19 operation, with tentacles reaching out earlier to Barcelona in March 2019; France in December; and Italy in October 2019 and even in the United States itself in December 2019. The Latest: zero chance it leaked from WIV]] when leading virologists were telling him that the thing looked like it was engineered.

“It’s very dangerous, Chuck, because a lot of what you’re seeing as attacks on me quite frankly are attacks on science because all of the things that I have spoken about consistently from the very beginning have been fundamentally based on science.”

Science and truth was attacked when Fauci’s pal Peter Daszak, the Wuhan gain of function funder, the guy Fauci routed the money through, orchestrated a ‘bullying’ campaign and coerced top scientists into signing off on a letter to The Lancet aimed at removing blame for Covid-19 from the Wuhan lab he was funding with taxpayer dollars.

Fauci is repeating this ‘I am science’ talking point all over the place. Last week, again on MSNBC, he said basically the same thing.

A real scientist would point out that one should always beware anyone who says ‘the science is settled’ or criticises others for questioning science. That’s what science is, a series of questioning hypotheses.

And given Fauci’s record for flip flopping on what is and isn’t scientifically sound during this pandemic, and his shady involvement with funding the dangerous research in a lab where the virus magically appeared, he in particular should be the first to be questioned.

Dr Fauci should be led away in handcuffs

“The stranger that is within thee shall get up above thee very high, and thou shalt come down very low … He shall be the head, and thou shalt be the tail” Deuteronomy 28:43-44

Dr David Martin – Patents Review

•July 27, 2021 • 2 Comments

A “novel” coronavirus (nCoV) is supposed to be “a new strain” that has not been previously identified in humans, but Dr David Martin – Patents Review shows SARS-CoV-2 is no novel Virus – July 9 2021

In this video Dr David E. Martin explains in detail,the trails of blood related to SARS Cov2.

NOT SURE HOW YOU FEEL BUT A CHILL RUN THROUGH MY SPINE WHEN I WATCH THIS VIDEO!!!

Dr David Martin, CEO of M-CAM International (risk management) has reviewed 4,000 Coronavirus patents. He appeared on Sitting #60 of the German Corona Committee on July 9 2021 to share his findings in a 90 minute discussion with lawyers of the Ausschuss and Dr Wolfgang Wodarg, Germany’s most experienced lung doctor.

Ralph Baric at a University of North Carolina lab | Photo: Christopher Janaro | Bloomberg
RALPH S. BARIC, described as “a science-maniac”and Professor of epidemiology at the UNC-Chapel Hill, also “one who has made a lot of money” — shouldn’t the world honor him the title FATHER of COVID-19?

Dr Martin’s clear and verifiable conclusion is that there is nothing at all novel about the SARS-CoV-2 gene sequence used as a basis for the Covid vaccines. Further from a patent standpoint, there seems to be no way of knowing what exact sequence is being used in the vaccines and therefore what people are being injected with. Drs Martin & Fuellmich consider this situation to be a RICO (Racketeer Influenced and Corrupt Organizations Act) legal case.

Odysee.com

“I have seen a horrible thing in the house of Israel; there is the whoredom of Ephraim, Israel is defiled” Hosea 6:10

By Stew Peters

July 21, 2021

FORT DETRICK – SOURCE of COVID-19?

Then said I, “LORD, how long?” And He answered, “Until the cities be wasted without inhabitant, and the houses without man, and the land be utterly desolate” Isaiah 6:11.

China to NUKE Japan?

•July 23, 2021 • Leave a Comment

CHINA is threatening to NUKE revisionist Japan on the eve of the Olympics if it intervenes in conflict with Taiwan, it has been revealed in a new video.

According to the Congressional Research Service, neo-Imperialist Nippon Kaigi believes that “Japan should be applauded for liberating much of East Asia” during WW2, that the “Tokyo War Crimes tribunals were illegitimate,” and that the rape of Nanking was either “exaggerated or fabricated.” It denies the forced prostitution of Chinese and Korean “comfort women” by the Imperial Japanese Army, believes Japan should have an army again — something outlawed by Japan’s current constitution — and believes that it should return to worshipping the emperor.

In 2013, at a Nippon Kaigi party celebrating Shinzo Abe’s new appointments to his cabinet — 15 of whose 18 members were Nippon Kaigi-niks — the old imperial “Rising Sun” flag was flown, pledges to “break away from the postwar regime” were made, and the (very short and controversial) imperial national anthem was sung. 

In response to these revisionist statements, elements in the Chinese Republic said in the video that it would declare “full-scale war” against neo-Imperialist JAPAN if the Taiwan disagreement escalates, stoking World War Three fears.

Atomic Bomb Dropped on Hiroshima - HISTORY
Even after this atomic bomb explosion in Hiroshima (and another in Nagasaki), JAPAN doesn’t know or pretends not to know what they had done to CHINA (and KOREA).

The Sun / Jul 19 2021 / Jamie Seidel, Adriana Elgueta

It comes after earlier this month, China vowed to invade Taiwan and explained how it would do it.

An article in a state-controlled publication offered a glimpse of a terrifying three-stage plan to pave the way for an invasion force to storm the breakaway island.

President Xi Jinping pledged a “complete reunification” with Taiwan as he delivered a speech to mark 100 years of the Chinese Communist party.

Any invasion would represent a serious escalation of hostilities and could drag in the US through its pact to defend Taiwan.

The video threatened to nuke Japan if they intervened in the Taiwan conflicts

Delinquent of duty, General MacArthur had left today the Western Pacific an unfinished business to solve. See Japan’s Imperial Conspiracy by David Bergamini

Washington’s regional allies such as South Korea, revisionist Japan and Australia could also be sucked into a conflict as would Nato forces such as the UK because the US is a member of the alliance.

But a video channel, allegedly approved by the Chinese Communist Party with close ties to the People’s Liberation Army (PLA), took the anger to the next level.

In the new video now deleted, a narrator said: “We will use nuclear bombs first. We will use nuclear bombs continuously.

“We will do this until Japan declares unconditional surrender for the second time.”

SOS, Save Our Sea. Graphic: Xiong Xiaoying/GT
Gen MacArthur’s Unfinished Business after WWII: Now China says to Japan, “We will use nuclear bombs continuously.” Japan, the only country to experience nuclear attacks, may experience them again?

“When we liberate Taiwan, if Japan dares to intervene by force – even if it only deploys one soldier, one plane or one ship – we will not only return fire but also wage full-scale war against Japan itself.”

Delinquent of his duty to execute fair and equitable justice for the crimes JAPAN had committed, General MacArthur had left today the Western Pacific an unfinished business to solve. By allowing JAPAN’s criminals to roam free the UNITED STATES is deemed as an accomplice in its crimes. Under the English common law, an accomplice is a person who actively participates in the commission of a crime, even if they take no part in the actual criminal offense but by allowing JAPAN’s criminals free, (even bringing in their “germ data” from Harbin, CHINA for the foundation of FORT DETRICK’s biochemical weapon program), the UNITED STATES would be sharing JAPAN’s culpability.

“I have seen a horrible thing in the house of Israel; there is the whoredom of Ephraim, Israel is defiled” Hosea 6:10

And, today, many of those criminals have their Nippon Kaigi great grand children in the DIET, JAPAN’S Parliament, ruling over their country. Hence today, the Japanese has mastered the art of giving apology without any contrition. See more of these deceits and deceptions in Japan’s Imperial Conspiracy by David Bergamini. Your local library would have a copy screaming for attention to be read.

For Japan's Shinzo Abe, Unfinished Family Business - WSJ
Shinzo Abe recalls sitting on his grandfather’s lap as a young boy 55 years ago. ABE’s duty was to rebuild Japan’s military for JAPAN’s “Manchukuo: Asia’s Unfinished War.” ABE’s grandfather Nobusuke Kishi was nicknamed the “Monster of Manchuria,” and Prime Minister of JAPAN (1957-1960) under the nose of the UNITED STATES.

And there is a prophecy to the house of Israel, “a rebellious nation” (Ezekiel 3:5). This house of Israel refers to 10 tribes of Israel that separated from Judah and set up their own kingdom. They were besieged and taken into captivity in 721 BC. Ezekiel was writing more than a hundred years later with fellow captives at Telabib (Ezekiel 3:15), so the message could only meant for those of the Northern Kingdom – the modern Israelites today from Prophet Ezekiel:

Ezekiel: Prophecy as Performance Art | My Jewish Learning
Ezekiel’s Vision of God for the Endtime rebellious House of Israel

Chapter 5

“And thou, son of man, take thee a sharp knife, take thee a barber’s razor and cause it to pass over thine head and upon thy beard. Then take thee balances to weigh and divide the hair.

Thou shalt burn with fire a third part in the midst of the city, when the days of the siege are fulfilled; and thou shalt take a third part and smite about it with a knife, and a third part thou shalt scatter in the wind; and I will draw out a sword after them.

Thou shalt also take thereof a few in number, and bind them in thy skirts.

Then take of them again, and cast them into the midst of the fire, and burn them in the fire; for thereof shall a fire come forth into all the house of Israel.

“Thus saith the Lord God: This is Jerusalem. I have set it in the midst of the nations and countries that are round about her.

And she hath changed My judgments into wickedness more than the nations, and My statutes more than the countries that are round about her; for they have refused My judgments and My statutes. They have not walked in them.

Therefore thus saith the LORD God: Because ye multiplied more than the nations that are round about you, and have not walked in My statutes, neither have kept My judgments, neither have done according to the judgments of the nations that are round about you,

therefore thus saith the LORD God: Behold I, even I, am against thee, and will execute judgments in the midst of thee in the sight of the nations.

And I will do in thee that which I have not done, and the like of which I will not do any more, because of all thine abominations.

10 Therefore the fathers shall eat the sons in the midst of thee, and the sons shall eat their fathers; and I will execute judgments in thee, and the whole remnant of thee will I scatter into all the winds.

11 “Therefore as I live, saith the LORD God, surely because thou hast defiled My sanctuary with all thy detestable things and with all thine abominations, therefore will I also diminish thee; neither shall Mine eye spare, neither will I have any pity.

12 A third part of thee shall die with the pestilence, and with famine shall they be consumed in the midst of thee; and a third part shall fall by the sword round about thee; and I will scatter a third part into all the winds, and I will draw out a sword after them.

13 Thus shall Mine anger be accomplished, and I will cause My fury to rest upon them, and I will be comforted; and they shall know that I, the LORD, have spoken it in My zeal when I have accomplished My fury upon them.

14 “Moreover I will make thee a waste and a reproach among the nations that are round about thee, in the sight of all that pass by.

15 So it shall be a reproach and a taunt, an instruction and an astonishment unto the nations that are round about thee, when I shall execute judgments upon thee in anger and in fury and in furious rebukes. I, the LORD, have spoken it.

16 When I shall send upon them the evil arrows of famine which shall be for their destruction, and which I will send to destroy you, and I will increase the famine upon you, and will break your staff of bread,

17 so will I send upon you famine and evil beasts, and they shall bereave thee; and pestilence and blood shall pass through thee, and I will bring the sword upon thee. I, the LORD, have spoken it.”

Ezekiel 5:1-17

What Happened on 9 Av?

•July 20, 2021 • Leave a Comment

What Happened on 9 Av?

The Siege of Jerusalem, AD 70, by Flavius Josephus
The Fall of Jerusalem began with a Siege in AD 70, wrote Flavius Josephus

Tisha B’Av, the 9th day of the month of Av (July 17-18, 2021), is the saddest day on the Jewish calendar, on which pious or Orthodox Jews, deprive themselves and pray. It is the culmination of the Three Weeks, a period of time during which they mark the destruction of the Holy Temple in Jerusalem.

“Thus saith the LORD of hosts: ‘The fast of the fourth month, and the fast of the fifth, and the fast of the seventh, and the fast of the tenth, shall be to the house of Judah joy and gladness and cheerful feasts. Therefore love the truth and peace.’ Zechariah 8:19

So what happened on the 9th of Av?

1313 BCE: The spies returned from the Promised Land with frightening reports, and the Israelites balked at the prospect of entering the land. God decreed that they would therefore wander in the desert for 40 years.

The Israelites are in the desert, recently having experienced the miraculous Exodus, and are now poised to enter the Promised Land. But first they dispatch a reconnaissance mission to assist in formulating a prudent battle strategy. The spies return on the eighth day of Av and report that the land is unconquerable.

That night, the 9th of Av, the people cry. They insist that they’d rather go back to Egypt than be slaughtered by the Canaanites. God is highly displeased by this public demonstration of distrust in His power, and consequently that generation of Israelites never enters the Holy Land. Only their children have that privilege, after wandering in the desert for another 38 years.

The Fall of Jerusalem in 70 CE: A Story of Roman Revenge

Both Holy Temples in Jerusalem were destroyed on this date – the 9th day of Av. The First Temple was burned by the Babylonians in 423 BCE.

And in the fifth month, on the seventh day of the month [which is Av], which is the nineteenth year of King Nebuchadnezzar king of Babylon, came Nebuzaradan, captain of the guard, a servant of the king of Babylon, unto Jerusalem.

And [two days later] he burned the house of the LORD, and the king’s house, and all the houses of Jerusalem, and every great man’s house burned he with fire. II King 25:8-9

— Western records designate the year as 586 BCE when this First Temple was destroyed by Nebuchadnezzar, which is 163 years earlier than Jewish reckoning. But why such differences? The Jews have a continuous record, but English has no written records until around 400 CE. And even if the Roman Empire had a continuous record, it could bring us back another 500 years at most, but nothing to bring us to 586 BCE. Hence Western narratives and its dating system are, unfortunately, full of suspects.

In 66 CE the Jewish population rebelled against the Roman Empire. Four years later, on 4 August 70 CE (the 9th Day of Av), the Second Temple fell to the Romans unleashing a period of suffering from which the Jewish nation has never fully recovered.

Siege of Jerusalem | Facts & Summary | Britannica

According to an inscription on the Colosseum, Emperor Vespasian built the Colosseum with Jewish slaves and war spoils – many from the spoils of the Second Temple.

Surely deemed not worthy of survival, the apostate Sadducees, the Boethusians and the Essenes all vanished without coming through the Consuming Fires. 

The Sadducees and Boethusians, following the heretic Samaritan way of observing Passover, kept it on the night of the fourteenth. The Essenes, after they had repudiated the calendar that was sanctioned by the Sanhedrin, then went about presumptuously making one of their own. They all perished by either the flaming Sword or the consuming Fire.

These unpleasant endings should give those in the Church serious thoughts to a coincidence that all serious believer would find troubling. But, alas, His ten endtime virgins are all naked, wretched and far asleep, as if they had all been tranquilized by Satan.

Shall a trumpet be blown in the city, and the people not be afraid? Shall there be evil in a city, and the LORD hath not done it? Amos 3:6

The Pharisees and the Nazarenes escaped; the former to Yavneh, the later to Pella. 

The Unspoken Will of God

•July 17, 2021 • Leave a Comment

Wow, is there such a thing as the Unspoken Will of God?

Yes, there is!

Some of God’s oracles were written with God’s fingers. And they are the Ten Commandments.

Unspoken - theway church
What Are the Unspoken Word of God?

Others are scattered all over the Books of Moses. Much of these were collated and for the Mishnah that form the 613 mitzvot. Many of the mitzvot cannot be observed now, following the destruction of the Second Temple, although they still retain religious significance.

And the LORD delivered unto me two tablets of stone written with the finger of God, and on them was written according to all the words which the LORD spoke with you on the mount out of the midst of the fire in the day of the assembly. Deuteronomy 9:10

Others were written when God told Moses to write them down:

And the LORD said unto Moses, “Write thou these words, for according to the tenor of these words I have made a covenant with thee and with Israel.” Exodus 34:27

But surprisingly, there were the unspoken Word of God! Extra blessings await those who touches the heart of God; like parents, they have their secret wishes for their children. So is God. But how do we know God’s unspoken will if they were unspoken?

To be unspoken would also mean unwritten.

The answer is quite simple. Like parents they could be hinted at but not quite spoken of. So how could we understand the unspoken Word of God if there are any?

The answer lies in the Four fasts of Zechariah:

“Thus saith the LORD of hosts: ‘The fast of the fourth month, and the fast of the fifth, and the fast of the seventh, and the fast of the tenth, shall be to the house of Judah joy and gladness and cheerful feasts. Therefore love the truth and peace.’ Zechariah 8:19

The Scriptures do not give any details, but they are in the Oral Law:

Seventeenth of Tammuz (Shiva Asar B’Tammuz, minor fast) — the breaching of the walls of Jerusalem before the destruction of the Second Temple in 70 AD. – June 27, 2021 (July 16,17, 2022)

Ninth of Av (Tisha B’Av, full fast) — fall of Jerusalem on the same dates in 587 BC and 70 AD. – July 18, 2021 (August 6,7, 2022)

Third of Tishrei: Fast of Gedalia (Tzom Gedalia, minor fast) — assassination of Gedaliah, the righteous governor of Judah (II Kings 25:22–26). – Sept 9, 2021 (Sept 28, 2022)

Tenth of Tevet (Asara B’Tevet, minor fast) — the siege of Jerusalem by Nebuchadnezzar II of Babylon. – Dec 14, 2021 (January 3, 2023)

Journal Archives - Leon Davey 'Art'

But notice, today these fasts mainly by Jews — the “house of Judah” — will turn to be a joy and into “gladness and cheerful feasts.” How so, you may ask? God must have accepted their fasts prayers and those who participate in them would be duly rewarded. Those who fast will turn into joy! Extra blessings await those who touches the heart of God.

These four fasts are all related to Jerusalem, God’s beloved city with its Temple where God initially told Moses to build a sanctuary for Him to dwell. Thus, they needed to be done with the right attitude:

“Speak unto all the people of the land, and to the priests, saying, ‘When ye fasted and mourned in the fifth and seventh month even those seventy years, did ye fast at all unto Me, even to Me?” Zechariah 7:5

“When you held days of fasting every fifth and seventh month all these seventy years, were you doing it for me? And when you held feasts, was that for me?” MSG

The right attitude means to care about God, to think about his welbeing; for he asks: do you fast for me?

The final place for this sanctuary or Temple was and is to be in Jerusalem, and God wants to dwell with us.

At that time they shall call Jerusalem the Throne of the LORD and all the nations shall be gathered unto it, to the name of the LORD, to Jerusalem. Jeremiah 3:17

“Thus saith the LORD God: This is Jerusalem. I have set it in the midst of the nations and countries that are round about her. Ezekiel 5:5

And many nations shall come and say, “Come, and let us go up to the mountain of the LORD, and to the house of the God of Jacob. And He will teach us of His ways, and we will walk in His paths.” For the law shall go forth from Zion, and the word of the LORD from Jerusalem. Micah 4:2

Hedges: The Collapse of the American Empire

•July 15, 2021 • Leave a Comment

The American Empire will Collapse within a Decade, Two at Most.

Chris Hedges / April 19, 2021

U.S. leadership has stumbled from one military debacle to another, a trajectory mirroring the sad finales of other historical imperial powers.

America’s defeat in Afghanistan is one in a string of catastrophic military blunders that herald the death of the American empire.

With the exception of the first Gulf War, fought largely by mechanized units in the open desert that did not—wisely—attempt to occupy Iraq, the United States political and military leadership has stumbled from one military debacle to another. Korea. Vietnam. Lebanon. Afghanistan. Iraq. Syria. Libya.

The trajectory of military fiascos mirrors the sad finales of the Chinese, Ottoman, Hapsburg, Russian, French, British, Dutch, Portuguese and Soviet empires. While each of these empires decayed with their own peculiarities, they all exhibited patterns of dissolution that characterize the American experiment.

There is not a single case since 1941 when the coups, political assassinations, election fraud, black propaganda, blackmail, kidnapping, brutal counter-insurgency campaigns, U.S. sanctioned massacres, torture in global black sites, proxy wars or military interventions carried out by the United States resulted in the establishment of a democratic government. The two-decade-long wars in the Middle East, the greatest strategic blunder in American history, have only left in their wake one failed state after another. Yet, no one in the ruling class is held accountable.

War, when it is waged to serve utopian absurdities, such as implanting a client government in Baghdad that will flip the region, including Iran, into U.S. protectorates, or when, as in Afghanistan, there is no vision at all, descends into a quagmire. The massive allocation of money and resources to the U.S. military, which includes Biden’s request for $715 billion for the Defense Department in fiscal year 2022, a $11.3 billion, or 1.6 percent increase, over 2021, is not in the end about national defense. The bloated military budget is designed, as Seymour Melman explained in his book, “The Permanent War Economy,” primarily to keep the American economy from collapsing. All we really make anymore are weapons. Once this is understood, perpetual war makes sense, at least for those who profit from it.

Biden to Withdraw Combat Troops From Afghanistan by Sept. 11 - The New York  Times

The idea that America is a defender of democracy, liberty and human rights would come as a huge surprise to those who saw their democratically elected governments subverted and overthrown by the United States in Panama (1941), Syria (1949), Iran (1953), Guatemala (1954), Congo (1960), Brazil (1964), Chile (1973), Honduras (2009) and Egypt (2013). And this list does not include a host of other governments that, however despotic, as was the case in South Vietnam, Indonesia or Iraq, were viewed as inimical to American interests and destroyed, in each case making life for the inhabitants of these countries even more miserable.

“The two-decade-long wars in the Middle East, the greatest strategic blunder in American history, have only left in their wake one failed state after another. Yet, no one in the ruling class is held accountable” Chris Hedges.

I spent two decades on the outer reaches of empire as a foreign correspondent. The flowery rhetoric used to justify the subjugation of other nations so corporations can plunder natural resources and exploit cheap labor is solely for domestic consumption. The generals, intelligence operatives, diplomats, bankers and corporate executives that manage empire find this idealistic talk risible. They despise, with good reason, naïve liberals who call for “humanitarian intervention” and believe the ideals used to justify empire are real, that empire can be a force for good. These liberal interventionists, the useful idiots of imperialism, attempt to civilize a process that was created and designed to repress, intimidate, plunder and dominate.

Afghan Retreat: U.S. Formally Withdrawing from Its Longest War — Naharnet

The liberal interventionists, because they wrap themselves in high ideals, are responsible for numerous military and foreign policy debacles. The call by liberal interventionists such as Barack Obama, Hillary Clinton, Joe Biden, Susan Rice and Samantha Power to fund jihadists in Syria and depose Muammar Gaddafi in Libya rent these countries—as in Afghanistan and Iraq—into warring fiefdoms. The liberal interventionists are also the tip of the spear in the campaign to rachet up tensions with China and Russia.

Russia is blamed for interfering in the last two presidential elections on behalf of Donald Trump. Russia, whose economy is roughly the size of Italy’s, is also attacked for destabilizing the Ukraine, supporting Bashar al-Assad in Syria, funding France’s National Front party and hacking into German computers. Biden has imposed sanctions on Russia—including limits on buying newly issued sovereign debt—in response to allegations that Moscow was behind a hack on SolarWinds Corp. and worked to thwart his candidacy.

At the same time, the liberal interventionists are orchestrating a new cold war with China, justifying this cold war because the Chinese government is carrying out genocide against its Uyghur minority, repressing the pro-democracy movement in Hong Kong and stealing U.S. patents. As with Russia, sanctions have been imposed targeting the country’s ruling elite. The U.S. is also carrying out provocative military maneuvers along the Russian border and in the South China Sea.

As US troops prepare to pull out, a look at the war in Afghanistan by the  numbers - ABC News

The defeat in Afghanistan is a familiar and sad story, one all those blinded by imperial hubris endure. The tragedy, however, is not the collapse of the American empire, but that, lacking the ability to engage in self-critique and self-correction, as it dies it will lash out in a blind, inchoate fury at innocents at home and abroad.

MIT Predicted in 1972 That Society Will Collapse This Century. New Research Shows We’re on Schedule.

“I also will do this unto you: I will even appoint over you terror, consumption, and the burning ague that shall consume the eyes and cause sorrow of heart; and ye shall sow your seed in vain, for your enemies shall eat it. And I will set My face against you, and ye shall be slain before your enemies; they that hate you shall reign over you, and ye shall flee when none pursueth you.” Leviticus 26:16-17

What are the Oracles of God? (Part I)

•July 15, 2021 • Leave a Comment

What are the Oracles of God? (Part I)

What are the Oracles of God committed to the Jews? What are Oracles anyway?

Romans 3:1 What advantage then hath the Jew? Or what profit is there in circumcision?

2. Much in every way; chiefly because unto them were committed the oracles of God. 3. For what if some did not believe? Shall their unbelief make the faithfulness of God without effect? 4. God forbid! Yea, let God be true, but every man a liar. As it is written: “That Thou mightest be justified in Thy sayings, and mightest overcome when Thou art judged.”

So what are these Oracles committed to only one group of people on earth to manage?

The Oracles of God Committed unto the Jews – Purely Presbyterian
But what are the components of these Oracles?

The Oracles is designated by Strong to be G3051 logion of God

Strong’s Outline of Biblical Usage

  • a brief utterance, a divine oracle (doubtless because oracles were generally brief)
  • in the NT, the words or utterances of God
  • of the contents of the Mosaic law

There are four times in the New Testament this word oracles (logion G3051) of God are used:

Act 7:38 This is he, that was in the church in the wilderness with the angel which spake to him in the Mount Sinai, and with our fathers: who received the lively oracles (G3051) to give unto us:

Rom 3:2 Much every way: chiefly, because that unto them were committed the oracles (G3051) of God.

Heb 5:12 For when for the time ye ought to be teachers, ye have need that one teach you again which be the first principles of the oracles (G3051) of God; and become such as have need of milk, and not of strong meat.

1 Pe 4:11 If any man speak, let him speak as the oracles (G3051) of God; if any man minister, let him do it as of the ability which God giveth: that God in all things may be glorified through Jesus Christ, to whom be praise and dominion for ever and ever. Amen.

The Greek word Logion is related to Logos! The Greek phrase translated as “oracles of God” is logion Theos (logion G3051 being the plural form of logos).

In the New Testament, in John 1:1 In the beginning was the Word (G3056 logos), and the Word (logos) was with God, and the Word (logos) was God. Thus the term oracles of God could be translated as the “Words of God.” 

But sometimes the term oracles has been used by some Bible translators as are the messages or words of God. In Acts 7:38, Stephen speaks of how Moses received “living oracles to give to us” — a reference to the life-giving nature of God’s Word.

Romans 3:2 mentions the oracles of God: “To begin with, the Jews were entrusted with the oracles of God.” Paul highlights the fact that the Jews who received, copied, and preserved the Tanakh had been entrusted with the very Words of God.

In our twentieth-first century, the Scriptures or Bible has been delivered to us, all seems intact, but it’s not so simple. The Scriptures we have today have many components, all put together, some written, some not written. So what are the components of the Oracles (Words) of God?

No vowels in the original Hebrew Text that Moses wrote, only alphabets.

(1) The Hebrew alphabet. But unfortunately the original written Words of God couldn’t be understood without the “unwritten” Words of God – the written Words have no vowels! It was just the bones! 

(2) Only when the unwritten vowels were incorporated into the Texts could the Words of God be read and understood. The unwritten are the flesh. The bones and flesh constitute a whole. Like it or not, our standard Bible, like the King James, has already incorporated the unwritten words or the oral Words of God into the written Text. “In the beginning God created the heaven and the earth” has a combination of both the Written and Oral Words of God.

(3) The Words of God also include the case law that had been decided by the judges (or oral law)

Deuteronomy 16:18 “Judges and officers shalt thou make thee in all thy gates which the Lord thy God giveth thee, throughout thy tribes; and they shall judge the people with just judgment. 

19 Thou shalt not distort judgment; thou shalt not respect persons, neither take a bribe; for a bribe doth blind the eyes of the wise and pervert the words of the righteous.

Deuteronomy 17:11 According to the sentence of the law which they shall teach thee and according to the judgment which they shall tell thee, thou shalt do. Thou shalt not decline from the sentence which they shall show thee to the right hand nor to the left. 

12 And the man who will do presumptuously, and will not hearken unto the priest who standeth to minister there before the Lord thy God, or unto the judge, even that man shall die; and thou shalt put away the evil from Israel. 

13 And all the people shall hear, and fear, and do no more presumptuously.

The Set of Letters of the Hebrew alphabet | Hebrew alphabet, Hebrew,  Alphabet
Ezra changed the Paleo Scripts to Square ones but still no vowels. Vowels were added Millennium later in the 10th Century AD.

(4) The unspoken Word or the unspoken Will of God. These are for those who are willing and happy to go the extra mile, so what are they?

Four fasts – Zechariah 8:19 “Thus saith the Lord of hosts: ‘The fast of the fourth month, and the fast of the fifth, and the fast of the seventh, and the fast of the tenth, shall be to the house of Judah joy and gladness and cheerful feasts. Therefore love the truth and peace.’

The Scriptures do not give any details, but they are in the Oral Law:

Ninth of Av (Tisha B’Av, full fast) — fall of Jerusalem on the same dates in 587 BC and 70 AD. – July 18, 2021

Fast of Gedalia (Tzom Gedalia, minor fast) — assassination of Gedaliah, the righteous governor of Judah (II Kings 25:22–26). – Sept 9, 2021

Tenth of Tevet (Asara B’Tevet, minor fast) — the siege of Jerusalem by Nebuchadnezzar II of Babylon. – Dec 14, 2021

Seventeenth of Tammuz (Shiva Asar B’Tammuz, minor fast) — the breaching of the walls of Jerusalem before the destruction of the Second Temple in 70 AD. – June 27, 2021

But notice, these fasts by the “house of Judah” will turn to be a joy and into “gladness and cheerful feasts.” How so, you may ask? God must have accepted their prayers and fasts and will be duly rewarded. These four fasts are all related to Jerusalem, God’s beloved city.

Aleppo Codex | Hebrew Bible | Britannica
Aleppo Codex – the first Hebrew Text to be written with vowels in the 10th Century AD.

Zechariah 8:1 Again the word of the LORD of hosts came to me, saying,

2 Thus saith the LORD of hosts; I was jealous for Zion with great jealousy, and I was jealous for her with great fury.

3 Thus saith the LORD; I am returned unto Zion, and will dwell in the midst of Jerusalem: and Jerusalem shall be called a city of truth; and the mountain of the LORD of hosts the holy mountain.

(5) Out of the unwritten Word of God came also rules and regulations in determining the calendar. During the time of Christ, the Sanhedrin met in a building called the Hall of Hewn Stones near the Temple in Jerusalem. When the new month should start depends on the crescent new moon actually being seen by at least two witnesses. The word “this” (in this verse in Exodus 12:2, “This month shall be unto you”) implies something that is actually seen. These witnesses could be local or from the Diaspora who arrived in Jerusalem to testify. And the phrase “be unto you” means the calendar is being given to us the layman, and not for the layman each to determine the calendar for ourselves.

The rabbis of the Sanhedrin would question the witnesses in the sightings of the moon on their arrival. They knew what the proper responses to their questions ought to be, and were thus quickly able to identify fraudulent claims. Starting with the elder of each pair, they would ask: “Tell us how you saw the moon.”

On whether to declare a leap year on a given year, the Sanhedrin considered several factors in the course of their deliberations. The primary factor, which may or may not override other factors, was the spring equinox.

(a) If the spring equinox would fall later than the first half of Nissan (from the 16th onward), then the year could be declared a leap year. This is because Passover should be observed “in its appointed season” (Numbers 9:2-3). Again “in its appointed season” is defined by the Oral Law as in the spring.

(b) However, it wasn’t enough for Passover to fall after the equinox, when it was “officially” spring; spring-like conditions needed to be evidenced. If in the land of Israel, the barley had not yet ripened, and the trees were not yet blossoming with seasonal fruit — that, too, was sufficient reason to delay Nissan by adding a second month of Adar. Spring had to be felt; it had to be bright and green.

(c) There were also several non-season-related factors which the Sanhedrin considered. For example, if the roads or bridges were in disrepair due to the winter rainy season, impeding the ability of the pilgrims to travel to Jerusalem for Passover.

This was an advantage to the Jews because they have God’s Words. Of course, this advantage was not only applicable to those who believed the gospel, but even to those who don’t believe. Roman 3:4 – God forbid their advantage be disadvantaged even if they don’t believe; let God be true, but man a liar. — the Words of God, both written and unwritten; And Case Laws, are still committed to the Jews.

“In the beginning God created the heaven and the earth.” The above is a combination of both the written and oral Words of God.

And the man who will do presumptuously, and will not hearken unto the Sanhedrin who were and are designated to minister before the LORD thy God, even that man shall die.

Deuteronomy 17:12 And the man who will do presumptuously, and will not hearken unto the priest who standeth to minister there before the Lord thy God, or unto the judge, even that man shall die; and thou shalt put away the evil from Israel. 

13 And all the people shall hear, and fear, and do no more presumptuously.

It’s a death penalty “that man shall die” because mankind have been found guilty of being presumptuous or acting presumptuously by creating our own calendars.

What are the Oracles of God? (Part II)

Is there a Calendar Omen?

US’s Bio-experiment on fellow Americans?

•July 13, 2021 • Leave a Comment

IS FORT DETRICK A SOURCE of COVID-19?

During World War II, CAMP DETRICK became the site of intensive biological warfare research. But after the War, Gen MacArthur took Japan’s Unit 731 scientists home from Harbin, CHINA (including Shiro Ishii and many of his 3,607 associates); fed, nourished and gave them immunity; and FORT DETRICK (renamed after a 1956 expansion to 1,200 acres today) was where these Japanese criminals ended up; and where the US’s bio-weapon program got its foreign GERM and CHEMICAL research momentum and expansion.

JAPAN’S Shiro Ishii and his cohorts conducted live human vivisections and other biological experimentation in Harbin, CHINA, and after WWII were transferred to FORT DETRICK

Believe it or not, American’s Bio-experiment on fellow Americans?

OPERATION WHITECOAT

Operation Whitecoat was a biodefense medical research program carried out by the United States Army at Fort Detrick, Maryland between 1954 and 1973. The program pursued medical research using volunteer enlisted personnel who were eventually nicknamed “Whitecoats”.

These volunteers, all conscientious objectors, including many members of the Seventh-day Adventist Church, were informed of the purpose and goals of each project before providing consent to participate in any project. These “volunteers” were conscientious objectors — who volunteered to expose themselves to deadly viruses and bacteria, rather than go to war.

Japanese Forces Battle Of Shanghai

Over a 20-year period beginning in the 1950s, about 2,300 were infected at Fort Detrick with Q fever, yellow fever, Rift Valley fever, Hepatitis A, Yersinia pestis (Plague), Tularämie (Hasenpest) and other germ warfare experiments.

The justification of their research was to defend troops and civilians against biological weapons and it was believed that the Soviet Union was engaged in similar activities. Much of the actual tests were subjected to confidentiality and visitors are not allowed at Fort Detrick. This also applies to the former participants.

Although the program was discontinued in 1973, human use research for biodefense purposes is still conducted at the U.S. Army Medical Research Institute of Infectious Diseases (USAMRIID) at Fort Detrick and at other government and civilian research institutes. However, these post-Whitecoat studies are often human use challenge studies, in which a person is inoculated with a known pathogen to determine how effective an investigational treatment will be.

Second Sino-Japanese War Bombing

Says USAToday:

Operation Whitecoat tests were done under the cloud of the Cold War and at a time when people rarely scrutinized the workings of government. It was a time when the government conducted some dubious experiments, such as the infamous Tuskegee experiments in which scientists studied the progression of syphilis in untreated poor black men.

OPERATION BIG ITCH AND OPERATION DROP KICK

Operation Big Itch and Operation Drop Kick, the corps explored the feasibility of using fleas and mosquitoes as weapons. Declassified government documents apparently show tests were conducted, but with uninfected mosquitoes.

In 1956, the Corps conducted Operation Drop Kick when they released 600,000 uninfected mosquitoes from a plane at Avon Park Bombing Range, Florida. Within a day, the mosquitoes had spread a distance of between one and two miles and had bitten many people. The mosquitos were released across several Black communities in Florida. In the predominantly Black community of Avon Park, dozens of Black people became ill, and eight people died.

In 1958, further tests discovered at Avon Park AFB, Florida, mosquitoes could quickly be disseminated from helicopters, would spread more than a mile in each direction and would enter all types of buildings.”

A longtime Avon Park resident, Beatrice Peterson, didn’t know about mosquito releases but recalled that screwworm flies were released in the mid to late 1950s. She was only 14-years-old at the time.

“We know they released some flies, but what was the reason and why, I can’t remember why because we were in school back in the 1950s,” Peterson said. “Occasionally we would see them when they fly over and drop the little boxes out. Evidently the boxes were supposed to open up.”

A similar operation took place over Georgia, “Operation Big Buzz.” The experiment occurred in May 1955 in the U.S. State of Georgia. The operation was a field test designed to determine the feasibility of producing, storing, loading into munitions, and dispersing from aircraft the yellow fever mosquito (though these were not infected for the test).

Victims Along Qinhuai River

The second goal of the operation was to determine whether the mosquitoes would survive their dispersion and seek meals on the ground. When the mosquitoes were collected and it was determined that they were actively feeding on the blood of humans.

Operation Big Itch was a September 1954 series of tests at Dugway Proving Ground in Utah. The tests were designed to determine coverage patterns and survivability of the tropical rat flea (Xenopsylla cheopis) for use in biological warfare as a disease vector. The fleas were loaded into two types of munitions and dropped from the air.

The E14 bomb and E23 bomb, which could be clustered into the E86 cluster bomb and E77 bomb, respectively. When the cluster bombs reached 2,000 or 1,000 feet the bomblets would drop via parachute, disseminating their vector. Big Itch proved successful, and the tests showed that not only could the fleas survive the fall from an airplane but they also soon attached themselves to hosts.

JAPAN’S Unit 731 Site, R&D Experimental Camp, Harbin, CHINA

Are any of these experiments not having their origins at FORT DETRICK? Yes, they are:

And this is from Wikipedia:

Jeffrey Alan Lockwood wrote in 2009 that the biological warfare program at Ft. Detrick began to research the use of insects as disease vectors going back to World War II and also employed German and Japanese scientists after the war who had experimented on human subjects among POWs and concentration camp inmates.

Scientists used or attempted to use a wide variety of insects in their biowar plans, including fleas, ticks, ants, lice and mosquitoes – especially mosquitoes that carried the yellow fever virus. They also tested these in the United States.

Lockwood thinks that it is very likely that the U.S. did use insects dropped from aircraft during the Korean War to spread diseases, and that the Chinese and North Koreans were not simply engaged in a propaganda campaign when they made these allegations, since the Joint Chiefs of Staff and Secretary of Defense had approved their use in the fall of 1950 at the “earliest practicable time”. At that time, it had five biowarfare agents ready for use, three of which were spread by insect vectors.

Japanese experiment unit 731 images

See also in Wikipedia:

Wikipedia:

Entomological testing on fellow Americans
Further information: U.S. Cold War entomological warfare program

The United States seriously researched the potential of entomological warfare (EW) during the Cold War. EW is a specific type of biological warfare which aims to use insects as weapons, either directly or through their potential to act as vectors. During the 1950s the United States conducted a series of field tests using entomological weapons.

Bodies On The Stairs

Operation Big Itch [in Utah], in 1954, was designed to test munitions loaded with uninfected fleas (Xenopsylla cheopis).

In May 1955 over 300,000 yellow fever mosquitoes (Aedes aegypti) were dropped over parts of the U.S. state of Georgia to determine if the air-dropped mosquitoes could survive to take meals from humans. The mosquito tests were known as Operation Big Buzz.

The U.S. engaged in at least two other EW testing programs, Operation Drop Kick and Operation May Day. A 1981 Army report outlined these tests as well as multiple cost-associated issues that occurred with EW.

Japanese experiment unit 731 images

In civilian venues
Medical experiments were conducted on a large scale on civilians who had not consented to participate. Often, these experiments took place in urban areas in order to test dispersion methods.

Questions were raised about detrimental health effects after experiments in San Francisco, California, were followed by a spike in hospital visits; however, in 1977 the Centers for Disease Control and Prevention determined that there was no association between the testing and the occurrence of pneumonia or influenza. The San Francisco test involved a U.S. Navy ship that sprayed Serratia marcescens from the bay; it traveled more than 30 miles.

One dispersion test involved laboratory personnel disguised as passengers spraying harmless bacteria in Washington National Airport.

Children At Unit 731

“Scientists” tested biological pathogens, including Bacillus globigii, which were thought to be harmless, at public places such as subways. Light bulbs containing Bacillus globigii were dropped in New York City’s subway system; the result was strong enough to affect people prone to illness (also known as Subway Experiment). Based on the circulation measurements, thousands of people would have been killed if a dangerous microbe was released in the same manner. The Chicago subway system was also subject to a similar experiment by the Army.

A jet aircraft released material over Victoria, Texas, that was monitored in the Florida Keys.

Much information about these programs remained classified and kept secret. How many of these experiments were initiated from FORT DETRICK and its 7,900 researchers? Why was FORT DETRICK closed from July 2019 to November 29, 2019? Why did this closure of FORT DETRICK coincide with the timeline of “vaping illness,” the pandemic flu and COVID-19? And why does this mysterious EVALI disease look exactly like COVID-19, and even accurately matches its epidemic footprint?

Who is Fantahun Woldesenbet? Active shooter in Frederick, Maryland
FORT DETRICK / UNIT 731 Transplant / USAMRIID with 7,900 Researchers / 1,200 ACRES

Could the following narrative be possible?

1) Fort Detrick was shut down after a cease and desist order to the organisation in July, 2019 due to multiple violations of procedure.
2) An outbreak of ‘influenza’ killed something like 10,000 people in the US in August 2019.
3) In October 2019 there was a US organised event ‘Event 201 – A Global Pandemic Exercise’ which simulated a very similar scenario to the actual pandemic.
4) From October 18 – 27, the 2019 Military World Games was held in Wuhan. Could the SARS-Cov-2 virus be released while the US Army team were there?

Wikipedia:

From 1950 through 1953, the U.S. Army conducted Operation LAC (Large Area Coverage), spraying chemicals over six cities in the United States and Canada, in order to test dispersal patterns of chemical weapons. Army records stated that the chemicals which were sprayed on the city of Winnipeg, Manitoba, Canada, included zinc cadmium sulfide, which was not thought to be harmful.A 1997 study by the U.S. National Research Council found that it was sprayed at levels so low as not to be harmful; it said that people were normally exposed to higher levels in urban environments.

For more about Time reported high cancer rate, Agent Orange and anthrax, weaponized botulism and radioactive carbon here. John Hopkins Public Health news here. Baltimore Sun here. For those living near Fort Detrick and are affected by sickness, diseases, cancer or any other illness, please check here.

“Therefore as I live, saith the LORD God, surely because thou hast defiled My sanctuary with all thy detestable things and with all thine abominations, therefore will I also diminish thee; neither shall Mine eye spare, neither will I have any pity.

“A third part of thee shall die with the pestilence, and with famine shall they be consumed in the midst of thee; and a third part shall fall by the sword round about thee; and I will scatter a third part into all the winds, and I will draw out a sword after them.” Ezekiel 5:11-12

Aso: Japan will defend Taiwan

•July 11, 2021 • Leave a Comment

FORT DETRICK – SOURCE of COVID-19?

During World War II, Fort Detrick became the site of intensive biological warfare research. But after the War, Gen MacArthur took Japan’s Unit 731 scientists home (including Shiro Ishii and 3,607 of his associates) and gave them immunity; and Fort Detrick was where these Japanese scientists ended up; and where the US’s bio-weapon program got its foreign GERM research momentum and expansion.

Japan would have to defend Taiwan together with the US in the event of a major problem, Kyodo News reported on July 06, 2021 Japanese Deputy Prime Minister Taro Aso as saying, marking some of the highest-level remarks from Tokyo on a hot subject.

In comments at a political fundraising party in Tokyo on Monday, Aso said an invasion of Taiwan by China could be seen as an existential threat, allowing Japan to exercise the right to collective self-defense.

JAPAN’s Imperial Army, Creator of Unit 731 bio-warfare program in Harbin, CHINA, whose data were later transferred to Fort Detrick, USA

The reason why Japan keeps hyping up the so-called external threats is obvious: it needs to constantly exaggerate the situation so it can turn these into public opinion to support revising its pacifist constitution. And to increase its military budget!

China, on the other hand, said Aso’s comments were “extremely wrong and dangerous.”

Chinese Ministry of Foreign Affairs spokesman Zhao Lijian told a regular news conference in Beijing that “we will never allow any country in any way to interfere in the Taiwan question, and nobody should underestimate the Chinese people’s strong determination, will and ability to safeguard national sovereignty.”

And earlier, Chinese President Xi Jinping had pledged to complete “reunification” with Taiwan and vowed to “smash” any attempts at formal independence.

“Resolving the Taiwan question and realizing China’s complete reunification is a historic mission and an unshakable commitment of the CPC,” Xi said with an eye for an October 1, 2049 celebration. “Anyone who would attempt to do so will find themselves on a collision course with a great wall of steel forged by over 1.4 billion Chinese people.”

Why Japan is ‘digging own grave’ by offering to defend Taiwan from China: Also Japan past Atrocities by British vlogger Alexander Mercouris for his insightful presentation:

And I will destroy your high places, and cut down your images, and cast your carcasses upon the carcasses of your idols; and My soul shall abhor you.

And I will make your cities waste and bring your sanctuaries unto desolation, and I will not smell the savor of your sweet odors.

And I will bring the land into desolation, and your enemies who dwell therein shall be astonished at it. And I will scatter you among the heathen, and will draw out a sword after you; and your land shall be desolate and your cities waste. Leviticus 26:30-33

The Coming War on China

•July 10, 2021 • Leave a Comment

The Coming War on China – A True Documentary

The Coming War on China, from award winning journalist John Pilger, reveals what the news doesn’t – that the world’s greatest military power, the United States, and the world’s second economic power, China, both nuclear-armed, may well be on the road to war.

Marshall Islanders being Betrayed with Unclear Fallout, Radiation (cancer, miscarriages, deformities, thyroid disorders, leukemia) and Death.

Nuclear war is not only imaginable, but planned. The greatest build-up of NATO military forces since the Second World War is under way on the western borders of Russia. On the other side of the world, the rise of China is viewed in Washington as a threat to American dominance.

To counter this, President Obama announced a ‘pivot to Asia’, which meant that almost two-thirds of all US naval forces would be transferred to Asia and the Pacific, their weapons aimed at China. A policy which has been taken up by his successor Donald Trump, who during his election campaign said “We can’t continue to allow China to rape our country and that’s what they’re doing”.

Filmed on five possible front-lines across Asia and the Pacific over two years, the story is told in chapters that connect a secret and ‘forgotten’ past to the rapacious actions of great power today and to a resistance, of which little is known in the West.

This is also the US’s use and experimentation of weapons of mass destruction, about bio and chemical weapon experiments all along the islands of the South Pacific, about how these islanders were burned, and how they died.

Credit to John Pilger for his brave journalism.

“Woe to the crown of pride, to the drunkards of Ephraim, whose glorious beauty is a fading flower, which is on the head of the fat valleys of them that are overcome with wine!” Isaiah 28:1

“And it shall come to pass that as the Lord rejoice over you to do you good and to multiply you, so the LORD will rejoice over you to destroy you and to bring you to nought; and ye shall be plucked from off the land whither thou goest to possess it.” Deuteronomy 28:63

US’s Biowarfare in Cuba?

•July 9, 2021 • Leave a Comment

FORT DETRICK – SOURCE of COVID-19?

During World War II, Fort Detrick became the site of intensive biological warfare research using various pathogens. But after the War, the U.S. government under Gen MacArthur, Supreme Commander of the Allied Forces, gave immunity and took Japan’s Unit 731 scientists home (including Shiro Ishii and 3,607 of his associates); and this is how Fort Derrick was where many of the Japanese scientists ended up; and where the U.S.’s bio-weapon program got its foreign momentum, expanded and its effects worldwide.

Shirō Ishii - Alchetron, The Free Social Encyclopedia
JAPAN’S General Shiro Ishii with his cohorts administrated and conducted live human vivisections and other biological experimentation in Harbin, CHINA

So, is there any U.S.’s biowarfare in Cuba?

JFK Files Reveal US Biological Warfare Plans Against Cuba

In the summer of 1975, congressional staffer Loch Johnson was searching through classified papers at the LBJ Library in Austin, Texas, when he came across something he couldn’t believe — a covert plan by the US military to deploy biological weapons against Cuba.

The American public knew that their government had a tense relationship with Cuba, especially with its feisty leader, Fidel Castro. The US had unsuccessfully underwritten a Cuban-exile paramilitary invasion at the Bay of Pigs in 1961 — a disaster in every sense. And just a year later, the world came to the brink of nuclear apocalypse after a showdown with the Soviet Union over nuclear missiles it had placed in Cuba.

Johnson relayed to his superiors at the Church Committee the details of project SQUARE DANCE:

The proposal envisioned the destruction of the Cuban economy by introducing aerially from off-shore a sugar cane plant parasite called Bunga. The program would begin with a 30 percent reduction of anticipated Cuban sugar production and within three-to-six years the ruination of the sugar industry would be achieved.

Weapon of mass destruction - Wikipedia
U.S.’s Bio-Weapon Program Worldwide and even against the U.S.?

But that wasn’t all. Johnson quoted directly from the JCS memo:

The economic and political disturbances caused by this attack could be exacerbated and exploited by such measures as spreading hoof-and-mouth disease among draft animals, controlling rainfall by cloud seeding, mining canefields, burning cane, and directing other acts of conventional sabotage against the cane milling and transportation systems.

Hoof-and-mouth disease (sometimes referred to as foot-and-mouth disease) is highly infectious and affects farm animals such as cattle, sheep, goats, and pigs. The disease causes high fevers followed by blisters in the animal’s mouth and feet. While very rarely affecting humans, it can bring devastating economic consequences to farmers. Containing a 2001 outbreak in the UK cost some £8bn ($12bn) in public and private outlays.

The longest-serving non-royal head of state in the 20th and 21st centuries, Castro secured Cuba’s independence and became a thorn to US hegemony.

A JFK document released last year revealed an intelligence memorandum from 1962 discussing the possibility of using biological agents to induce crop failure “which would appear to be of natural origin.” A US Army memo from 1963, recently released by the National Archives, lists a number of “Ideas to Exploit Cuban Vulnerabilities,” including the initiation of “biological warfare against vegetable and animal tissue (except human).”

The October 30,1964, memo, referenced in Johnson’s book National Security Intelligence but digitally released last month by the National Archives, gives us a clearer picture of what that might have looked like.

“Bunga,” known also as Aeginetia Indica, is a flowering weed that acts as a root parasite to nearby plants. It can be particularly harmful to sugarcane crops, which were Cuba’s primary economic output. US intelligence sabotage efforts had long targeted sugar crops, including night raids from offshore boats planting incendiary devices in fields. But this was something different.

Like the earlier memo from 1962, this one mentions the need for deniability: “It appears feasible to introduce gradually Bunga into Cuba and maintain a basis for plausibly disavowing US involvement.”

JFK Files Reveal US Biological Warfare Plans Against Cuba - WhoWhatWhy
JFK Files Reveal US Biological Warfare Plans Against Cuba

Biowarfare over Cuban skies

Wikipedia:

It has been rumored that the U.S. employed biological weapons against the Communist island nation of Cuba. Noam Chomsky claimed that evidence exists implicating the U.S. in biological warfare in Cuba, but these claims are disputed. Allegations in 1962 held that CIA operatives had contaminated a shipment of sugar while it was in storage in Cuba.

Also in 1962, a Canadian agricultural technician assisting the Cuban government claimed he was paid $5,000 to infect Cuban turkeys with the deadly Newcastle disease. Though the technician later claimed he had just pocketed the money, many Cubans and some US citizens believed a clandestinely administered biological weapons agent was responsible for a subsequent outbreak of the disease in Cuban turkeys.

In 1971 the first serious outbreak of African Swine Fever in the Western Hemisphere occurred in Cuba. The Cuban government alleged that U.S. covert biological warfare was responsible for this outbreak, which led to the preemptive slaughter of 500,000 pigs. The outbreak was labeled the “most alarming event” of 1971 by the United Nations Food and Agricultural Organization.

Six years after the event, the newspaper Newsday, citing untraceable sources, claimed that anti-Castro saboteurs, with at least the tacit backing of U.S. Central Intelligence Agency officials, introduced African swine fever virus into Cuba six weeks before the outbreak in 1971, to destabilize the Cuban economy and encourage domestic opposition to Fidel Castro. The virus was allegedly delivered to the operatives from an army base in the Panama Canal Zone by an unnamed U.S. intelligence source. Evidence linking these incidents to biological warfare has not been confirmed.

Accusations have continued to come out of Havana charging U.S. use of bio-weapons on the island, after the official end of the US biological weapons program in 1973. The Cuban government blamed the U.S. for a 1981 outbreak of dengue fever that sickened more than 300,000. Dengue, a vector-borne disease usually carried by mosquitoes, killed 158 people that year in Cuba, including 101 children under 15. Tensions between the two countries, coupled with confirmed U.S. research into entomological warfare during the 1950s, made these charges seem not implausible to some people.

For behold, the LORD will come with fire, and with His chariots like a whirlwind, to render His anger with fury and His rebuke with flames of fire. For by fire and by His sword will the LORD plead with all flesh; and the slain of the Lord shall be many. Isaiah 66:15

US’s Biowarfare in Vietnam?

•July 9, 2021 • Leave a Comment

FORT DETRICK – SOURCE of COVID-19?

During World War II, Fort Detrick became the site of intensive biological warfare research. But after the War, Gen MacArthur took Japan’s Unit 731 scientists home (including Shiro Ishii and 3,607 of his associates) and gave them immunity; and Fort Detrick was where these Japanese scientists ended up; and where the US’s bio-weapon program got its foreign GERM research momentum and expansion.

Agent Orange Wasn’t the Only Deadly Chemical Used In Vietnam / Erin Blakemore / Aug 29, 2018

While Agent Orange may be the most well-known chemical used during the Vietnam War, it wasn’t the only one. An entire rainbow of new chemical formulations rained down on Vietnam’s forests and fields. The Rainbow Herbicides, as they were known, were only used as weapons in the war for a little over a decade, but their consequences can still be felt today.

“I remember the sight and the smell of the spray,” recalls Thomas Pilsch, who served as a forward air controller in South Vietnam in 1968 and 1969. In the early morning low angle sunlight, it appeared to have an orange hue.” By spraying Agent Orange, he thought he was helping the United States military bust through Vietnam’s impenetrable jungles on the way to victory.

US plane spraying Vietnam landscape with tainted herbicide/defoliant Agent Orange during the war. (Credit: Dick Swanson/The LIFE Images Collection/Getty Images)
US plane spraying Vietnam landscape with tainted herbicide/defoliant Agent Orange

The U.S. had a rainbow of chemicals at their disposal. They were nicknamed according to the color on the barrels in which they were shipped. (Agent Orange didn’t appear orange, though it looked like that to Pilsch.) Once Operation Ranch Hand began, around 20 million gallons of Agents Green, Pink, Purple, Blue, White, Orange, Orange II, Orange III, and Super Orange were sprayed over South Vietnam. The chemicals were produced by companies like DOW Chemical, Monsanto, and Hercules, Inc.

“Trail dust” operations were conducted by the U.S. Air Force, whose “cowboys” flew C-123s escorted by fighters. As they approached a strategic target—dense, jungled areas that provided cover for the Viet Cong or crops suspected to feed their troops—the fighter jets would shoot down bombs and napalm. Then the sprayers would move in and douse an area with the chemical.

American soldiers were told the chemicals were safe. They were also effective. “We just blew away that jungle,” recalled Tom Essler, a U.S. Marine who served in Vietnam between 1967 and 1968, in an oral history. “Between the B-52 strikes and Agent Orange, that lovely lush jungle around Khe Sanh was turned brown.”

As the jungle died, so did crops. Famine, malnourishment and starvation set in. By the end of the war, over 3.6 million acres had been sprayed with Rainbow Herbicides.

So had millions of Vietnamese people. American soldiers had also been exposed to the herbicides, reassured by their superiors that they presented no risk.

Not true: Sixty-five percent of the United States’ rainbow of chemicals contained dioxins—known carcinogens. Dioxins enter the bloodstream after being eaten or touched, build up in the food chain and can cause reproductive problems, cancer, hormonal interference, immune system damage, and developmental issues.

Year-old conjoined twins being cared for at Hanoi's Viet-Duc hospital, a center for treating deformed children and others who may have been affected by exposure to the defoliant Agent Orange. (Credit: Gary Mangkorn/AP/REX/Shutterstock)
Conjoined twins affected by the defoliant Agent Orange being cared for at Hanoi’s Viet-Duc hospital

Wikipedia:

Contaminated soils, permanent forest loss, soil erosion, and other environmental damage have haunted Vietnam for years. Children of veterans and Vietnamese people exposed to the chemicals were born with serious birth defects and illnesses.

In the 1960s, the U.S. changed its main approach from biological agents aimed to kill to those that would incapacitate. In 1964, research programs studied Enterotoxin type B, which can cause food poisoning. New research initiatives also included prophylaxis, the preventive treatment of diseases. Pathogens studied included the biological agents causing a myriad of diseases such as anthrax, glanders, brucellosis, melioidosis, Venezuelan equine encephalitis, Q fever, coccidioidomycosis, and other plant and animal pathogens.

The Vietnam War brought public awareness to the U.S. biological weapons program. Jeanne Guillemin, wife of biologist Matthew Meselson, summarized the controversy:

The entire experimental legacy is dismaying, from the hundreds of dead monkeys at Fort Detrick to the spectacle of Seventh Day Adventist soldiers, the vaccinated volunteers in Project Whitecoat, strapped to chairs amid cages of animals in the Utah sunlight as Q fever aerosols are blown over them. Most chilling are the mock scenarios played out in urban areas: light bulbs filled with simulated BW agents being dropped in New York subways, men in Washington National Airport spraying pseudo-BW from briefcases, and similar tests in California and Texas and over the Florida Keys.

The Nixon administration felt an urgent need to respond to the growing negative perception of biological weapons. The realization that biological weapons may become the poor man’s atom bomb also contributed to the end of the U.S. biological weapons program. Subsequently, President Nixon announced that the U.S. was unilaterally renouncing its biological warfare program, ultimately signing the Biological and Toxin Weapons Convention in 1972.

President Nixon said at Fort Detrick on November 25, 1969: “The United States shall renounce the use of lethal biological agents and weapons, and all other methods of biological warfare.”

President Richard M. Nixon issued his “Statement on Chemical and Biological Defense Policies and Programs” on November 25, 1969 in a speech from Fort Detrick. The statement ended, unconditionally, all U.S. offensive biological weapons programs. Nixon noted that biological weapons were unreliable and stated:

“The United States shall renounce the use of lethal biological agents and weapons, and all other methods of biological warfare. The United States will confine its biological research to defensive measures such as immunization and safety measures.” President Richard M. Nixon

“Shall a trumpet be blown in the city, and the people not be afraid? Shall there be evil in a city, and the LORD hath not done it?” Amos 3:6

“Slay utterly old and young, both maids and little children and women; . . . and begin at My sanctuary.” Ezekiel 9:6

US’s Biowarfare in Korea?

•July 8, 2021 • Leave a Comment

FORT DETRICK – SOURCE of COVID-19?

INSURGE’s REVEALED: The long-suppressed official report on US biowarfare in North Korea

Excerpts from Medium by Jeffrey Kaye / Feb 21, 2018

Written largely by the most prestigious British scientist of his day, this official report, containing hundreds of pages of evidence about the use of US biological weapons during the Korean War, was effectively suppressed upon its original release in 1952.

Unit 731 - Complex.jpg
WORLD WAR II Japan’s hidden Unit 731 Germ Complex in Harbin, CHINA

Back in the early 1950s, the U.S. conducted a furious bombing campaign during the Korean War, dropping hundreds of thousands of tons of ordnance, much of it napalm, on North Korea. The bombardment, worse than any country had received up to that point, excepting the effects of Hiroshima and Nagasaki, wiped out nearly every city in North Korea, contributing to well over a million civilian deaths. Because of the relentless bombing, the people were reduced to living in tunnels. Even the normally bellicose Gen. MacArthur claimed to find the devastation wreaked by the U.S. to be sickening.

WMD world map.svg
U.S.’s Weapons of Mass Destruction – Napalm, anthrax, plague, and cholera in KOREA

The report concluded that the U.S. had used a number of biological weapons, including use of anthrax, plague, and cholera, disseminated by over a dozen of different devices or methods, including spraying, porcelain bombs, self-destroying paper containers with a paper parachute, and leaflet bombs, among others.

Napalm is a gel that burns at temperatures of 800-1,200 degrees C (1,500-2,200 degrees F).

When napalm falls on people, the gel sticks to their skin, hair, and clothing, causing unimaginable pain, severe burns, unconsciousness, asphyxiation, and often death. Even those who do not get hit directly with napalm can die from its effects since it burns at such high temperatures that it can create firestorms that use up much of the oxygen in the air. Bystanders also can suffer heatstroke, smoke exposure, and carbon monoxide poisoning.

Censorship of Unit 731-U.S. Collaboration on Biological Warfare Data

One important part of the ISC report guaranteed its suppression in the United States after its initial publication. The report discussed the activities of Imperial Japan’s biological warfare detachment, Unit 731, and the U.S. interest in its activities.

Back in 1952, collaboration between the U.S. and Japanese war criminals using biological weapons was top secret, and totally denied by the U.S.

But today, even U.S. historians accept that a deal was made between the U.S. and members of Unit 731 and associated portions of the Japanese military that had in fact been experimenting on the use of biological weapons since the mid-1930s, experimentation that included use of human vivisection and barbaric torture of thousands of human beings, most of whom were disposed of in crematoria. In addition, as described in the book chapter by Bernd Martin noted in the bibliography, there was collaboration between the Japanese and the Nazi regime on these issues.

The U.S. collaboration with Japanese war criminals of Unit 731 was formally admitted in 1999 by the U.S. government, though the documentation for this confession wasn’t published until nearly 20 years later.

It is a matter of historical record now that the U.S. government granted amnesty to Japan’s chief at Unit 731, doctor/General Shiro Ishii and his accomplices. The amnesty was kept top secret for decades, until revealed by journalist John Powell in a landmark article for the Bulletin of Atomic Scientists in October 1981.

[A]t least one scientist working at Ft. Detrick at the time admitted to German documentary investigators before he died that the U.S. had indeed been involved in germ warfare in Korea.

“I have seen a horrible thing in the house of Israel; there is the whoredom of Ephraim, Israel is defiled” Hosea 6:10

“Ephraim shall be desolate in the day of rebuke” Hosea 5:9

The Jews Shall Mourn

•July 7, 2021 • Leave a Comment

The Jews shall mourn for Him as one mourneth for his only son — Zechariah 12:10

Isaiah 53 – KJ21

This chapter of Isaiah shows a prophecy foretelling how a suffering servant will have to suffer and ultimately die for the sins and iniquities of many not his own. And upon his triumphant return, he would be given the glory to rule the world with the saints around him. The Orthodox Jews, after realizing how unfairly they had treated him, will be shocked and speechless.

The Ministry of the Suffering Servant – Warren Community Fellowship

Isaiah 53:1 Who hath believed our report? And to whom is the arm of the Lord revealed? — the Jews had the message made available to them first. ‘He came unto his own, but his own received him not.’ Although some did! The 3000 in Acts 2:41, etc.

2 For He shall grow up before Him as a tender plant, and as a root out of a dry ground. He hath no form nor comeliness, and when we shall see Him, there is no beauty that we should desire Him. Zechariah 12:10 He springs out of the earth without notice; low in its beginning, slow in its growth, liable to be crushed with the foot, or destroyed with the frost, and no great probability of its coming to any perfection; very ordinary. In fact, of dry ground, that is, of the land of Galilee, away from the land of Jerusalem and Judea, where the headquarter and their scholars are usually located. His parents were poor, they could only afford two turtle doves or two young pigeons as offerings, but the proper offering was a lamb for a burnt offering, and a pigeon or dove for a sin offering; but for the poor an alternative was allowed – instead of the more costly present of a lamb, a second pigeon or dove might be brought. The poverty of Mary and Joseph is shown in this offering. They would never have put the sanctuary off with the humbler had the richer gift been in their power. Luke 2:24

Leviticus 12:6 “‘And when the days of her (the mother) purifying are fulfilled, for a son or for a daughter, she shall bring a lamb of the first year for a burnt offering, and a young pigeon or a turtledove for a sin offering, unto the door of the tabernacle of the congregation unto the priest.
8 And if she be not able to bring a lamb, then she shall bring two turtledoves or two young pigeons, the one for the burnt offering and the other for a sin offering, and the priest shall make an atonement for her, and she shall be clean.’”

Jewish art by Hand Painted | Oil Painting Reproduction 28399

3 He is despised and rejected of men, a Man of sorrows, and acquainted with grief. And we hid as it were our faces from Him; He was despised, and we esteemed Him not. — his life was a series of sorrow, from the cradle to the cross; in his infancy his life was sought for by Herod, and he was obliged to be taken by his parents, and flee into Egypt; he ate his bread in sorrow, and with the sweat of his brow; he met with much sorrow from the hardness and unbelief of men’s hearts, and from the contradiction of sinners against himself, and sometimes from the doubts of his own disciples; from the temptations of Satan, and was exceeding sorrowful in the garden, when his sweat was as it were great drops of blood; and when on the cross, under the hidings of his Father’s face, under a sense of divine displeasure for the sins of his people, and enduring the pains and agonies of a shameful and an accursed death; he was made up of sorrows, and grief was familiar to him. Some render it, “broken with infirmity”, or “grief.”

4 Surely He hath borne our griefs and carried our sorrows; yet we did esteem Him stricken, smitten of God, and afflicted.

5 But He was wounded for our transgressions; He was bruised for our iniquities. The chastisement of our peace was upon Him, and with His stripes we are healed.

The night before, while He prayed, His blood fell to the ground. He knew He would be flogged nearly to the point of death before they pounded the metal spikes into His flesh. He knew the prophetic words of Isaiah spoken seven centuries earlier that He would be beaten so badly that He would be “disfigured beyond that of any man” and “beyond human likeness” (Isaiah 52:14).

Forerunner Commentary of the King James Version Isaiah 52:14:

Jesus had to die a death that was excruciatingly painful. Why? To depict the horrible pain that sin causes. It would not have served God’s purpose if He had died a painless death. The picture would have been incomplete.

Any criminal of that time would have despaired to learn he was to be crucified. Crucifixion was not only an execution, but also a method of torture. The Romans usually gave the victim an excruciating scourging first. Jesus was no exception. Before He ever touched His cross, He was scourged, beaten, and insulted.

Over the years we have heard quite a bit about the Roman lictor (Roman officer), the soldier charged with dispensing this dreaded punishment. He used a whip, often with imbedded pieces of metal, bone, or other sharp objects. Romans did not limit their lictors to the Israelite practice of “forty stripes save one,” nor to striking just the victim’s back. He would let the whip strike and wrap around every inch of the person’s body until he was within an inch of death.

The prophet Isaiah prophesies how Jesus appeared after the scourging: “Just as many were astonished at you, so His visage [appearance] was marred more than any man, and His form more than the sons of men” (Isaiah 52:14). He goes on to say that He was “wounded [pierced] for our transgressions, He was bruised [crushed] for our iniquities” (Isaiah 53:5).

Just as there were many who were appalled at him — his appearance was so disfigured beyond that of any human being and his form marred beyond human likeness — Isaiah 52:14.

Many people were shocked when they saw him. He was so scarred that he no longer looked like a person. His body was so twisted that he did not look like a human being anymore (Isaiah 52:14).

The Jews were prophesied they would mourn One whom they had rejected: “And they shall look to Me whom they have pierced; then they shall mourn for him, as one mourns for an only son” (Zechariah 12:10). But the Christians have nothing to mourn? Currently these endtime virgins are described as lukewarm and in need of nothing, but would they not mourn when they realise that they had been blind, wretched and naked, seeing finally that Christ had suffered far more through His torn flesh and shed blood than they had ever realised? No? Regardless, these are being described in Revelation 3:17. “As many as I love, I rebuke and chasten: or else I will spew thee out of My mouth (v16,19).”

6 All we like sheep have gone astray; we have turned every one to his own way; and the LORD hath laid on Him the iniquity of us all. — Genesis 22:8 Abraham said, “God will provide for himself the lamb for a burnt offering, my son.” So they went both of them together. that is, God the Father was foreshadowing what was to come; he has laid on Christ, his own Son, the sins of all his elect; which are as it were collected together, and made one bundle and burden of, and therefore expressed in the singular number, “iniquity”, and laid on Christ, and were bore by him, even all the sins of God’s elect; a heavy burden this! which none but the mighty Son could bear; this was typified by laying of hands, and laying of sins upon the goat of sacrifice, and putting the iniquities of Men also upon the head of the azazel goat, and carried away.

Words and Imagery of Isaiah's “Suffering Servant” in the New Testament  Attributed to Jesus | Roger E. Olson

7 He was oppressed, and He was afflicted, yet He opened not his mouth; He is brought as a lamb to the slaughter; and as a sheep before her shearers is dumb, so He openeth not His mouth. — The natural reading of this verse indicates this is a human, not the state of Israel as Orthodox Jews alleged. Thus this is talking about Jesus, one who came to fulfill this Isaiah prophecy.

And when Herod saw Jesus he was exceedingly glad, for he had been desirous to see Him for a long time, because he had heard many things about Him, and he hoped to see some miracle done by Him. Then he questioned Him with many words, but He answered him nothing (Luke 23:8-9).

8 He was taken from prison and from judgment; and who shall declare His generation? For He was cut off out of the land of the living; for the transgression of My people was He stricken. — again, the natural reading of this verse indicates this is a separate being, a human, and “My people” and “He” could only be two separate entities.

9 And He made His grave with the wicked, and with the rich in His death, because He had done no violence, neither was any deceit in His mouth. — that Christ died with wicked men, besides two robbers, as if he himself had been one, a sinner, and was buried in the sepulchre of Joseph of Arimathaea, a rich man.

10 Yet it pleased the LORD to bruise Him; He hath put Him to grief. When thou shalt make His soul an offering for sin, He shall see His seed, He shall prolong His days, and the pleasure of the Lord shall prosper in His hand. — Another prophecy fulfilled: Speaking to the serpent, “And I will put enmity between thee (serpent) and the woman, and between thy seed and her Seed; It shall bruise thy head, and thou shalt bruise His heel” Genesis 3:15. Jesus was buffeted, scourged, and nailed to the cross; and was bruised and broken in spirit, when the sins of his people were laid on him. But why do it please the LORD?

11 He shall see of the travail of His soul, and shall be satisfied. By His knowledge shall My righteous Servant justify many, for He shall bear their iniquities. — My righteous Servant couldn’t possibly be Israel, and Israel doesn’t bear the world’s iniquities, so this has to be a Man, the Son of Man, Jesus.

Isaiah Chapters 46 to 48, The Suffering Servant

12 Therefore will I divide Him a portion with the great, and He shall divide the spoil with the strong, because He hath poured out His soul unto death. And He was numbered with the transgressors; and He bore the sin of many, and made intercession for the transgressors. — In Daniel 7:18 “But the saints of the Most High shall take the kingdom, and possess the kingdom for ever, yea, for ever and ever.” He bore the sin of many; again, this description fit Jesus nicely fulfilling the Lamb of God that every Jewish family should be reminded at Passover. It would take an unsustainable effort to propose this is fulfilled by the state of Israel. Because He humbled himself, and became obedient unto death, even unto death, God hath also highly exalted Him, and given Him a name above every name, that at the name of Jesus every knee should bow, and every tongue confess that He is Lord, to the glory of God the Father.

And looking into the future, the blindness of the Jews will vanish. their eyes open. This is a prophecy for the Jews when Christ return: “And they shall look upon Me whom they have pierced, and they shall mourn for Him as one mourneth for his only son, and shall be in bitterness for Him as one who is in bitterness for his firstborn” Zechariah 12:10

Russian Hypersonic Mach 20 Missiles!

•July 7, 2021 • Comments Off on Russian Hypersonic Mach 20 Missiles!

A Sino-Russian Pack? Will the Biden Administration Push Russia and China Closer Together? Already as “strategic partners” both China and Russia had said they are “not entering into an alliance but keeping the door open to one,” should the need arises.

Space War Russia positions S-500 as game changer for missile defense / Apr 14, 2020

DefenseNews / by Alexander Bratersky / March 15, 2021

Russian foreign minister to visit China hard on heels of Alaska talks |  South China Morning Post

MOSCOW — Hypersonic weapons are a top priority for the Russian government, a defense analyst with the state-run think tank IMEMO has told Defense News, and with two now fielded, the country is looking into further improving the technology.“

The so-called hypersonic technology is essentially an evolutionary development. However, it provides new, combined abilities for missile weapons: increased speed and maneuverability, and improved accuracy,” Dmitry Stefanovich said. “I can’t imagine a person who is responsible for the decision-making in the country and who wouldn’t be interested in improving all those features.”

By creating hypersonic technology that can overcome missile defense systems, Russia maintains “strategic stability and strategic balance,” President Vladimir Putin once told Russian news agency Tass in March 2020.

For Russia, hypersonic technology is also a way to avoid a quantitative arms race like the Soviet Union went through during the Cold War, said Viktor Litovkin, a retired colonel and military analyst with Tass. “We have no money to get involved in a quantitative arms race. You need to have a little, but the highest quality, which will restrain the adversary,” he said.

Russia Zircon Hypersonic Missile

There are currently two hypersonic missiles with the Russian military: the Avangard and the Kinzhal. The former is a nuclear-capable missile reportedly able to fly faster than 20 times the speed of sound. The first Avangard infrastructure was set up in December 2019.

The Kinzhal (or “Dagger” in English) is a nuclear-capable air-launched ballistic missile fielded in December 2017. Before entering the military’s inventory, it was tested with the MiG-31 fighter jet. Putin has said the weapon can exceed 10 times the speed of sound, but some missile experts have cast doubt on that capability.

Why Russia’s Hypersonic Missiles Can’t Be Seen on Radar

Russian media previously reported the Kinzhal physically resembles the 9M723 ballistic missile developed for the Iskander tactical missile system. “If it looks like a duck, swims like a duck and quacks like a duck, then it probably is a duck,” Stefanovich said of the similarity.

Russia is also testing its 3M22 Zircon anti-ship hypersonic cruise missile, expected to be installed on the modernized submarine-killing ship Marshal Shaposhnikov. The vessel is undergoing its owns tests. The head of Tactical Missiles Corporation JSC, Boris Obnosov, told Tass last month that the Zircon’s testing is going according to schedule.

The first launch of Zircon from the nuclear-powered submarine Severodvinsk will take place in June, industry officials said, according to reports from Tass this month. If testing goes well, the Zircon will be delivered to the military in the first half of 2022.

Obnosov has said hypersonic projects are among the top priorities for his company, adding that there are “several dozen” hypersonic efforts ongoing in partnership with the country’s several research and development institutes. He said a center dedicated to hypersonic technology efforts could be established to oversee the projects, without providing further information.

Tactical Missiles Corporation is Russia’s leading developer of hypersonic technology, so it might also be behind a recently tested prototype of an air-to-surface hypersonic missile meant for the Su-57 fifth-generation fighter jet. However, the company did not respond to questions from Defense News regarding its hypersonic projects.

“The children of Ephraim, being armed and carrying bows, turned back in the day of battle” Psalm 78:9

China’s next frontier: TAIWAN

•July 6, 2021 • Leave a Comment

China’s next frontier to confront: Taiwan

With Tibet and Xinjiang at peace and Hong Kong finally subdued, China celebrated its CCP’s hundredth year in style. Within the next 28 years China will be having its last frontier to confront: Taiwan, TaiWan and TAIWAN.

Chinese President Xi Jinping had pledged to complete “reunification” with Taiwan and vowed to “smash” any attempts at formal independence.

“Resolving the Taiwan question and realizing China’s complete reunification is a historic mission and an unshakable commitment of the CPC,” Xi said with an eye for an October 1, 2049 celebration. “Anyone who would attempt to do so will find themselves on a collision course with a great wall of steel forged by over 1.4 billion Chinese people.”

Taiwan — broke away from China in 1949 — but the Chinese ruling party regards the island as a “renegade state” and has repeatedly vowed to take it back by force if necessary by 2049. That would be the hundred anniversary of the founding of the People Republic of China, which will give China’s leaders a profound motivation to achieve for another grand celebration on October 1, 2049.

Now new footage from China shows how the island could be brought back into China’s fold. Chinese state media reveals a ‘three-stage battle plan’ to invade Taiwan as the US stages war games in the Pacific.

The Sun Reports / Patrick Knox / Jul 2 2021

WAR FOOTING WW3 fears as Chinese state media reveals ‘three-stage battle plan’ to invade Taiwan as US stages war games in Pacific.

WORLD War Three fears are growing after China vowed to invade Taiwan and explained how it would do it as the Communist Party celebrates its centenary.

An article in a state-controlled publication has offered a glimpse of a terrifying three-stage plan to pave the way for an invasion force to storm the breakaway island.

It comes as President Xi Jinping yesterday pledged a “complete reunification” with Taiwan as he delivered a speech to mark 100 years of the Chinese Communist party.

The warning came as tensions were increasing in the seas around China where the US and Japan are reported to have been holding joint military exercises amid fears of a possible conflict.

Once ground targets are eliminated an amphibious force would launched the invasion
Once ground targets are eliminated an amphibious force would launched the invasion

Any invasion would represent a serious escalation of hostilities and could drag in the US through its pact to defend Taiwan.

Washington’s regional allies such as South Korea, Japan and Australia could also be sucked into a conflict as would Nato forces such as the UK because the US is a member of the alliance.

Xi’s vow to invade was followed up with an article in the publication Naval and Merchant Ships, which outlined a three-pronged attack that would pave the way for an amphibious landing and the toppling of the government in Taipei.

he first stage would see DF-16 short-range ballistic missile attacks pulverising airports, early warning radar, anti-air missile bases, and command centres across the island.

The article states: “The attacks against Taiwan’s airports would continue until [Chinese] surface troops had accomplished an assault landing.”

Following this China’s H-6 bombers and J-16 fighter jets would attack naval ports, although the facilities would not be “completely destroyed” so the People’s Liberation Army (PLA) could use them for a landing.

It is a common wish of the Chinese people to resolve the Taiwan issue and achieve the total reunification of the motherland
Xi Jinping, China’s President

The three stage attack would pave the way for a land invasion which would likely involve military hovercraft
The three stage attack would pave the way for a land invasion by military hovercraft


In the second stage, the article states YJ-91 and CJ-10 cruise missiles would be unleashed from land, warships and submarines.

Military bases, ammunition depots, communications infrastructure and key road junctions would be crippled. Drones would then be dispatched to assess the damage.

Finally, the article said warships and land-based rocket forces would wipe-out any remaining obstacles so the PLA’s marine corps and amphibious landing troops would safely land.

Taiwan's President Ma Ying-jeou remembers Nationalist victory in Sino-Japan  war, East Asia News & Top Stories - The Straits Times
Taiwan’s “first battle will also be its last” says Taiwan’s former President Ma Ying-jeou.

Of course, Taiwan and its fake allies will put up some resistance, but Taiwan’s former President Ma Ying-jeou has enough knowledge and the foresight about the island to predict that: “Taiwan’s “first battle will also be its last.”

“Be afraid,” warns ASIATIMES’ David Goldman for his home country; but he also has one for its illegitimate ally, Taiwan: “Be very afraid.”

Would a Gold-backed Yuan bankrupt the US Dollar?

•July 5, 2021 • Leave a Comment

The US Debt Clock is now over $28 Trillion – with regular $2 or $3 Trillion Dollars increase every few months, how could the US ever pay back?

Ponzi schemer Bernie Madoff has died in prison - CBS News
Another Mene, Mene, Tekel, Upharsin?

Peter Schiff “Madoff is Dead, but the US Government Ponzi Schemes Live On.” Ep 679 — April 14, 2021

The great federal-debt Ponzi scheme / July 5, 2021

Bernard Madoff, the Manhattan investment adviser who promised stellar returns to his A-list clients and instead defrauded them of more than $19 billion in history’s largest Ponzi scheme, has died. 

With his promise to deliver steady returns through markets bullish and bearish, Madoff built such a sterling reputation that he had to turn some prospective investors away. The fraud collapsed in December 2008, when plunging equity markets prompted clients to seek more withdrawals making his scheme unattainable. His sons Andrew and Mark notified the Federal Bureau of Investigation that their father had confessed to them.

Do We Have A New World Reserve Currency? Gold Backed YUAN? - YouTube

Like Charles Ponzi, whose 1920 con earned him a place in the annals of fame, Madoff seemed to deliver stunning returns to his clients, when in fact he was paying existing investors with money from new ones. Unlike Ponzi, who soared and fell in the course of one year, Madoff achieved a level of respect and acclaim among finance professionals — he was chairman of the Nasdaq Stock Market in 1990, 1991 and 1993 — and kept his ruse going for at least 15 years, even under scrutiny by the Securities and Exchange Commission.

“The money is gone,” Andrew Madoff quoted his father as telling the family. “It’s all been one big lie.”

Gold-Backed Yuan and Ruble Leave US Dollar in the Dust

Bernie Madoff died in prison at 82, but his spirit lives on in the US Government with a far greater Ponzi scheme — the Great American Debt. Now the Fed Reserve is trapped; it will either bankrupt the government or the American people. 

The Federal Reserve has either to raise interest rates and bankrupt the Treasury to attract new debts to pay off old ones, or the Reserve doesn’t raise rates, let inflation spiral out of control like the hyperinflation affecting the German’s Weimar Republic from 1921 to 1923 and bankrupting the American people to ruin.

“How does the Reserve fight that inflation without bankrupting the US government?” Schiff asked “The answer is it can’t. My thinking is, if it can’t fight inflation without bankrupting the government, it won’t fight the inflation, which means it bankrupts the public because it destroys the value of the dollar.”

The People’s Bank of China could at any moment at their own choosing move into making a version of the Chinese Yuan, making China the first country in the world to have an exchange rate, which would be backed by gold held in vaults 

. . . and the fall of the US Dollar?

Undoubtedly many Central Banks from various countries would see the benefits of safety to shift their reserves into Yuan. Further incentives include having a currency of international settlements if they have their trades with Iran, Cuba, Venezuela, Syria, Libya, Myanmar, South Sudan, Yemen, Zimbabwe, Turkey, Belarus, Russia and China (and the 138 countries in its Belts and Road initiative covering 4.4 billion people and about 40 per cent of global GDP) lie beyond the sanctions of the US government. Germany might find itself sanctioned if it goes with the Nord Stream 2 pipeline.

Hyperinflation in the Weimar Republic - Wikipedia
Hyperinflation during the Weimar Republic

China’s own currency, the Yuan, is not backed by either global use nor gold but being persistently pushed by Russia, this could change. If these two forces shaking the global monetary system — digital acceleration and geopolitical rivalry with the US — were to come together, change could indeed come quickly and suddenly.

With the advent of smart logistics, just-in-time inventory management and just-in-time payments for goods in world trade, traders won’t have to write contracts in foreign currency for payments due months ahead, and buy expensive hedges against currency market fluctuations.

“$16 trillion of US dollar deposits may disappear,” says David Goldman for ASIATIMES. What it means is that $16 trillion of deposits from foreign countries, once they loose their deposit base function in banks, will return to flood the US economy, chasing the same amount of goods and services, thus igniting a hyperinflation immediately.

If not, the United States must borrow 15% to 20% of its GDP each year to finance its internal budget deficit, and also must attract about $1 trillion of capital inflows to finance its growing current account deficit with the rest of the world. Either the dollar has to fall or Treasury yields have to rise – or both. And cumulatively its interest payment year on year would be prohibitive. Either way it is suicidal!

“Be afraid,” warns David Goldman: “Be very afraid!”

“Woe to the crown of pride, to the drunkards of Ephraim, whose glorious beauty is a fading flower, which is on the head of the fat valleys of them that are overcome with wine!” Isaiah 28:1

Is China Preparing A Gold-Backed Yuan? Beijing Greenlights Purchases Of Billions In Bullion

ZeroHedge by Tyler DURDEN – April 16, 2021 

In 2018, the Chinese launched a gold-backed, yuan-denominated oil futures contract. These contracts were priced in yuan, but convertible to gold at the Shanghai exchange, raising the prospect that “the rise of the petroyuan could be the death blow for the dollar.

Two weeks ago, The IMF reported that the global share of US-dollar-denominated exchange reserves dropped to 59.0% in the fourth quarter, according to the IMF’s COFER data released today. This matched the 25-year low of 1995.

And China had became the first major economy to unleash a Central Bank Digital Currency, cementing its trailblazer status in virtual currencies far ahead of other countries, after already recently experimenting with large-scale trials of actual payments by consumers, which was met with mixed results.

China wants to put itself back at the centre of the world | The Economist
China and its BRI Connectivity among 138 Countries

All of which sets the stage for the dramatic headlines that hit this bombshell as Reuters reports that China has given domestic and international banks permission to import large amounts of gold into the country,

The People’s Bank of China (PBOC), the nation’s central bank, controls how much gold enters China through a system of quotas given to commercial banks. It usually allows enough metal in to satisfy local demand but sometimes restricts the flow.

In recent weeks it has given permission for large amounts of bullion to enter, the sources said.

“We had no quotas for a while. Now we are getting them … the most since 2019,” said a source at one of the banks moving gold into China.

Around 150 tonnes of gold worth $8.5 billion at current prices is likely to be shipped, four sources said. Two of the sources said the bullion would be shipped in April. Two others said it would reach China over April and May.

The news sent gold prices soaring (in US Dollars).

The size of the shipments signals China’s dramatic return to the global bullion market. Since February 2020, the country has on average imported gold worth around $600 million a month, or roughly 10 tonnes, Chinese customs data show.

teaser image
Is the US Time Bomb Dollar on its Way?

In 2019 its imports ran at about $3.5 billion a month, or roughly 75 tonnes.

Is this just the next stage that China, at any moment at its own choosing, would peg its digital currency to gold, and we would see the writing on the wall for the US Dollar as the global reserve currency . . .

. . . paving the way for a gold-backed yuan?
. . . and bankrupting the US Dollar?

“And this the writing that was written, MENE, MENE, TEKEL, UPHARSIN,” Daniel 5:25

THAT NIGHT COULDN’T BE THE FOURTEENTH!

•June 25, 2021 • Leave a Comment

THAT NIGHT WHEN CHRIST ATE HIS LAST SUPPER WAS ON THE THIRTEENTH!

THE MISSING HOURS OF CHRIST

This presentation, in detail with all the events leading up to Jesus’ Crucifixion, is to prove that (a) that night Jesus took the Last Supper with His disciples, was the night on the thirteenth of Nisan. 

It is IMPOSSIBLE to be on the fourteenth as the High Priests (Annas and Caiapas), chief priests and other Sadducees were also waiting to partake their passover, which would be on the night of the Fourteenth. Even these Sadducees refused to enter the Preatorium lest they be defiled and couldn’t take their passover.

There are other reasons for this IMPOSSIBILITY but they are presented along with the events, with timing — hour and day — conveyed in this presentation.

Second, that night when Jesus and His disciple sat down and ate, the Scriptures say it was a supper. Yes, just a supper!

Also, and of greater importance, if that night had been the Passover night, Jesus would have infringed one of the ordinances — that the bones should be burned in the morning (boqer), Exodus 12:10, 22; Numbers 9:12.

“They shall leave none of it [food remains] unto the morning (boqer), nor break any bone of it. According to all the ordinances of the Passover they shall keep it.” Numbers 9:12.

Beside, there were the missing 18 hours that most students of the Gospels missed.

And finally, this presentation is also to show (b) that the three Synoptic Gospels didn’t contradict John’s testimony that Jesus died on the eve of the Passover. In fact, when their testimonies are placed in proper perspective, they supplement each other.

Below are the comprehensive evidence, right from the Scriptures:

Jesus’ Last Hours 

(The Hours Usage are Jewish Reckoning; Usages in Roman Reckoning are AM (Ante Meridiem “before noon”) and PM (Post Meridiem “after noon”). 

Prelude to the Passover

Matthew 26:1 (KJ21) And it came to pass, when Jesus had finished all these sayings, He said unto His disciples,

2 “Ye know that after two days is the Feast of the Passover, and the Son of Man is betrayed to be crucified.”

3 Then the chief priests and the scribes and the elders of the people assembled together unto the palace of the high priest, who was called Caiaphas,

4 and consulted that they might take Jesus by stealth and kill Him.

5 But they said, “Not on the feast day, lest there be an uproar among the people.”

Jesus anointed in Bethany

Matthew 26:6 Now when Jesus was in Bethany in the house of Simon the leper,

7 there came unto Him a woman having an alabaster box of very precious ointment, and poured it on His head as He sat at meat.

8 But when His disciples saw it, they were indignant, saying, “To what purpose is this waste?

9 For this ointment might have been sold for much and given to the poor.”

10 When Jesus perceived this, He said unto them, “Why trouble ye the woman? For she hath wrought a good work upon Me.

11 For ye have the poor always with you, but Me ye have not always.

12 For in that she hath poured this ointment on My body, she did it for My burial.

13 Verily I say unto you, wheresoever this Gospel shall be preached in the whole world, there shall also this, which this woman hath done, be told as a memorial of her.”

Judas promised 30 pieces of silver

Matthew 26:14 Then one of the twelve, called Judas Iscariot, went unto the chief priests

15 and said unto them, “What will ye give me if I will deliver Him unto you?” And they covenanted with him for thirty pieces of silver.

16 And from that time he sought opportunity to betray Him.

Disciples prepared for Passover

Matthew 26:17 Now on the first day (G4413 protos) of the Feast of Unleavened Bread, the disciples came to Jesus, saying unto Him, “Where wilt Thou that we prepare for Thee to eat the Passover?”

— The natural reading of this verse seems to suggest the disciples asked Jesus where to keep the Passover when Passover was already over. But G4413 protos could be translated as ‘a time before’ as in John 1:15 John bare witness of him, and cried, saying, This was he of whom I spake, He that cometh after me is preferred before me: for he was before G4413 me.

Thus Matthew 26:17 could be translated as: “Now before the Days of Unleavened Bread have arrived, the disciples came to Jesus, asking, Where shall we prepare for thee to eat the Passover?” 

 — the intention to eat the Passover was there, but the actual eating was yet to happen.  

18 And He said, “Go into the city to a certain man and say unto him, ‘The Master saith, “My time is at hand; I will keep the Passover at thy house with My disciples.”’”

19 And the disciples did as Jesus had appointed them, and they made ready the Passover.

The Last Supper — 13th Nisan, Monday, Even (6:00 PM)

Luke 22:14 And when the hour had come, He sat down and the twelve apostles with Him.

15 And He said unto them, “With desire I have desired to eat this Passover with you before I suffer” 

If that night was the Passover night, Jesus would had broken one of the ordinances according to Numbers 9:12: “They shall leave none of it [food remains] unto the morning (boqer), nor break any bone of it. According to all the ordinances of the Passover they shall keep it.”

They left early and if Jesus had broken any of the ordinances, the destiny of all humanity would have been flushed down the toilet.

Second, if they had killed the lamb at sunset at 6 PM as the CoG Communities believe, it would be a miracle if they could have the lamb roasted and meal ready before 10 PM, but for this exercise, let’s start at 6 PM when supper was served, because that night could only be the thirteenth.

Taking into consideration a very unusual word for “desire” is epithumia in the Greek, which is something forbidden, perhaps this verse should be translated as: “With fervent desire I have desired to eat this Passover with you before I suffer; but I’m saying to you now, I am forbidden and denied this privilege, and I will no longer eat with you until we’re all in the kingdom of God.” — for a detailed exegesis see endnote.

16 for I say unto you, I will not anymore eat thereof until it be fulfilled in the Kingdom of God.” John 13:1 Now before the Feast of the Passover, when Jesus knew that His hour had come that He should depart out of this world unto the Father, having loved His own who were in the world, He loved them unto the end.

John 13:2 And supper (G1173) being ended, and the devil having now put into the heart of Judas Iscariot, Simon’s son, to betray Him other translations say “during supper.” It was just as a supper as in John 12:2 where Martha and Mary made Him a supper (G1173) in Bethany after raising Lazarus. If that night was a passover why didn’t the Gospel writers say so to differentiate it from other ordinary supper?

3 Jesus, knowing that the Father had given all things into His hands and that He had come from God and was going to God,

Foot washing (only recorded by John) — 13th Nisan, Monday Night (7:30 PM)

John 13:4 rose from supper (G1173) and laid aside His garments, and took a towel and girded Himself.

5 After that He poured water into a basin, and began to wash the disciples’ feet and to wipe them with the towel wherewith He was girded.

Among Eastern people it was customary, before eating, to wash the feet; and to do this, or to bring water for it, was one of the rites of hospitality. See Genesis 18:4; Judges 19:21. The reasons for this were, that they wore “sandals,” which covered only the bottom of the feet, and that when they ate they reclined on couches or sofas. It became therefore necessary that the feet should be washed before food. But here, none of His disciples was willing to play host and doing the act of hospitality, hence Jesus volunteered after supper.

6 Then came He to Simon Peter, and Peter said unto Him, “Lord, dost Thou wash my feet?”

7 Jesus answered and said unto him, “What I do thou knowest not now, but thou shalt know hereafter.”

8 Peter said unto Him, “Thou shalt never wash my feet.” Jesus answered him, “If I wash thee not, thou hast no part with Me.”

9 Simon Peter said unto Him, “Lord, not my feet only, but also my hands and my head.”

See the source image

10 Jesus said to him, “He that is washed needeth not but to wash his feet, but is clean every whit. And ye are clean, but not all.”

11 (For He knew who would betray Him; therefore He said, “Ye are not all clean.”)

12 So after He had washed their feet and had taken His garments and had sat down again, He said unto them, “Know ye what I have done to you?

13 Ye call Me Master and Lord; and ye say well, for so I am.

14 If I then, your Lord and Master, have washed your feet, ye also ought to wash one another’s feet.

15 For I have given you an example, that ye should do as I have done to you.

16 Verily, verily I say unto you, the servant is not greater than his lord, neither he that is sent greater than he that sent him.

17 If ye know these things, happy are ye if ye do them.

Judas left to betray Jesus — 13th Nisan, Monday Night (8:00 PM)

John 13:18 “I speak not of you all. I know whom I have chosen; but that the Scripture may be fulfilled, ‘He that eateth bread with Me hath lifted up his heel against Me.’

19 Now I tell you before it comes that, when it is come to pass, ye may believe that I am He.

20 Verily, verily I say unto you, he that receiveth whomsoever I send, receiveth Me; and he that receiveth Me, receiveth Him that sent Me.”

21 When Jesus had thus said, He was troubled in spirit, and testified and said, “Verily, verily I say unto you that one of you shall betray Me.”

22 Then the disciples looked at one another, not knowing of whom He spoke.

23 Now there was leaning on Jesus’ bosom, one of His disciples, whom Jesus loved.

24 Simon Peter therefore beckoned to him, that he should ask who it should be of whom He spoke.

25 He then, leaning on Jesus’ breast, said unto Him, “Lord, who is it?”

26 Jesus answered, “He it is to whom I shall give a sop when I have dipped it.” And when He had dipped the sop, He gave it to Judas Iscariot, the son of Simon. this was not the Passover sop, which was dipped into a sauce made of various things, called by the Jews for this was not the “paschal” supper, but a common supper, two days before the feast of the Passover; but this sop, or rather crust of bread (G740 artos), which when dipped into a sop, which Christ dipped his hand into, and took to Judas Iscariot, was evidently a piece from a common bread (G740 artos).

27 And after the sop, Satan entered into him. Then Jesus said unto him, “What thou doest, do quickly.”

28 Now no man at the table knew with what intent He spoke this unto him.

29 For some of them thought, because Judas had the money bag, that Jesus had said unto him, “Buy those things that we have need of for the feast,” or that he should give something to the poor. — some of the other disciples thought Judas was taking the money to buy for the feast. This indicates that buying and selling were still going on, which demonstrates that Passover hadn’t arrived yet otherwise everyone would be keeping Passover at home and none would be engaging in commercial activities. Second, if that night were the Passover, the other disciples would be wondering why Judas didn’t wait until morning (boqer) before venturing out of the house (Ex 12:22; Num 9:12); but none did.

30 Judas then, having received the sop, went immediately out. And it was night.

31 Therefore when he had gone out, Jesus said, “Now is the Son of Man glorified, and God is glorified in Him.

32 If God be glorified in Him, God shall also glorify Him in Himself, and shall straightway glorify Him.

Wine and unleavened bread — 13th Nisan, Monday Night (8:00 PM)

Luke 22:17 And He took the cup, and gave thanks and said, “Take this, and divide it among yourselves;

18 for I say unto you, I will not drink of the fruit of the vine until the Kingdom of God shall come.”

19 And He took bread (G740 artos), and gave thanks and broke it and gave it unto them, saying, “This is My body which is given for you. This do in remembrance of Me.” Jesus was using leavened bread (Greek=“artos”) throughout this last supper (recorded in all the Gospel accounts and 1 Corinthians 10-12). Had this been Passover, Jesus would have had to use unleavened bread (Greek=“azimos”) which was commanded in Exodus 12:8.

20 Likewise also He took the cup after supper, saying, “This cup is the new testament in My blood, which is shed for you.

21 But behold, the hand of him that betrayeth Me is with Me on the table.

22 And truly the Son of Man goeth as it was determined; but woe unto that man by whom He is betrayed!”

23 And they began to inquire among themselves which of them it was that should do this thing.

24 And there was also a contention among them, which of them should be accounted the greatest.

25 And He said unto them, “The kings of the Gentiles exercise lordship over them, and they that exercise authority over them are called ‘benefactors.’

26 But ye shall not be so; but he that is greatest among you, let him be as the younger, and he that is chief, as he that doth serve.

27 For who is greater, he that sitteth at meat or he that serveth? Is it not he that sitteth at meat? But I am among you as He that serveth.

28 “Ye are they that have continued with Me in My temptations.

29 And I appoint unto you a Kingdom, as My Father hath appointed unto Me,

30 that ye may eat and drink at My table in My Kingdom, and sit on thrones judging the twelve tribes of Israel.”

A new commandment  13th Nisan, Monday Night (9:00 PM)

John 13:33 Little children, yet a little while I am with you. Ye shall seek Me; and as I said unto the Jews, ‘Whither I go ye cannot come,’ so now say I to you.

34 A new commandment I give unto you: that ye love one another, as I have loved you, that ye also love one another.

35 By this shall all men know that ye are My disciples: if ye have love one for another.”

Prophecy about Peter denying Christ 

Luke 22:31 And the Lord said, “Simon, Simon! Behold, Satan hath desired to have you, that he may sift you as wheat.

32 But I have prayed for thee, that thy faith fail not; and when thou art converted, strengthen thy brethren.”

33 And Peter said unto Him, “Lord, I am ready to go with Thee, both into prison and to death.”

34 And He said, “I tell thee, Peter, the cock shall not crow this day before thou shalt thrice deny that thou knowest Me.”

Christ’s instruction to the disciples  13th Nisan, Monday Night (9:00 PM)

Luke 22:35 And He said unto them, “When I sent you without purse and pack and shoes, lacked ye anything?” And they said, “Nothing.”

36 Then said He unto them, “But now, he that hath a purse, let him take it and likewise his pack; and he that hath no sword, let him sell his garment and buy one.

37 For I say unto you that this that is written must yet be accomplished in Me: ‘And He was reckoned among the transgressors.’ For the things concerning Me have an end.”

38 And they said, “Lord, behold, here are two swords.” And He said unto them, “It is enough.” 

Thomas Coke Commentary on Luke 22:38. Lord, behold, here are two swords.— Our Lord’s disciples, mistaking his meaning about the swords, replied, they had two: the reason why they had any at all, probably, was, that they might defend themselves against robbers in their journey from Galilee and Perea, and from the beasts of prey which in those parts were very frequent and dangerous in the night time: it afterwards appears, that one of these swords was Peter’s. See John 18:10. Our Lord replies to the disciples, “It is enough for weapons of this sort; my chief intent is, to direct you to another kind of defence; even that which arises from piety and faith.” This is strongly intimated by our Lord’s saying that two swords were sufficient; which, it is evident, they could not have been for so many men, had our Lord meant what he said in a literal sense.

They sang a hymn and left 13th Nisan, Monday Night (9:30 PM)

Matthew 26:30 And when they had sung a hymn, they went out unto the Mount of Olives.

One of the Passover ordinances would be broken if that night was a Passover:

“And ye shall let nothing of it remain until the morning (boqer), and that which remaineth of it [food remains] until the morning ye shall burn with fire.” Exodus 12:10

“They shall leave none of it [food remains] unto the morning (boqer), nor break any bone of it. According to all the ordinances of the Passover they shall keep it” Numbers 9:12.

Jesus and His disciples left for the Garden of Gethsemane and according to most timeline it was around 9:00 PM. Further, they left without burning any food remains or the bones, infringing one of the Passover ordinances according to Exodus 12:10, 22; Numbers 9:12. If that night was a Passover night, all our hopes and dreams about eternal life would be flushed down the toilet. OBVIOUSLY IT WASN’T A PASSOVER NIGHT. THANK GOD!

More discourse 13th Nisan, Monday Night (9:30 PM)

John 14:1 “Let not your heart be troubled. Ye believe in God; believe also in Me.

2 In My Father’s house are many mansions; if it were not so, I would have told you. I go to prepare a place for you.

3 And if I go and prepare a place for you, I will come again and receive you unto Myself, that where I am, there ye may be also.

4 And whither I go ye know, and the way ye know.”

5 Thomas said unto Him, “Lord, we know not whither Thou goest; and how can we know the way?”

6 Jesus said unto him, “I am the Way, the Truth, and the Life; no man cometh unto the Father, but by Me.

7 If ye had known Me, ye should have known My Father also; and from henceforth ye know Him, and have seen Him.”

8 Philip said unto Him, “Lord, show us the Father, and it sufficeth us.”

9 Jesus said unto him, “Have I been so long a time with you, and yet hast thou not known Me, Philip? He that hath seen Me hath seen the Father; and how sayest thou then, ‘Show us the Father’?

10 Believest thou not that I am in the Father, and the Father in Me? The words that I speak unto you I speak not of Myself; but the Father that dwelleth in Me, He doeth the works.

11 Believe Me that I am in the Father, and the Father in Me; or else believe Me for the very works’ sake.

12 Verily, verily I say unto you, he that believeth in Me, the works that I do he shall do also; and greater works than these shall he do, because I go unto My Father.

13 And whatsoever ye shall ask in My name, that will I do, that the Father may be glorified in the Son.

14 If ye shall ask anything in My name, I will do it.

15 “If ye love Me, keep My commandments.

16 And I will pray the Father, and He shall give you another Comforter, that He may abide with you forever”

17 even the Spirit of Truth, whom the world cannot receive, because it seeth Him not, neither knoweth Him. But ye know Him, for He dwelleth with you, and shall be in you.

18 “I will not leave you comfortless; I will come to you.

19 Yet a little while and the world seeth Me no more, but ye see Me. Because I live, ye shall live also.

20 At that day ye shall know that I am in My Father, and you in Me, and I in you.

21 He that hath My commandments and keepeth them, he it is that loveth Me; and he that loveth Me shall be loved by My Father, and I will love him and will manifest Myself to him.”

22 Judas (not Iscariot) said unto Him, “Lord, how is it that Thou wilt manifest Thyself unto us, and not unto the world?”

23 Jesus answered and said unto him, “If a man love Me, he will keep My words; and My Father will love him, and We will come unto him and make Our abode with him.

24 He that loveth Me not, keepeth not My sayings. And the Word which you hear is not Mine, but the Father’s who sent Me.

25 “These things have I spoken unto you, being yet present with you.

26 But the Comforter, who is the Holy Ghost whom the Father will send in My name, He shall teach you all things and bring all things to your remembrance, whatsoever I have said unto you.

27 “Peace I leave with you; My peace I give unto you, not as the world giveth, give I unto you. Let not your heart be troubled, neither let it be afraid.

28 Ye have heard how I said unto you, ‘I go away and come again unto you.’ If ye loved Me, ye would rejoice because I said, ‘I go unto the Father,’ for My Father is greater than I.

29 And now I have told you before it comes to pass, that when it is come to pass, ye might believe.

30 “Hereafter I will not talk much with you, for the prince of this world cometh, and hath nothing in Me.

31 But that the world may know that I love the Father, as the Father gave Me commandment, even so I do. Arise, let us go hence.

More discourse — 13th Nisan, Monday Night (9:30 PM)

John 15:1 “I am the true vine, and My Father is the husbandman.

2 Every branch in Me that beareth not fruit He taketh away; and every branch that beareth fruit, He purgeth it, that it may bring forth more fruit.

3 Now ye are clean through the Word which I have spoken unto you.

This image has an empty alt attribute; its file name is pictures-of-jesus-gethsemane-958589-wallpaper.jpg

4 “Abide in Me, and I in you. As the branch cannot bear fruit of itself, unless it abide in the vine, no more can ye, unless ye abide in Me.

5 “I am the vine, ye are the branches. He that abideth in Me and I in Him, the same bringeth forth much fruit, for without Me ye can do nothing.

6 If a man abides not in Me, he is cast forth as a branch and is withered; and men gather them and cast them into the fire, and they are burned.

7 If ye abide in Me, and My words abide in you, ye shall ask what ye will, and it shall be done unto you.

8 Herein is My Father glorified, that ye bear much fruit; so shall ye be My disciples.

9 “As the Father hath loved Me, so have I loved you. Continue ye in My love.

10 If ye keep My commandments, ye shall abide in My love, even as I have kept My Father’s commandments, and abide in His love.

11 These things have I spoken unto you, that My joy might remain in you, and that your joy might be full.

12 “This is My commandment: that ye love one another, as I have loved you.

13 Greater love hath no man than this, that a man lay down his life for his friends.

14 Ye are My friends if ye do whatsoever I command you.

15 Henceforth I call you not servants, for the servant knoweth not what his lord doeth; but I have called you friends, for all things that I have heard of My Father, I have made known unto you.

16 Ye have not chosen Me, but I have chosen you and ordained you, that ye should go and bring forth fruit and that your fruit should remain, that whatsoever ye shall ask of the Father in My name, He may give it to you.

17 These things I command you, that ye love one another.

18 “If the world hates you, ye know that it hated Me before it hated you.

19 If ye were of the world, the world would love his own; but because ye are not of the world, but I have chosen you out of the world, therefore the world hateth you.

20 Remember the word that I said unto you: ‘The servant is not greater than his lord.’ If they have persecuted Me, they will also persecute you; if they have kept My saying, they will keep yours also.

21 But all these things will they do unto you for My name’s sake, because they know not Him that sent Me.

22 If I had not come and spoken unto them, they would not have sin, but now they have no cloak for their sin.

23 He that hateth Me hateth My Father also.

24 If I had not done among them the works which no other man did, they would not have had sin; but now they have both seen and hated both Me and My Father.

25 But this cometh to pass, that the word might be fulfilled that is written in their law: ‘They hated Me without a cause.’

26 “But when the Comforter is come, whom I will send unto you from the Father, even the Spirit of Truth who proceedeth from the Father, He shall testify of Me.

27 And ye also shall bear witness, because ye have been with Me from the beginning.

More discourse — 13th Nisan, Monday Night (9:30 PM)

John 16:1 “These things have I spoken unto you, that ye should not lose faith.

2 They shall put you out of the synagogues; yea, the time cometh that whosoever killeth you will think that he doeth God service.

3 And these things will they do unto you, because they have not known the Father, nor Me.

4 But these things have I told you, that when the time shall come, ye may remember that I told you of them. “And these things I said not unto you at the beginning, because I was with you.

5 But now I go My way to Him that sent Me, and none of you asketh Me, ‘Whither goest Thou?’

6 But because I have said these things unto you, sorrow hath filled your heart.

7 Nevertheless I tell you the truth. It is expedient for you that I go away, for if I go not away, the Comforter will not come unto you; but if I depart, I will send Him unto you.

8 And when He is come, He will reprove the world concerning sin, and concerning righteousness, and concerning judgment:

9 concerning sin, because they believe not in Me;

10 concerning righteousness, because I go to My Father and ye see Me no more;

11 concerning judgment, because the prince of this world is judged.

12 “I have yet many things to say unto you, but ye cannot bear them now.

13 However when He, the Spirit of Truth, is come, He will guide you into all truth; for He shall not speak from Himself, but whatsoever He shall hear, that shall He speak; and He will show you things to come.

14 He shall glorify Me, for He shall receive of Mine, and shall show it unto you.

15 All things that the Father hath are Mine; therefore I said that He shall take of Mine, and shall show it unto you.

16 A little while, and ye shall not see Me; and again a little while, and ye shall see Me, because I go to the Father.”

17 Then said some of His disciples among themselves, “What is this that He saith unto us, ‘A little while, and ye shall not see Me; and again a little while, and ye shall see Me,’ and, ‘because I go to the Father’?”

18 They said therefore, “What is this that He saith, ‘A little while’? We cannot tell what He saith.”

19 Now Jesus knew that they were desirous of asking Him, and said unto them, “Do ye inquire among yourselves of what I said, ‘A little while, and ye shall not see Me; and again a little while, and ye shall see Me’?

20 Verily, verily I say unto you that ye shall weep and lament, but the world shall rejoice; and ye shall be sorrowful, but your sorrow shall be turned into joy.

21 A woman when she is in travail hath sorrow, because her hour is come; but as soon as she is delivered of the child, she remembereth no more the anguish, for the joy that a man is born into the world. 

22 And ye now therefore have sorrow; but I will see you again, and your heart shall rejoice, and your joy no man taketh from you.

23 And in that day ye shall ask Me nothing. Verily, verily I say unto you, whatsoever ye shall ask the Father in My name, He will give it to you.

24 Hitherto have ye asked nothing in My name. Ask and ye shall receive, that your joy may be full.

25 “These things have I spoken unto you in proverbs; but the time cometh when I shall no more speak unto you in proverbs, but I shall show you plainly of the Father.

26 In that day ye shall ask in My name, and I say not unto you that I will pray the Father for you;

27 for the Father Himself loveth you, because ye have loved Me and have believed that I came out from God.

28 I came forth from the Father, and am come into the world. Again, I leave the world and go to the Father.”

29 His disciples said unto Him, “Lo, now speakest Thou plainly and speakest no proverb.

30 Now are we sure that Thou knowest all things and needest not that any man should ask Thee. By this we believe that Thou camest forth from God.”

31 Jesus answered them, “Do ye now believe?

32 Behold, the hour cometh, yea, is now come, that ye shall be scattered, every man to his own, and shall leave Me alone. And yet I am not alone, because the Father is with Me.

33 These things I have spoken unto you, that in Me ye might have peace. In the world ye shall have tribulation, but be of good cheer: I have overcome the world.”

In Gethsemene to pray — 13th Nisan, Monday Night (10:00 PM)

Luke 22:39 And He came out and went, as He was wont, to the Mount of Olives; and His disciples also followed Him.

Jesus’ ‘inner circle’

Mark 14:33 And He took with Him Peter and James and John, and began to be sore amazed and very heavy of heart. — These three disciples were there during Christ’s time of prayers and distress. They were Christ’s inner circle.

34 And He said unto them, “My soul is exceeding sorrowful unto death; tarry ye here, and watch.”

Jesus prayed for 3 hours — 13th Nisan, Monday Night (12:00 AM)

Matthew 26:39 And He went a little farther, and fell on His face and prayed, saying, “O My Father, if it be possible, let this cup pass from Me; nevertheless, not as I will, but as Thou wilt.”

40 And He came unto the disciples and found them asleep, and said unto Peter, “What, could ye not watch with Me one hour?

41 Watch and pray, that ye enter not into temptation. The spirit indeed is willing, but the flesh is weak.”

42 He went away again the second time and prayed, saying, “O My Father, if this cup may not pass away from Me, unless I drink it, Thy will be done.”

43 And He came and found them asleep again, for their eyes were heavy.

44 And He left them and went away again, and prayed a third time, saying the same words.

Up to this point, Jesus still hoped and prayed that this cup could be taken away from Him, so He could take the Passover with His disciples. But it wasn’t granted.

Second, He sweated profusely, His blood falling to the ground, not so much as death awaited Him, but the process of tortues under the Roman soldiers that most people would fear of. Surely He knew this in advance.  

And being in agony, He prayed more earnestly, and His sweat was, as it were, great drops of blood falling down to the ground (Luke 22:44).

Then He said unto them, “My soul is exceeding sorrowful, even unto death; tarry ye here and watch with Me.” And He went a little farther, and fell on His face and prayed, saying, “O My Father, if it be possible, let this cup pass from Me; nevertheless, not as I will, but as Thou wilt” (Matthew 26:38-39). Christ wanted two things that night; (a) to partake the upcoming Passover; (b) avoiding this cup of suffering. Here, for three hours, He was still pleading, but both requests were denied.

The Lord’s prayer — 13th Nisan, Tuesday Early Morning (1:00 AM)

John 17:1 These words spoke Jesus and lifted up His eyes to Heaven and said, “Father, the hour is come. Glorify Thy Son, that Thy Son also may glorify Thee,

2 as Thou hast given Him power over all flesh, that He should give eternal life to as many as Thou hast given Him.

3 And this is life eternal: that they might know Thee, the only true God, and Jesus Christ whom Thou hast sent.

4 I have glorified Thee on the earth; I have finished the work which Thou gavest Me to do.

5 And now, O Father, glorify Thou Me with Thine own Self with the glory which I had with Thee before the world was.

6 “I have manifested Thy name unto the men whom Thou gavest Me out of the world. Thine they were, and Thou gavest them to Me, and they have kept Thy Word.

7 Now they have known that all things whatsoever Thou hast given Me are of Thee.

8 For I have given unto them the Words which Thou gavest Me; and they have received them and have known surely that I came out from Thee, and they have believed that Thou didst send Me.

9 I pray for them; I pray not for the world, but for them whom Thou hast given Me, for they are Thine.

10 And all Mine are Thine, and Thine are Mine, and I am glorified in them.

11 And now I am no more in the world, but these are in the world, and I come to Thee. Holy Father, keep through Thine own name those whom Thou hast given Me, that they may be one, as We are.

12 While I was with them in the world, I kept them in Thy name. Those that Thou gavest Me I have kept, and none of them is lost, but the son of perdition, that the Scripture might be fulfilled.

13 “And now come I to Thee, and these things I speak in the world, that they might have My joy fulfilled in themselves.

14 I have given them Thy Word, and the world hath hated them, because they are not of the world, even as I am not of the world.

15 I pray not that Thou shouldest take them out of the world, but that Thou shouldest keep them from the evil.

16 They are not of the world, even as I am not of the world.

17 Sanctify them through Thy truth: Thy Word is truth.

18 As Thou hast sent Me into the world, even so have I also sent them into the world.

This image has an empty alt attribute; its file name is jesus-garden-apostles-sleeping-960161-gallery.jpg

19 And for their sakes I sanctify Myself, that they also might be sanctified through the truth.

20 “Neither pray I for these alone, but for them also who shall believe in Me through their word,

21 that they all may be one, as Thou, Father, art in Me and I in Thee, that they also may be one in Us, that the world may believe that Thou hast sent Me.

22 And the glory which Thou gavest Me I have given them, that they may be one, even as We are one:

23 I in them and Thou in Me, that they may be made perfect in one, and that the world may know that Thou hast sent Me and hast loved them, as Thou hast loved Me.

24 “Father, I will that they also, whom Thou hast given Me, be with Me where I am, that they may behold My glory which Thou hast given Me; for Thou loved Me before the foundation of the world.

25 “O righteous Father, the world hath not known Thee, but I have known Thee, and these have known that Thou hast sent Me.

26 And I have declared unto them Thy name, and will declare it, that the love wherewith Thou hast loved Me may be in them, and I in them.”

Judas’s betrayal — 13th Nisan, Tuesday Early Morning (1:30 AM)

John 18:1 When Jesus had spoken these words, He went forth with His disciples over the Brook Kidron, where was a garden into which He entered with His disciples.

2 And Judas also, who betrayed Him, knew the place, for Jesus often resorted thither with His disciples.

3 Judas then, having received a band of men and officers from the chief priests and Pharisees, came thither with lanterns and torches and weapons.

The high priests, Annas and Caiaphas, were known to be Sadducees and according to their beliefs they would be having their passover that night, if that night was on the fourteenth. They would be roasting their lambs for 4 to 5 hours and eating them and it would be extremely unlikely they had planned anything else on such a revered night.

Later these same high priests were said to refuse entering the praetorium, lest they be defiled to partake their passover, signifying that night could only be the thirteenth!

4 Jesus therefore, knowing all things that should come upon Him, went forth and said unto them, “Whom seek ye?”

5 They answered Him, “Jesus of Nazareth.” Jesus said unto them, “I am He.” And Judas also, who betrayed Him, stood with them.

6 As soon then as He had said unto them, “I am He,” they went backward and fell to the ground.

7 Then He asked them again, “Whom seek ye?” And they said, “Jesus of Nazareth.”

8 Jesus answered, “I have told you that I am He. If therefore ye seek Me, let these go their way,”

9 that the saying might be fulfilled which He spoke, “Of those that Thou gavest Me, have I lost none.”

Healing of High Priest servant’s ear — 13th Nisan, Tuesday Early Morning (2:00 AM)

John 18:10 Then Simon Peter, having a sword, drew it and smote the high priest’s servant and cut off his right ear. The servant’s name was Malchus.

11 Then said Jesus unto Peter, “Put up thy sword into the sheath. The cup which My Father hath given Me, shall I not drink it?” — Peter was there during Christ’s time of distress

12 Then the band and the captain and officers of the Jews took Jesus and bound Him,

Disciples deserted Him — 13th Nisan, Tuesday Early Morning (2:00 AM)

Mark 14:50 And they all forsook Him and fled.

51 And there followed Him a certain young man, having a linen cloth cast about his naked body; and the young men laid hold on him. — this disciple during Christ’s trial was probably James. 

Acts 12:2 He (Governor Herod) killed James the brother of John with the sword,

52 And he left the linen cloth and fled from them naked.

They led Him to Annas — 13th Nisan, Tuesday Early Morning (2.30 AM)

John 18:13 and led Him away to Annas first, for he was the father-in-law of Caiaphas, who was the high priest that same year.

14 Now it was Caiaphas who gave counsel to the Jews that it was expedient that one man should die for the people.

Peter followed near a fire — 13th Nisan, Tuesday Morning (3:00 AM)

John 18:15 And Simon Peter followed Jesus, and so did another disciple. That disciple was known unto the high priest, and went in with Jesus into the palace of the high priest. — John, shy to identify himself, was another disciple during Christ’s time of distress. 

16 But Peter stood at the door outside. Then the other disciple, who was known unto the high priest, went out and spoke unto her who kept the door, and brought in Peter.

17 Then the damsel who kept the door said unto Peter, “Art not thou also one of this man’s disciples?” He said, “I am not.”

18 And the servants and officers stood there, who had made a fire of coals, for it was cold and they warmed themselves. And Peter stood with them, and warmed himself.

Before Annas and Caiaphas — 13th Nisan, Tuesday Morning (4:00 AM)

John 18:19 The high priest (identified as Annas) then asked Jesus about His disciples and about His doctrine. — Annas was trying to fish out something so as to accuse Jesus of treason and to put Him to death.

20 Jesus answered him, “I spoke openly to the world; I ever taught in the synagogue and in the temple whither the Jews always resort, and in secret have I said nothing.

21 Why askest thou Me? Ask them that heard Me what I have said unto them. Behold, they know what I said.”

22 And when He had thus spoken, one of the officers who stood by struck Jesus with the palm of his hand, saying, “Answerest thou the high priest so?”

23 Jesus answered him, “If I have spoken evil, bear witness of the evil; but if well, why smitest thou Me?”

24 Now Annas had sent Him bound unto Caiaphas, the high priest.

Caiaphas was the son-in-law of Annas by marriage to his daughter. Annas and Caiaphas were Sadducees or their close allies, the Boethusiasns. And if that night was on the fourteenth, they would be having their Sadducaic passover. Their minds would be on killing, cleaning and roasting the lamb after sunset, and it would be close to insanity to think that they had planned to be troubled on something else on such an auspicious night.

Second, after Jesus’ miracle of raising Lazarus from the grave, the chief priests (John 12:10) who would certainly include Caiaphas and other Sadducees advocated putting Jesus to death. This act of raising Lazarus from death is anathema to Sadducaic teaching, because Sadducees don’t believe in any resurrection (Acts 4:1-6; 23:8).

The Sanhedrin — 13th Nisan, Tuesday Morning (5:00 AM)

Matthew 26:59 Now the chief priests and elders and all the council sought false witness against Jesus to put Him to death,

Mark 14:55 And the chief priests and all of the council (i.e. the entire Sanhedrin members alone would be 70 or 72, not including elders and false witnesses) sought for witnesses against Jesus to put Him to death, and found none. — It would probably take one or two hours to assemble them together, even if they all live nearby. Those days they didn’t have telephones, only runners.

Second, if that night were the fourteenth, it would be a passover night for the Sadducees, who made up a large portion of the Sanhedrin at that time. It would be inconceivable to believe that many runners could be found during the early morning hours and dared to trouble all the Sadducaic members of the Sanhedrin in their sleep. This together with the comment above on Annas and Caiaphas are strong evidence to believe that that night wasn’t possible to be on the fourteenth.

60 but found none. Yea, though many false witnesses came, yet found none. At the last came two false witnesses,

61 and said, “This fellow said, ‘I am able to destroy the temple of God and to build it in three days.’”

62 And the high priest (Caiaphas, Matt 28:57) arose and said unto Him, “Answerest thou nothing? What is it which these witnesses say against thee?”

Earlier a Saddusaic high priest Caiaphas already wanted Jesus dead for raising Lazarus (for Sadducees didn’t believe in any resurrection Acts 23:8):
John 11:49 And one of them named Caiaphas, being the high priest that same year, said unto them, “Ye know nothing at all,
50 nor consider that it is expedient for us that one man should die for the people, and that the whole nation perish not.”
51 And he spoke this not of himself, but, being high priest that year, he prophesied that Jesus should die for that nation;
52 and not for that nation only, but that also He should gather together in one the children of God who were scattered abroad.
53 So from that day forth, they took counsel together to put Him to death.

63 But Jesus held His peace. And the high priest answered and said unto Him, “I adjure thee by the living God that thou tell us whether thou be the Christ, the Son of God.”

This image has an empty alt attribute; its file name is hEOhUdEkbtEPaz0WFhOg230Bam3MDK67MUUzBPkBITbU1B-yyr7BHsUSjsnV43LYsI9pnEmA07FsZKLOGGtCPIOz2s3MFCGopIMPJmj9dnlPtHxmV991SrEr6eGB-9GYHeWhKOSdwMGNQKGhZJQRrQ=s0-d-e1-ft
Jesus before Caiaphas, chief priests, elders and the full Sandhedrin

64 Jesus said unto him, “Thou hast said; nevertheless I say unto you, hereafter shall ye see the Son of Man sitting at the right hand of Power, and coming in the clouds of heaven.”

65 Then the high priest rented his clothes, saying, “He hath spoken blasphemy! What further need have we of witnesses? Behold, now ye have heard his blasphemy!

66 What do you think?” They answered and said, “He is deserving of death!”

67 Then they spit in His face and buffeted Him, and others smote Him with the palms of their hands,

68 saying, “Prophesy unto us, thou Christ! Who is he that smote thee?”

Peter denied Jesus three times — 13th Nisan, Tuesday Morning (5:00 AM)

Matthew 26:69 Now Peter sat outside in the palace, and a damsel came unto him, saying, “Thou also wast with Jesus of Galilee.”

70 But he denied it before them all, saying, “I know not what thou sayest.”

71 And when he had gone out onto the porch, another maid saw him and said unto those who were there, “This fellow was also with Jesus of Nazareth.”

72 And again he denied with an oath, “I do not know the man!”

73 And after a while came unto him those who stood by, and said to Peter, “Surely thou also art one of them, for thy speech betrayeth thee.”

74 Then he began to curse and to swear, saying, “I know not the man!” And immediately the cock crowed.

75 And Peter remembered the word of Jesus, when He said unto him, “Before the cock crow, thou shalt deny Me thrice.”

The best scientific evidence says that normally endogenous cycles stimulate a cock to crow in response to incremental changes in light intensity. The best bet seems to be from around 5 AM to 6 AM.

Luke 22:62 And Peter went out and wept bitterly.

63 And the men who held Jesus mocked Him and smote Him.

64 And when they had blindfolded Him, they struck Him on the face and asked Him, saying, “Prophesy! Who is it that smote thee?”

65 And many other things they spoke blasphemously against Him.

Sanhedrin condemned Him — 13th Nisan, Tuesday, Dawn (6:00 AM)

Luke 22:66 And as soon as it was day, the elders of the people and the chief priests and the scribes came together, and led Him into their council, saying, it was day — “it was daybreak The Scripture here is screaming! “John 19:14 couldn’t be the same time as in Luke 22:66!” THIS IS DAYBREAK! 6AM! DAWN! THE SIXTH HOUR IN JOHN 19:14 COULDN’T BE ROMAN TIME! “Jesus couldn’t be with the Sanhedrin here and inside the praetorium at the same time!THIS IS DAYBREAK! THIS IS ALREADY 6AM!

The Lord shall smite thee with madness, and blindness, and astonishment of heart; and thou shalt grope at noonday, as the blind gropeth in darkness. That was written for the children of Israel in Deuteronomy 28:28-29 that they should gropeth in the dark. But in the last days, all ten virgins of the endtime Laodicean church blind, wretched and naked are ALL groping in the light!

67 “Art thou the Christ? Tell us.” And He said unto them, “If I tell you, ye will not believe.

68 And if I also ask you, ye will not answer Me nor let Me go.

69 Hereafter shall the Son of Man sit on the right hand of the power of God.”

70 Then said they all, “Art thou then the Son of God?” And He said unto them, “Ye say that I am.”

71 And they said, “What need of any further witness? For we ourselves have heard it from his own mouth.”

Judas hung himself — 13th Nisan, Tuesday Morning (7:00-8:00 AM)

Matthew 27:3 Then Judas, who had betrayed Him, when he saw that He was condemned, repented and brought back the thirty pieces of silver to the chief priests and elders,

4 saying, “I have sinned in that I have betrayed the innocent blood.” And they said, “What is that to us? See thou to that!”

5 And he cast down the pieces of silver in the temple and departed, and went and hanged himself.

6 And the chief priests took the silver pieces and said, “It is not lawful to put them into the treasury, because it is the price of blood.”

7 And they took counsel and bought with them the potter’s field, to bury strangers in.

8 Therefore that field was called the Field of Blood unto this day.

9 Then was fulfilled that which was spoken by Jeremiah the prophet, saying, “And they took the thirty pieces of silver, the price of Him that was valued, whom they the children of Israel did value,

10 and gave them for the potter’s field, as the Lord appointed me.”

The Sanhedrin sent Him to Pilate — 13th Nisan, Tuesday Morning (8:30 AM)

Luke 23:1 And the whole multitude of them arose and led Him unto Pilate.

Before Pilate — 13th Nisan, Tuesday Morning (9:00 AM) — 3rd hour

John 18:28 Then they led Jesus from the house of Caiaphas to the praetorium (AMP, RSV, YLT, WEB). It was early. They themselves did not enter the praetorium, so that they might not be defiled, but might eat the passover. — the phases “they” from the “house of Caiaphas” would comprise the chief priests (Caiaphas and Annas), the captains of the temple (Lk 22:52) and their servants. Most in the CoG Communities identify these accusers as solely the Pharisees but evidence here shows this is erroneous.

The chief priests, the captains of the temple and their servants are all known to be Sadducees. This is another proof that the Sadducaic passover haven’t arrived, and they, too, didn’t want to defile themselves by entering a Gentile residence just before their passover where they would have kept it on night of the fourteenth!

This is a solid proof that that night could only be on THE THIRTEENTH!

29 So Pilate went out to them and said, “What accusation do you bring against this man?” 30 They answered him, “If this man were not an evildoer, we would not have handed him over.” — Pilate would have to come out of the praetorium to speak to the multitude and he did “So Pilate went out [of the praetorium] and said” to the crowd!

31 Pilate said to them, “Take him yourselves and judge him by your own law.” The Jews said to him, “It is not lawful for us to put any man to death.” 32 This was to fulfil the word which Jesus had spoken to show by what death he was to die.

33 Pilate entered the praetorium again and called Jesus, and said to him, “Are you the King of the Jews?” 34 Jesus answered, “Do you ask this of your own accord, or did others ask it to you about me?” — See, Pilate went back to the praetorium to speak to Jesus.

35 Pilate answered, “Am I a Jew? Your own nation and the chief priests have handed you over to me; what have you done?” 36 Jesus answered, “My kingship is not of this world; if my kingship were of this world, my servants would fight, that I might not be handed over to the Jews; but my kingship is not from the world.” — the chief priests were standing outside the praetorium. “They themselves did not enter the praetorium, so that they might not be defiled, but might eat the passover” (John 18:28). So the Sadducees haven’t had their passover yet!

37 Pilate said to him, “So you are a king?” Jesus answered, “You say that I am a king. For this I was born, and for this I have come into the world, to bear witness to the truth. Everyone who is of the truth hears my voice.” 

Praetorium - YouTube
Only Jesus was in the Praetorium, the Sadducaic Chief Priests stayed out!

38 Pilate said unto Him, “What is truth?” And when he said this, he went out [the praetorium] again unto the Jews, and said unto them, “I find in him no fault at all. 39 But ye have a custom that I should release unto you one at the Passover. Will ye therefore that I release unto you the King of the Jews?”

Most like to place the timing of this encounter with Pilate and Herod and then back to Pilate again early morning, around 5.30 to 8.30 AM. But this timing just couldn’t be so.

“How Dare You Trouble Me?” It would be inconceivable or even fanciful to think that Pilate as king of Judea could be troubled in the early morning by someone subordinate to him as traditional protocol demands. Pilate was known as a tyrant and would kill anybody at will those who displeased him. It would be far more reasonable to assume that he attended court at a reasonable hour starting at 9 AM the earliest.

Luke 23:2 And they began to accuse Him, saying, “We found this fellow perverting the nation and forbidding to give tribute to Caesar, saying that he himself is Christ, a king.”

Jesus before Pilate

3 And Pilate asked Him, saying, “Art thou the king of the Jews?” And He answered him and said, “Thou sayest it.”

4 Then said Pilate to the chief priests and the people, “I find no fault in this man.”

5 And they became the more fierce, saying, “He stirreth up the people, teaching throughout all Judea, beginning from Galilee to this place.” – this stirring includes raising Lazarus from the dead, infuriating the Sadducees more than the Pharisees.

The chief priests could include Annas’ five sons (1 Eleazar ben Ananus 16-17; 2 Jonathan 37; 3 Theophilus 37-41; 4 Matthias 43; 5 Ananus ben Ananus 63-66), who at later times, also held the high priest office. Annas’ son-in-law Caiaphas 18-36-37

More on

(3) Theophilus ben Ananus 37-41: “A growing belief points to Theophilus ben Ananus, High Priest of the Temple in Jerusalem from 37 to 41. In this tradition Theophilus would have been both a kohen and a Sadducee,” (Theophilus (biblical), Wikipedia).

(5) Ananus ben Ananus 63-66: Josephus’s account says “Ananus, who, as we have told you already, took the high priesthood, was a bold man in his temper, and very insolent; he was also of the sect of the Sadducees,” (Anti 20.9.1). Wikipedia says he was the Sadducaic high priest who ordered the execution by stoning of James the brother of Jesus. Ananus was deposed as the high priest in 66 and became one of the main leaders of the Great Revolt of Judea. But in 68, he was killed during the inter-rebel civil war in Jerusalem, (Ananus ben Ananus, Wikipedia).

Josephus provides us with more details of the death of the high priesthood toward the AD 66-70 inferno: “But the rage of the Idumeans was not satiated by these slaughters; but they now betook themselves to the city, and plundered every house, and slew every one they met; and for the other multitude, they esteemed it needless to go on with killing them, but they sought for the high priests, and the generality went with the greatest zeal against them; and as soon as they caught them they slew them, and then standing upon their dead bodies, in way of jest, upbraided Ananus with his kindness to the people, and Jesus with his speech made to them from the wall. Nay, they proceeded to that degree of impiety, as to cast away their dead bodies without burial, although the Jews used to take so much care of the burial of men, that they took down those that were condemned and crucified, and buried them before the going down of the sun. I should not mistake if I said that the death of Ananus was the beginning of the destruction of the city, and that from this very day may be dated the overthrow of her wall, and the ruin of her affairs, whereon they saw their high priest, and the procurer of their preservation, slain in the midst of their city,” (Wars. Book 4, Chapter 5).

Luke 23:6 When Pilate heard of Galilee, he asked whether the Man were a Galilean.

7 And as soon as he learned that He belonged unto Herod’s jurisdiction, he sent Him to Herod, who himself also was at Jerusalem at that time.

Before Herod — 13th Nisan, Tuesday Morning (10:00 AM) — 4th hour

8 And when Herod saw Jesus he was exceedingly glad, for he had been desirous to see Him for a long time, because he had heard many things about Him, and he hoped to see some miracle done by Him. — remember, in those days they only have runners in sending and receiving messages. And protocol required letters were properly written, signed and sealed before they were despatched. 

9 Then he questioned Him with many words, but He answered him nothing.

10 And the chief priests and scribes stood and vehemently accused Him.

11 And Herod, with his men of war, treated Him with contempt and mocked Him, and arrayed Him in a gorgeous robe and sent Him again to Pilate.

12 And on the same day, Pilate and Herod were made friends together, for before that there was enmity between them.

13 And Pilate, when he had called together the chief priests and the rulers and the people,

My Favourite Painting: Jeffrey Archer - Country Life
“I find no fault in this man,” said Pilate

14 said unto them, “Ye have brought this man unto me as one who perverteth the people. And behold, I, having examined him before you, have found no fault in this man concerning those things whereof ye accuse him.

15 No, nor yet Herod; for I sent you to him, and lo, nothing worthy of death is done unto him.

16 I will therefore chastise him and release him.” Only Pilate was to scourge Jesus (consistent with John 19:1; Matt 27:26; Mark 15:15)

17 (For of necessity he must release one unto them at the Feast.)

18 And they all cried out at once, saying, “Away with this man, and release unto us Barabbas”

19 (who had been cast into prison for a certain sedition made in the city, and for murder).

20 Pilate therefore, desiring to release Jesus, spoke again to them.

21 But they cried, saying, “Crucify him, crucify him!”

22 And he said unto them the third time, “Why? What evil hath he done? I have found no cause for death in him. I will therefore chastise him and let him go.” Only Pilate was to scourge Jesus (John 19:1; Matt 27:26; Mark 15:15). The Roman soldiers remained restraint.

23 But they were instant with loud voices, requiring that He might be crucified. And the voices of them and of the chief priests prevailed.

Pilate: Barabbas or Jesus — 13th Nisan, Tuesday Morning (11:00 AM) — 5th hour

Matthew 27:15 Now at that feast, the governor was wont to release unto the people a prisoner, whom they would.

John 18:39 But ye have a custom that I should release unto you one at the Passover. — Not a law, neither of God nor man’s, but a custom, so commentators have swam in an ocean on this point, but nothing to such custom or reason is known.

Pilgrims normally took their trips to Jerusalem early before the actual Passover took place, to secure an accommodation, to buy a lamb and also to purify themselves. The whole period is a Passover season. “And the Jews’ Passover was nigh at hand, and many went out of the country up to Jerusalem before the Passover to purify themselves.” John 11:55 

16 And they had then a notable prisoner called Barabbas.

17 Therefore when they were gathered together, Pilate said unto them, “Whom will ye that I release unto you: Barabbas, or Jesus who is called Christ?”

18 For he knew that for envy they had delivered Him.

19 When he had sat down on the judgment seat [inside the praetorium again], his wife sent unto him, saying, “Have thou nothing to do with that just man; for I have suffered many things this day in a dream because of him.”

20 But the chief priests and elders persuaded the multitude that they should ask for Barabbas and destroy Jesus. the chief priests were always deeply involved throughout, but stayed outside the praetorium with the multitude.

21 The governor answered and said unto them, “Which of the two will ye that I release unto you?” They said, “Barabbas!”

22 Pilate said unto them, “What shall I do then with Jesus, who is called Christ?” They all said unto him, “Let him be crucified!”

23 And the governor said, “Why, what evil hath he done?” But they cried out the more, saying, “Let him be crucified!”

24 When Pilate saw that he could not prevail, but rather that a tumult (disorderly agitation) was beginning, he took water and washed his hands before the multitude, saying, “I am innocent of the blood of this just person. See ye to it.”

25 Then answered all the people and said, “His blood be on us, and on our children!”

26 Then released he Barabbas unto them

“Crucify him! Crucify him!” — 13th Nisan, Tuesday (12 NOON) — 6th hour

John 19:1 Then Pilate therefore took Jesus and scourged Him [inside the praetorium].

Only Pilate scourged Jesus here (consistent with Matt 27:26; Mark 15:15); no mentioning of the soldiers doing the scourging before John 19:16.

2 And the soldiers plaited a crown of thorns and put it on His head, and they put on Him a purple robe

Crown Of Thorns Stock Footage ~ Royalty Free Stock Videos | Pond5

3 and said, “Hail, King of the Jews!” And they smote Him with their hands.

4 Pilate therefore went forth again and said unto them [to those outside the praetorium], “Behold, I bring him forth to you, that ye may know that I find no fault in him.”5 Then came Jesus [from inside the praetorium] forth, wearing the crown of thorns and the purple robe. And Pilate said unto them, “Behold the man!”

6 When therefore the chief priests and the officers saw Him, they cried out, saying, “Crucify him! Crucify him!” Pilate said unto them, “Ye take him and crucify him, for I find no fault in him.”

7 The Jews answered him, “We have a law, and by our law he ought to die, because he made himself the Son of God.”

8 When Pilate therefore heard that saying, he was the more afraid.

9 And he went again into the praetorium and said [in private] unto Jesus, “From whence art thou?” But Jesus gave him no answer.

10 Then said Pilate unto Him, “Speakest thou not unto me? Knowest thou not that I have power to crucify thee, and have power to release thee?”

11 Jesus answered, “Thou couldest have no power at all against Me, unless it were given thee from above. Therefore he (the chief priests) that delivered Me unto thee hath the greater sin.” — having the greater sin, the Sadducees (some Pharisees included) were wiped out in the AD 70 inferno! Also a result of “His blood be on us, and on our children!”

12 And from thenceforth Pilate sought to release Him, but the Jews cried out, saying, “If thou let this man go, thou art not Caesar’s friend. Whosoever maketh himself a king speaketh against Caesar.”

13 When Pilate therefore heard that saying, he brought Jesus forth and sat down in the judgment seat (in the praetorium) in a place that is called the Pavement, but in Hebrew, Gabbath – (an extended elevated pavement by itself in front of the praetorium. This must be the place where a final verdict was made).

14 And it was the Preparation of the Passover and about the sixth hour, and Pilate said unto the Jews, “Behold your king!” (NOON 13th Nisan)

This sixth hour would be the same sixth hour where Jesus talked with the Samaritan woman at the well, established to be at NOON, when Jesus was wearied and needed a drink (John 4:6). To think that John suddenly popped up Roman time to suit a belief is just trying to be fanciful.

Second, Roman times uses AM (ante meridiem, meaning before midday) and PM (post meridiem, meaning past midday) to denote time. So if John was using Roman time in John 19:14 why didn he use AM and PM? The Hours Usage in John 19:14 is definitly Jewish Reckoning. 

Thirdly, Luke 22:66 says “it was day” — Jesus was at the Sanhedrin at daybreak! He couldn’t be with the Sanhedrin here and inside the praetorium at the same time! “Ephraim compasseth me about with lies, and the house of Israel with deceit” (Hosea 11:12). And most CoG Communities are prone to lying!

John 19:15 But they cried out, “Away with him, away with him! Crucify him!” Pilate said unto them, “Shall I crucify your king?” The chief priests answered, “We have no king but Caesar!”

16 Then he delivered Him therefore unto them to be crucified. And they (the soldiers, a small number 50-60 say) took Jesus and led Him away.

Matt 27:27 Then the soldiers of the governor [personal soldiers] took Jesus into the praetorium, and gathered unto Him the whole detachment of soldiers. i.e. this small number of the governor’s soldiers led Jesus to the entire contingent of soldiers!

Gill: consisting of five hundred, and some say more: these their fellow soldiers, to whom Jesus was committed, got together “against him” as the Syriac and Persic versions render it.

The TPT version says “nearly six hundred soldiers.” Matthew Henry: (at least five hundred, some think twelve or thirteen hundred)

The soldiers, numbering 500-600, led Him away to be crucified, but first to be flogged, this time by the Roman soldiers, including more scourging and mocking — the missing hours, back at the praetorium (about 18 hours where there is no record of Him; from about NOON on the thirteenth to daybreak on the fourteenth of Nisan). And it is thus obvious that that evening, the evening where Jesus and His disciples were taking supper, were indeed a supper. There is no evidence of a Passover — no lamb, no bitter herbs — not even a Samaritan or a Sadducaic passover, where it would be on an early fourteenth of Nisan. Even the high priests (Annas and Caiapas), chief priests and other Sadducees stayed outside the praetorium lest they be defiled and wouldn’t be able to partake in their passover!

Image result for roman whip

The night before, while He prayed, His blood fell to the ground. He knew He would be flogged nearly to the point of death before they pounded the metal spikes into His flesh. He knew the prophetic words of Isaiah spoken seven centuries earlier that He would be beaten so badly that He would be “disfigured beyond that of any man” and “beyond human likeness” (Isaiah 52:14). 

Forerunner Commentary of the King James Version Isaiah 52:14:

Jesus had to die a death that was excruciatingly painful. Why? To depict the horrible pain that sin causes. It would not have served God’s purpose if He had died a painless death. The picture would have been incomplete.

Any criminal of that time would have despaired to learn he was to be crucified. Crucifixion was not only an execution, but also a method of torture. The Romans usually gave the victim an excruciating scourging first. Jesus was no exception. Before He ever touched His cross, He was scourged, beaten, and insulted.

Image result for roman whipping
Before 500-600 soldiers!

Over the years we have heard quite a bit about the Roman lictor (Roman officer), the soldier charged with dispensing this dreaded punishment. He used a whip, often with imbedded pieces of metal, bone, or other sharp objects. Romans did not limit their lictors to the Israelite practice of “forty stripes save one,” nor to striking just the victim’s back. He would let the whip strike and wrap around every inch of the person’s body until he was within an inch of death.

The prophet Isaiah prophesies how Jesus appeared after the scourging: “Just as many were astonished at you, so His visage [appearance] was marred more than any man, and His form more than the sons of men” (Isaiah 52:14). He goes on to say that He was “wounded [pierced] for our transgressions, He was bruised [crushed] for our iniquities” (Isaiah 53:5).

Just as there were many who were appalled at him — his appearance was so disfigured beyond that of any human being and his form marred beyond human likeness — Isaiah 52:14.

Many people were shocked when they saw him. He was so scarred that he no longer looked like a person. His body was so twisted that he did not look like a human being anymore (Isaiah 52:14).

And in Isaiah 53:7 Isaiah goes on to describe the servant who would suffer and die for the sin of his people “like a lamb that is led to the slaughter.”

The Jews were prophesied they would mourn One whom they had rejected: “And they shall look to Me whom they have pierced; then they shall mourn for him, as one mourns for an only son” (Zechariah 12:10). But the Christians have nothing to mourn? Currently these endtime virgins are described as lukewarm and in need of nothing, but would they not mourn when they realise that they had been blind, wretched and naked, seeing finally that Christ had suffered far more through His torn flesh and shed blood than they had ever realised? No? Regardless, these are they being described in Revelation 3:17. “As many as I love, I rebuke and chasten: or else I will spew thee out of My mouth (v16,19).”

The Lord shall smite thee with madness, and blindness, and astonishment of heart; and thou shalt grope at noonday, as the blind gropeth in darkness. That was written by Moses for the children of Israel in Deuteronomy 28. But at the endtime, all ten virgins of the Laodicean church — blind, wretched and naked — ALL THESE TEN VIRGINS ARE GROPIING IN THE LIGHT!

The next morning — 14th Nisan, Wednesday, Dawn (6:00 AM)

Luke 23:26 And as they led Him away, they laid hold upon one Simon, a Cyrenian, coming out of the country, and on him they laid the cross, that he might bear it after Jesus.

27 And there followed Him a great company of people, and of women who also bewailed and lamented Him.

28 But Jesus, turning unto them, said, “Daughters of Jerusalem, weep not for Me, but weep for yourselves and for your children.

29 For behold, the days are coming in which they shall say, ‘Blessed are the barren, and the wombs that never bore and the breasts which never gave suck.’

30 Then shall they begin to say to the mountains, ‘Fall on us!’ and to the hills, ‘Cover us!’

31 For if they do these things in a green tree, what shall be done in the dry?”

They led Him to be crucified — 14th Nisan, Wednesday (7:00 AM)  

John 19:16 Then he delivered Him therefore unto them to be crucified. And they took Jesus and led Him away.

17 And He, bearing His cross, went forth into a place called the Place of a Skull (which is called in the Hebrew, Golgotha)

The Third hour — 14th Nisan, Wednesday (9:00 AM) — 3rd hour

John 19:18 where they crucified Him and two others with Him, one on either side and Jesus in the midst. — here, Jesus was nailed to the cross, with two others besides Him

19 And Pilate wrote a title and put it on the cross. And the writing was: Jesus Of Nazareth The King Of The Jews.

20 Then many of the Jews read this title, for the place where Jesus was crucified was nigh to the city, and it was written in Hebrew and Greek and Latin.

21 Then said the chief priests of the Jews to Pilate, “Write not ‘The King of the Jews,’ but, ‘He said, I am King of the Jews.’”

22 Pilate answered, “What I have written, I have written.”

23 Then the soldiers, when they had crucified Jesus, took His garments and made four parts, to every soldier a part, and also His coat. Now the coat was without seam, woven from the top throughout.

24 They said therefore among themselves, “Let us not rend it, but cast lots for it, whose it shall be,” that the Scripture might be fulfilled which saith, “They parted My raiment among them, and for My vesture did they cast lots.” These things therefore the soldiers did.

Mark 15:25 And it was the third hour (9 AM) when they crucified Him.

29 And those who passed by railed at Him, wagging their heads and saying, “Ah, thou that destroyest the temple and buildest it in three days,

30 save thyself and come down from the cross!”

31 Likewise also the chief priests, mocking, said among themselves with the scribes, “He saved others; himself he cannot save!

32 Let Christ, the King of Israel, descend now from the cross, that we may see and believe.” And those who were crucified with Him reviled Him.

25 Now there stood by the cross of Jesus His mother and His mother’s sister, Mary the wife of Clopas, and Mary Magdalene.

26 When Jesus therefore saw His mother and the disciple standing by whom He loved, He said unto His mother, “Woman, behold thy son!”

27 Then said He to the disciple, “Behold thy mother!” And from that hour, that disciple took her unto his own home.

Mark 15:33 And when the sixth hour (12 NOON) had come, there was darkness over the whole land until the ninth hour (3 PM).

Luke 23:44 And it was about the sixth hour (12 NOON), and there was a darkness over all the earth until the ninth hour (3 PM). 45 And the sun was darkened, and the veil of the temple was rent in the midst.

See the source image

28 After this Jesus, knowing that all things were now accomplished, that the Scripture might be fulfilled, said, “I thirst.”

29 Now there was set there a vessel full of vinegar; and they filled a sponge with vinegar and put it upon a hyssop, and put it to His mouth.

Mark 15:34 And at the ninth hour (3 PM) Jesus cried out with a loud voice, saying, “Eloi, Eloi, lama sabachthani?” which is, being interpreted, “My God, My God, why hast Thou forsaken Me?”

35 And some of those who stood by, when they heard it, said, “Behold, he calleth Elijah.”

36 And one ran and filled a sponge full of vinegar, and put it on a reed and gave it to Him to drink, saying, “Let him alone. Let us see whether Elijah will come to take him down.”

37 And Jesus cried out with a loud voice, and gave up the ghost.

30 When Jesus therefore had received the vinegar, He said, “It is finished.” And He bowed His head and gave up the ghost.

Earthquakes and graves opened — 14th Nisan, Wednesday (3.00 PM) — 9th hour

Matthew 27:51 And behold, the veil of the temple was rent in two from the top to the bottom, and the earth quaked and the rocks rent.

52 And the graves were opened; and many bodies of the saints who slept arose,

53 and came out of the graves after His resurrection, and went into the Holy City and appeared unto many.

54 Now when the centurion, and those who were with him watching Jesus, saw the earthquake and those things that were done, they feared greatly, saying, “Truly, this was the Son of God!”

Preparation for the Passover — 14th Nisan, Wednesday (4:00 PM) — 10th hour

John 19:31 The Jews therefore, because it was the Preparation, and so that the bodies should not remain upon the cross on the Sabbath day (for that Sabbath day was a high day), besought Pilate that their legs might be broken and that they might be taken away.

32 Then came the soldiers and broke the legs of the first and of the other who was crucified with Him.

33 But when they came to Jesus and saw that He was dead already, they broke not His legs,

34 but one of the soldiers with a spear pierced His side, and forthwith there came out blood and water.

35 And he that saw it bore record, and his record is true, and he knoweth that he saith truly, that ye might believe.

36 For these things were done, that the Scripture should be fulfilled: “A bone of Him shall not be broken.”

37 And again another Scripture saith, “They shall look on Him whom they pierced.”

The women watched — 14th Nisan, Wednesday (4:30 PM)

Mark 15:40 There were also women looking on afar off, among whom were Mary Magdalene, and Mary the mother of James the Less and of Joses, and Salome

41 (who also, when He was in Galilee, had followed Him and ministered unto Him), and many other women who came up with Him unto Jerusalem.

Joseph of Arimathea — 14th Nisan, Wednesday (5:00 PM) — 11th hour

Mark 15:42 And now when the evening had come, because it was the Preparation (that is, the day before the Sabbath), — that Sabbath was a High Day, the beginning of the Feast of Unleavened Bread.

43 Joseph of Arimathea, an honorable council member who also was waiting for the Kingdom of God, came and went in boldly unto Pilate and asked for the body of Jesus.

44 And Pilate wondered if He were already dead; and calling unto him the centurion, he asked him whether He had been any while dead.

45 And when he learned it from the centurion, he gave the body to Joseph.

46 And Joseph bought fine linen, and took Him down and wrapped Him in the linen. And he laid Him in a sepulcher which was hewn out of a rock, and rolled a stone unto the door of the sepulcher.

47 And Mary Magdalene and Mary the mother of Joses beheld where He was laid.

~~~

End note: Luke 22:15-6. Here Jesus said to the disciples: 

 “With fervent desire I have desired to eat this Passover with you before I suffer; for I say to you, I will no longer eat of it until it is fulfilled in the kingdom of God.” 

What did He mean by saying “THIS Passover”? 

There are only two possibilities: 

1) He meant the upcoming Passover that very year, which had not yet arrived, as this statement was made “before the feast of the Passover” (John 13:1).

2) He meant that very meal that evening which they were partaking of – even though it was served with regular “bread,” makes no mention of lamb, or bitter herbs, which were required for a Passover meal. Second, if that meal was the Passover, Jesus and His disciples would have broken one of the Passover ordinances specified in Numbers 9:12 moving the bones out of the house and burned them in the morning.

Fred Coulter, whose book The Christian Passover is his church’s flagship and endorsed by most of the CoG Communities, specifies it this way:

 God’s commands to Moses in Exodus 12 show us the step-by-step procedures required for keeping the Old Testament Passover.  It is clear that the act of slaying the lambs was only one part of keeping the Passover.  The nine steps for keeping the Old Testament Passover were as follows: 

1) Select an unblemished male lamb less than one year old on the 10th day of the first month (Ex 12:3).
2) Kill the lamb on the 14th day of the first month at dusk [Hebrew ben ha arbayim, “between the two evenings”]. Share the lamb with a neighbor if one’s own family was too small to eat it. Do not break a bone of the lamb (Ex 12:4, 6, 46).

3) Strike the side posts and lintel of the door of the house with some of the blood (Ex 12:7).
4) Roast the whole lamb — head and legs and edible entrails — with fire (Ex 12:9).
5) Do not boil the meat in water or eat it raw (Ex 12:9).
6) Eat the flesh in that night with bitter herbs and unleavened bread (Ex 12:8).
7) Allow no alien to eat it unless circumcised (Ex 12:43-44).
8) Eat it in the same house where it was slain. Do not carry any of it out of the house (Ex 12:46).
9)
Burn any remains, such as the bones and fat, the skin and guts, with fire by morning (Ex 12:10). (The Christian Passover, pg 19)

These were the commands of God for Israel’s first Passover.  If the children of Israel had not observed all nine steps for the Passover exactly as God commanded, the Passover would not have been fully “kept,” and the Lord would not have spared the firstborn of Israel.

At their next Passover, the first one in the wilderness after the tabernacle was set up and dedicated, the nine rules for “keeping” the Passover are called statutes and ordinances: “Let the children of Israel also keep the Passover at its appointed time.  In the fourteenth day of this month, between the two evenings, you shall keep it in its appointed time. You shall keep it according to ALL ITS STATUTES, and according to ALL THE ORDINANCES of it” (Num. 9:2-3). 

This Scripture shows that the nine rules for the Passover, here called statutes and ordinances, were to be observed in all the years that followed.  All nine ordinances were to be observed on the 14th day of the month!  It is quite clear in Numbers 9 that all the statutes and all the ordinances that were established at the first Passover were to be observed by the children of Israel.  We find no later instructions given in Scripture that in any way alter or modify the manner in which the Passover was originally commanded to be observed. (The Christian Passover, pg 19-20)

And Fred’s statements are reemphasised further: 

“And none of you shall go out of the door of his house until morning [sunrise]” (Ex 12:21-22),” (pg 58).

And none of you shall go out of the door of his house until sunrise [Hebrew boqer]’ ” (Ex 12:21-22). (Pg 71)

“…And none of you shall go out of the door of his house UNTIL SUNRISE….And the children of Israel went away and did as the LORD had commanded Moses and Aaron, SO THEY DID” (Ex 12:22, 28).

“If any of the children of Israel had left their houses before morning, it would be recorded in the Scriptures that some of the people had disobeyed the command of God and had left their houses too soon, and therefore they had died in the plague of the firstborn.” (Pg 72)

The Blind couldn’t see, of course! If that night had been the Passover, that would make Jesus and His disciples break a Passover ordinance since they were only allowed to burn the bones and left their house in the morning, BUT THEY DIDN’T! 

What, then, did Jesus mean when He said, “With fervent desire I have desired to eat this Passover with you before I suffer”? The word for “desire” in this verse is an unusual word, epithumia in the Greek, and means “a longing, especially for that which is forbidden” (see Strong’s Exhaustive Concordance, #1939). 

The word for “desire” in this verse is very important to understanding the context of Jesus’ words. Says Thayer’s Greek-English Lexicon, “desire, craving, longing,” “specifically for what is forbidden.” This is the “strongest expression of intense desire,” whether good or bad, says the Jamieson, Fausset, Brown Critical-Experimental Commentary. 

In other words, Jesus here was saying He desired to eat the traditional Passover with His disciples that year, but He knew that such a thing will be impossible that it was forbidden that for Him to fulfill God’s PLAN He must be dead and in the grave the evening the Passover would be eaten, and therefore it was forbidden and impossible for Him to eat that Passover with them!

Second, Christ also wanted to avoid this “cup” of suffering that He knew He had to endure. He pleaded for three hours, but both requests were denied, forbidden.

Perhaps Luke 22:15-6 should be translated as:

“With fervent desire I have desired to eat this Passover with you before I suffer; but I’m saying to you now, I am forbidden and denied this privilege, and I will no longer eat with you until we’re all in the kingdom of God.” 

Conclusion: despite all the huffings and puffings arguing otherwise by the various CoG Communities, that night when Jesus and His disciples had their last supper, the same night He was betrayed, it wasn’t the Passover; it wasn’t on the Fourteenth night.  IT COULDN’T BE! — IT’S IMPOSSIBLE! It was just a supper as the Scriptures say, and to believe that that night was the Fourteenth is only a sweet FANCIFUL DREAM!

~~~~~

Operation Mockingbird “The CIA and the Media”

•June 23, 2021 • Leave a Comment
Seal of the Central Intelligence Agency.svg

So Much Of What The CIA Used To Do Covertly It Now Does Overtly by Caitlin Johnstone / June 22, 2021

In 1977 Carl Bernstein published an article titled “The CIA and the Media” reporting that the CIA had covertly infiltrated America’s most influential news outlets and had over 400 reporters who it considered assets in a program known as Operation Mockingbird. It was a major scandal, and rightly so. The news media are meant to report truthfully about what happens in the world, not manipulate public perception to suit the agendas of spooks and warmongers.

In a recent Fox News appearance by Glenn Greenwald he made an observation about the way the CIA used to have to infiltrate the media, but now just openly has US intelligence veterans in mainstream media punditry positions manipulating public perception.

Edward Snowden: CIA’s annual budget is $14.7B; the NSA’s is $10.8B

“If you go and Google, and I hope your viewers do, Operation Mockingbird, what you will find is that during the Cold War these agencies used to plot how to clandestinely manipulate the news media to disseminate propaganda to the American population,” Greenwald said. “They used to try to do it secretly. They don’t even do it secretly anymore. They don’t need Operation Mockingbird. They literally put John Brennan who works for NBC and James Clapper who works for CNN and tons of FBI agents right on the payroll of these news organizations. They now shape the news openly to manipulate and to deceive the American population.”

Wikipedia: John Brennan serves as a senior national security and intelligence analyst for NBC News and MSNBC

Nowadays the CIA collaboration happens right out in the open, and the public is too brainwashed and gaslit to even recognize this as scandalous. Immensely influential outlets like The New York Times uncritically pass on CIA disinfo which is then spun as fact by cable news pundits. The sole owner of The Washington Post is a CIA contractor, and WaPo has never once disclosed this conflict of interest when reporting on US intelligence agencies per standard journalistic protocol. Mass media outlets now openly employ intelligence agency veterans like John Brennan, James Clapper, Chuck Rosenberg, Michael Hayden, Frank Figliuzzi, Fran Townsend, Stephen Hall, Samantha Vinograd, Andrew McCabe, Josh Campbell, Asha Rangappa, Phil Mudd, James Gagliano, Jeremy Bash, Susan Hennessey, Ned Price and Rick Francona, as are known CIA assets like NBC’s Ken Dilanian, as are CIA interns like Anderson Cooper and CIA applicants like Tucker Carlson.

They’re just rubbing it in our faces now. Like they’re showing off.

And that’s just the media. We also see this flaunting behavior exhibited in the US government-funded National Endowment for Democracy (NED), a propaganda operation geared at sabotaging foreign governments not aligned with the US which according to its own founding officials was set up to do overtly what the CIA used to do covertly. The late author and commentator William Blum makes this clear:

Hong Kong protesters wave American flags asking for help - YouTube
Buyout Hong Kong protesters waving American flags / CBS Evening News, 8 Sept 2019

We see NED’s fingerprints all over pretty much any situation where the western power alliance needs to manage public perception about a CIA-targeted government, from Russia to Hong Kong to Xinjiang to the imperial propaganda operation known as Bellingcat.

“Ephraim compasseth me with lies, and the house of Israel with deceit” Hosea 11:12

“And I will cast you out of My sight, as I have cast out all your brethren, even the whole seed of Ephraim” Jeremiah 7:15 

COVID BioWeapon: Is this Made in the USA?

•June 21, 2021 • 9 Comments

The Covid BioWeapon: Made in the USA? Aimed at China and Iran?

The Unz Review, by MIKE WHITNEY AND RON UNZ • JUNE 15, 2021

“…..we are left with the strong likelihood that Covid came from a laboratory (and) was designed as a bioweapon… China was the intended target (and) America seems the likely source of the attack… The most likely suspects would be rogue elements of our national security establishment… The virus and its dispersal devices might have been obtained from Ft. Detrick and CIA operatives… would have been sent to Wuhan to release it.” Ron Unz, Editor of The Unz Review; from the text

If Covid-19 comes from a lab, then the Question is, which Lab?

Question 1– What makes your theory about the origins of SARS-CoV-2 so controversial, is not that it suggests that the pathogen was created in a lab, but that it is, in fact, a bioweapon that was deliberately released by US agents prosecuting a secret war on presumed enemies of the United States. Here’s the “money quote” from your article titled, “American Pravda: George Orwell’s Virus Lab-Leak”:

“…..we are left with the strong likelihood that Covid came from a laboratory along with a good possibility that it was designed as a bioweapon, yet we lack serious indications that any lab-leak occurred. So if the original Wuhan outbreak was due to the deployment of a powerful bioweapon but not one that had accidentally leaked from any lab, then surely China was the intended target, the victim rather than the perpetrator….

Given our ongoing military and geopolitical confrontation with China, America seems the likely source of the attack… The most likely suspects would be rogue elements of our national security establishment, probably some of the Deep State Neocons whom Trump had placed near the top of his administration.

This small handful of high-level plotters would have then drawn upon the resources of the American national security apparatus to actually carry out the operation. The virus and its dispersal devices might have been obtained from Ft. Detrick and CIA operatives or members of special forces would have been sent to Wuhan to release it…. In effect, what happened was a Dr. Strangelove-type scenario, but brought to real life.” (“American Pravda: George Orwell’s Virus Lab-Leak”, Ron Unz, The Unz Review)

Donald Trump's South Asia strategy working, says Mike Pompeo | World  News,The Indian Express
Mike Pompeo: “I was the CIA director. We lied, we cheated, we stole … we had entire training courses … It reminds you of the glory of the American experiment.”

So, here’s the question: Do you think recent developments lend credibility to your explosive theory or do you now believe that Covid-19 was merely “accidentally” leaked through human error?

Ron Unz– As everyone knows, over the last month the entire “mainstream narrative” of the Covid outbreak has been completely overturned. Just a few weeks ago, anyone suggesting the virus was artificial was denounced and ridiculed as a “conspiracy theorist” and any such statements were automatically banned by Facebook.

But exactly these same prohibited ideas are now widely accepted and promoted by leading figures in the media and political establishments. The 45-year veteran of the New York Times who spearheaded its Covid coverage has now admitted that he was completely mistaken, and that the virus probably came from a lab. The three billion Facebook users can now openly discuss this possibility.

The total collapse of this “natural virus” propaganda-bubble was produced by a self-published 11,000 word article by longtime science journalist Nicholas Wade. Yet the astonishing thing is that almost none of the crucial facts he cited in his article were new. Nearly all of Wade’s important evidence had been publicly available for a full year, but was simply ignored by our entire political and media establishment, partly because Trump took that position and they all hated Trump.

So the virus probably came from a lab. But the question now becomes “which lab?” Just as the MSM had promoted the totally unsubstantiated belief that Covid was natural, the MSM has now begun promoting the equally unsubstantiated belief that Covid accidentally leaked from China’s Wuhan Institute of Virology. However, the evidence of any such Wuhan lab-leak is so thin as to be almost invisible.

It’s true that Chinese researchers at that lab were experimenting with related bat viruses, but many American researchers were doing very similar experiments, and for decades bat viruses have also been the central focus of America’s huge biowarfare program.

Wuhan is an enormously large metropolis of 11 million, much larger than New York City, and the Wuhan lab is located 20 miles(!) from the Huanan Seafood Wholesale Market, which was the earliest epicenter of the Wuhan outbreak. A distance of 20 miles seems pretty far for an accidental lab-leak.

Immediately after the initial Wuhan outbreak, the virus began infecting Iran’s top political elites, and killing a number of them. Isn’t it implausible that a random lab-leak in Wuhan would so quickly jump to the Holy City of Qom on the other side of the world?

There are many other aspects of the timing of the outbreak that seem very inconsistent with a random, accidental lab-leak.

Until a few weeks ago, the MSM and Facebook shut down anyone who disagreed with the “natural virus” theory, even though the evidence for an artificial virus had always been much stronger. They’ve now said “Oops! We were wrong. The virus probably came from a lab.” So I think they’ll now have a much harder time shutting down any debate about which lab.

Once people became aware of the basic facts of the virus, belief that it was artificial natural quickly collapsed. And once people become aware of the basic facts of the initial Covid outbreak, I think that belief in an accidental lab-leak will also begin to collapse.

What is this Defense Intelligence Agency report that the US and all its allies received on the second week of November, 2019 ? Not Wuhan? Could we know?

Question 2–You seem to have anticipated my next question, but I’ll go ahead and ask it anyway. In another one of your articles, you say this:

“As the coronavirus gradually began to spread beyond China’s own borders, another development occurred that greatly multiplied my suspicions. Most of these early cases had occurred exactly where one might expect, among the East Asian countries bordering China. But by late February Iran had become the second epicenter of the global outbreak. Even more surprisingly, its political elites had been especially hard-hit, with a full 10% of the entire Iranian parliament soon infected and at least a dozen of its officials and politicians dying of the disease, including some who were quite senior. Indeed, Neocon activists on Twitter began gleefully noting that their hatred Iranian enemies were now dropping like flies.

Let us consider the implications of these facts. Across the entire world the only political elites that have yet suffered any significant human losses have been those of Iran, and they died at a very early stage, before significant outbreaks had even occurred almost anywhere else in the world outside China. Thus, we have America assassinating Iran’s top military commander on Jan. 2nd and then just a few weeks later large portions of the Iranian ruling elites became infected by a mysterious and deadly new virus, with many of them soon dying as a consequence. Could any rational individual possibly regard this as a mere coincidence?”

My question is this: Is this the smoking gun? In other words, do these two “attacks” on enemies of the United States strongly suggest Washington’s involvement?

Vice President Mike Pence speaks with Anthony Fauci, director of the National Institutes of Allergy and Infectious Diseases, at the White House as President Donald Trump declared the coronavirus pandemic a national emergency.
So much scheming, one narrative for the public, one in secret sharing only among themselves? To destroy China and Iran in one blast? No?

Ron Unz– Well, it’s certainly an *extremely* odd coincidence for those who claim the global Covid outbreak was caused by an accidental, random lab-leak of a virus in Wuhan, China.

Iran is on the other side of the world from China, and very few Chinese visit the Holy City of Qom. So it’s extremely strange that the Covid virus would have jumped so extremely quickly from a Wuhan lab-leak to Iran’s top political leadership, which suffered the next major outbreak.

A few weeks afterward, the third major world outbreak began in Northern Italy, but 200,000 Chinese live and work in that region, and many had just returned from their Lunar New Year holiday in China. The Chinese population in Qom is absolutely negligible by comparison. The Italian outbreak makes perfectly logical sense while the one in Qom does not.

None of this constitutes proof, but it raises huge doubts about the likelihood of the random lab-leak hypothesis. By contrast, the deliberate release of a viral bioweapon seems a much more plausible explanation of both these outbreaks.

America has the world’s largest and most comprehensive biowarfare program, and America’s two leading international adversaries—China and Iran—were almost simultaneously hit by a mysterious, deadly virus. Suspicion seems to point in a pretty obvious direction.

<<>>

For about a year, most experts had agreed that the Covid outbreak in Wuhan probably began in late October or early November of 2019. By a remarkable coincidence, there were 300 American military servicemen visiting Wuhan for the World Military Games, which ended in late October. That visit would have provided perfect cover for America to slip a couple of operatives into the group, and have them release the virus in the city. With thousands of foreign military personnel traveling around and doing sightseeing, any risk of detection would have been minimal. That seems much more plausible than the risk of finding and using local Chinese operatives.

What would Americans think if 300 Chinese military officers paid an extended visit to Chicago, and immediately afterwards a mysterious, deadly viral epidemic suddenly broke out in that city?

<<>>

In any event, our biological warfare capability certainly does exist, with the Ft. Detrick facility being our leading lab. Trump’s lackadaisical response once Covid began leaking back into the U.S. hardly suggests that he initially realized it might be a dangerous bioweapon, so he seems to have been entirely ignorant of the facts. Therefore, the attack against China (and Iran) would have been a rogue operation, probably carried out by elements of the national security apparatus associated with the Deep State Neocons at the top of his administration.

If someone sufficiently senior had been behind the plot, I think it would have been easy for the conspirators to have drawn upon America’s military resources to carry out the operation, with all those lower-level participants believing that they were part of a fully-authorized strike against America’s leading geopolitical adversaries, just as our government soon afterward assassinated Iran’s top military commander. Probably someone such as such as Secretary of State (and former CIA Director) Mike Pompeo or National Security Advisor John Bolton would have had been able to orchestrate the attack.

Such individuals had the means, motive, and opportunity, so it seems absurd for the media to so totally ignore this possibility.

Pompeo and Bolton's Middle East trip for Trump-Syria damage control - Vox
“Such individuals had the means, motive, and opportunity, so it seems absurd for the media to so totally ignore this possibility.”

<<>>

Most experts believe that the Covid outbreak in Wuhan probably began in late October or early November, but since infections took some time to spread and the virus was initially undetectable, no one in the Chinese government was aware of the outbreak until the end of December. However, several American government sources later revealed to ABC News that as early as November 2019, our Defense Intelligence Agency had distributed a secret report to government officials warning that a “cataclysmic” disease outbreak was taking place in Wuhan. The Pentagon afterwards denied the story, but Israeli TV independently confirmed that the report indeed existed and had been distributed to our NATO allies and Israel. The secret DIA report was prepared in “the second week of November,” at a time when probably only a couple of dozen people were starting to feel a little sick in Wuhan, a city of 11 million, and more than a month before anyone in the Chinese government discovered the outbreak. These facts seem almost impossible to explain if the virus was either natural or was accidentally leaked from the Wuhan lab.

Audio: https://www.unz.com/CONTENTS/AUDIO/kbarrett/KB-TJ_2021_0520-unz.mp3?_=2

FORT DETRICK – SOURCE of COVID-19?

“I know Ephraim, and Israel is not hid from Me; for now, O Ephraim, thou committest whoredom, and Israel is defiled” Hosea 5:3 

“Ephraim shall be desolate in the day of rebuke; among the tribes of Israel have I made known that which shall surely be” Hosea 5:9

JESUS’ LAST HOURS ON EARTH Part II

•June 20, 2021 • Leave a Comment

THE LAST HOURS of CHRIST on EARTH Part II

The CoG Communities have been trumpeting that after resurrection, Christ went to heaven to present Himself to His Father to be accepted as a sacrifice. They base their “evidence” on the waving of the mistranslation of “omar” as “wave sheaf” in Leviticus 23:11 “And he shall wave the sheaf before the Lord to be accepted for you; on the morrow after the Sabbath the priest shall wave it.” 

But where are the evidence? The timeline below shows that Jesus was hour-by-hour on the earth after being resurrected.

They led Him to be crucified — 14th Nisan, Wednesday (7:00 AM)
John 19:16 Then he delivered Him therefore unto them to be crucified. And they took Jesus and led Him away.
17 And He, bearing His cross, went forth into a place called the Place of a Skull (which is called in the Hebrew, Golgotha)

The Third hour — 14th Nisan, Wednesday (9:00 AM) — 3rd hour
John 19:18 where they crucified Him and two others with Him, one on either side and Jesus in the midst. — here, Jesus was nailed to the cross, with two others besides Him
19 And Pilate wrote a title and put it on the cross. And the writing was: Jesus Of Nazareth The King Of The Jews.
20 Then many of the Jews read this title, for the place where Jesus was crucified was nigh to the city, and it was written in Hebrew and Greek and Latin.
21 Then said the chief priests of the Jews to Pilate, “Write not ‘The King of the Jews,’ but, ‘He said, I am King of the Jews.’”
22 Pilate answered, “What I have written, I have written.”
23 Then the soldiers, when they had crucified Jesus, took His garments and made four parts, to every soldier a part, and also His coat. Now the coat was without seam, woven from the top throughout.
24 They said therefore among themselves, “Let us not rend it, but cast lots for it, whose it shall be,” that the Scripture might be fulfilled which saith, “They parted My raiment among them, and for My vesture did they cast lots.” These things therefore the soldiers did.

Mark 15:25 And it was the third hour (9 AM) when they crucified Him.

29 And those who passed by railed at Him, wagging their heads and saying, “Ah, thou that destroyest the temple and buildest it in three days,
30 save thyself and come down from the cross!”
31 Likewise also the chief priests, mocking, said among themselves with the scribes, “He saved others; himself he cannot save!
32 Let Christ, the King of Israel, descend now from the cross, that we may see and believe.” And those who were crucified with Him reviled Him.
25 Now there stood by the cross of Jesus His mother and His mother’s sister, Mary the wife of Clopas, and Mary Magdalene.
26 When Jesus therefore saw His mother and the disciple standing by whom He loved, He said unto His mother, “Woman, behold thy son!”
27 Then said He to the disciple, “Behold thy mother!” And from that hour, that disciple took her unto his own home.

Mark 15:33 And when the sixth hour (12 NOON) had come, there was darkness over the whole land until the ninth hour (3 PM).
Luke 23:44 And it was about the sixth hour (12 NOON), and there was a darkness over all the earth until the ninth hour (3 PM). 45 And the sun was darkened, and the veil of the temple was rent in the midst.

28 After this Jesus, knowing that all things were now accomplished, that the Scripture might be fulfilled, said, “I thirst.”
29 Now there was set there a vessel full of vinegar; and they filled a sponge with vinegar and put it upon a hyssop, and put it to His mouth.

See the source image

Mark 15:34 And at the ninth hour (3 PM) Jesus cried out with a loud voice, saying, “Eloi, Eloi, lama sabachthani?” which is, being interpreted, “My God, My God, why hast Thou forsaken Me?”
35 And some of those who stood by, when they heard it, said, “Behold, he calleth Elijah.”
36 And one ran and filled a sponge full of vinegar, and put it on a reed and gave it to Him to drink, saying, “Let him alone. Let us see whether Elijah will come to take him down.”
37 And Jesus cried out with a loud voice, and gave up the ghost.

30 When Jesus therefore had received the vinegar, He said, “It is finished.” And He bowed His head and gave up the ghost.

Earthquakes and graves opened — 14th Nisan, Wednesday (3.00 PM) — 9th hour
Matthew 27:51 And behold, the veil of the temple was rented in two from the top to the bottom, and the earth quaked and the rocks rent.
52 And the graves were opened; and many bodies of the saints who slept arose,
53 and came out of the graves after His resurrection, and went into the Holy City and appeared unto many.
54 Now when the centurion, and those who were with him watching Jesus, saw the earthquake and those things that were done, they feared greatly, saying, “Truly, this was the Son of God!”

Preparation for the Passover — 14th Nisan, Wednesday (4:00 PM) — 10th hour
John 19:31 The Jews therefore, because it was the Preparation, and so that the bodies should not remain upon the cross on the Sabbath day (for that Sabbath day was a high day), besought Pilate that their legs might be broken and that they might be taken away.
32 Then came the soldiers and broke the legs of the first and of the other who was crucified with Him.
33 But when they came to Jesus and saw that He was dead already, they broke not His legs,
34 but one of the soldiers with a spear pierced His side, and forthwith there came out blood and water.
35 And he that saw it bore record, and his record is true, and he knoweth that he saith truly, that ye might believe.
36 For these things were done, that the Scripture should be fulfilled: “A bone of Him shall not be broken.”
37 And again another Scripture saith, “They shall look on Him whom they pierced.”

The women watched — 14th Nisan, Wednesday (4:30 PM)
Mark 15:40 There were also women looking on afar off, among whom were Mary Magdalene, and Mary the mother of James the Less and of Joses, and Salome
41 (who also, when He was in Galilee, had followed Him and ministered unto Him), and many other women who came up with Him unto Jerusalem.

Joseph of Arimathea — 14th Nisan, Wednesday (5:00 PM) — 11th hour
Mark 15:42 And now when the evening had come, because it was the Preparation (that is, the day before the Sabbath), — that Sabbath was a High Day, the beginning of the Feast of Unleavened Bread.
43 Joseph of Arimathea, an honorable council member who also was waiting for the Kingdom of God, came and went in boldly unto Pilate and asked for the body of Jesus.
44 And Pilate wondered if He were already dead; and calling unto him the centurion, he asked him whether He had been any while dead.
45 And when he learned it from the centurion, he gave the body to Joseph.
46 And Joseph bought fine linen, and took Him down and wrapped Him in the linen. And he laid Him in a sepulcher which was hewn out of a rock, and rolled a stone unto the door of the sepulcher.
47 And Mary Magdalene and Mary the mother of Joses beheld where He was laid.

~~~

First Day of Unleavened Bread — 15th Nisan, Thursday (9:00 AM) — 3rd hour
Matthew 27:62 Now the next day, that following the Day of the Preparation, the chief priests and Pharisees came together unto Pilate,
63 saying, “Sir, we remember that that deceiver said while he was yet alive, ‘After three days I will rise again.’
64 Command therefore that the sepulcher be made secure until the third day, lest his disciples come by night and steal him away, and say unto the people, ‘He is risen from the dead,’ so that the last error shall be worse than the first.”
65 Pilate said unto them, “Ye have a watch. Go your way, make it as secure as ye can.”
66 So they went and made the sepulcher secure, sealing the stone and setting up a watch.

Thursday Evening — Beginning of 16th Nisan (7:00 PM) — 1st watch
Mark 16:1 And when the Sabbath was past, Mary Magdalene and Mary the mother of James, and Salome bought sweet spices, so that they might come and anoint Him.

Friday Afternoon — Afternoon of 16th (1-5 PM) to Beginning of 17th (6 PM)
Luke 23:56 And they returned and prepared spices and ointments, and rested the Sabbath day according to the commandment. — resting on the weekly Sabbath

Saturday Evenings — End of 17th (5-6 PM) to the Dawn of 18th (6-7 PM)
Matthew 28:1 At the end of the Sabbath (G4521, sab’-bat-on), as it began to dawn toward the first day of the week (G4521, sab’-bat-on), came Mary Magdalene and the other Mary to see the sepulcher. — Dawn is the beginning (of the 24-hr day), so that the three days and nights remain intact.

The Proper translation should be: At the end of the Sabbath, as it began to dawn toward the beginning of [a new] week (G4521, sab’-bat-on), came Mary Magdalene and the other Mary to see the sepulcher.

2 And behold, there was a great earthquake, for the angel of the Lord descended from Heaven, and came and rolled back the stone from the door, and sat upon it.
3 His countenance was like lightning, and his raiment white as snow.
4 And for fear of him the guards shook and became as dead men.
5 And the angel answered and said unto the women, “Fear ye not, for I know that ye seek Jesus, who was crucified.
6 He is not here, for He is risen, as He said. Come, see the place where the Lord lay.
7 And go quickly and tell His disciples that He is risen from the dead, and behold, He goeth before you into Galilee. There shall ye see Him. Lo, I have told you.”

Sunday Morning — Dawn of 18th of Nisan (4-5 AM)
Mark 16:2 And very early in the morning on the first day of the week (beginning of a new week G4521, sab’-bat-on), they came unto the sepulcher at the rising of the sun.
3 And they said among themselves, “Who shall roll us away the stone from the door of the sepulcher?”
4 And when they looked, they saw that the stone was rolled away, for it was very large.
5 And entering into the sepulcher, they saw a young man sitting on the right side, clothed in a long white garment; and they were frightened. — no mentioning that his countenance was like lightning. Also, Luke account (Luke 24:4) says they saw two men stood by them, not one sitting; John account of two angels both sitting, one at each end of Christ tomb:

Luke 24:4 And it came to pass, as they were much perplexed about this, behold, two men stood by them in shining garments.
5 And as they were afraid and bowed down their faces to the earth, they said unto them, “Why seek ye the living among the dead?
6 He is not here, but has risen! Remember how He spoke unto you when He was yet in Galilee,
7 saying, ‘The Son of Man must be delivered into the hands of sinful men and be crucified, and the third day rise again.’”
8 And they remembered His words,

6 And he said unto them, “Be not afraid. Ye seek Jesus of Nazareth, who was crucified. He is risen! He is not here. Behold the place where they laid Him.
7 But go your way. Tell His disciples and Peter that He goeth before you into Galilee. There shall ye see Him, as He said unto you.”

Luke 24:9 and returned from the sepulcher and told all these things unto the eleven and to all the rest.
10 It was Mary Magdalene and Joanna and Mary the mother of James, and other women who were with them, who told these things unto the apostles.
11 And their words seemed to them as idle tales, and they believed them not.

Sunday Morning — Morning of 18th Nisan (7-8 AM)
John 20:2 Then she ran and came to Simon Peter and to the other disciple (Most guessed him as John), whom Jesus loved, and said unto them, “They have taken away the Lord out of the sepulcher, and we know not where they have laid Him!”
3 Peter therefore went forth, and that other disciple, and came to the sepulcher.
4 And they both ran together, and the other disciple outran Peter and came first to the sepulcher.
5 And stooping down and looking in, he saw the linen cloth lying, yet he went not in.
6 Then came Simon Peter following him, and went into the sepulcher and saw the linen cloths as they lay
7 and the napkin that had been about His head, not lying with the linen cloths, but wrapped together in a place by itself.
8 Then the other disciple, who came first to the sepulcher, went in also; and he saw, and believed.
9 For as yet they knew not the Scripture, that He must rise again from the dead. — none of the angels appeared to the men.
10 Then the disciples went away again unto their own home (went back to where they were staying in Jerusalem).

Sunday Morning — Morning of 18th Nisan (9-10 AM)
John 20:11 But Mary stood outside at the sepulcher weeping, and as she wept she stooped down and looked into the sepulcher,
12 and saw two angels in white, sitting one at the head and the other at the feet where the body of Jesus had lain.
13 And they said unto her, “Woman, why weepest thou?” She said unto them, “Because they have taken away my Lord, and I know not where they have laid Him.”
14 And when she had thus said, she turned around and saw Jesus standing, and knew not that it was Jesus.
15 Jesus said unto her, “Woman, why weepest thou? Whom seekest thou?” She, supposing Him to be the gardener, said unto Him, “Sir, if thou have borne Him hence, tell me where thou hast laid Him, and I will take Him away.”
16 Jesus said unto her, “Mary!” She turned herself and said unto Him, “Rabboni!” (which is to say, “Master”).
17 Jesus said unto her, “Touch Me not, for I am not yet ascended to My Father; but go to My brethren and say unto them, ‘I ascend unto My Father and your Father, and to My God and your God.’” — Do not cling to Me

MEV Jesus said to her, “Stop holding on to Me, for I have not yet ascended to My Father. But go to My brothers and tell them, ‘I am ascending to My Father and your Father, to My God and your God.’ ”
to them, I am ascending to my Father and your Father, to my God and your God.”
NASB Jesus said to her, “Stop clinging to Me, for I have not yet ascended to the Father; but go to My brothers and say to them, ‘I am ascending to My Father and your Father, and My God and your God.’”
CJB “Stop holding onto me,” Yeshua said to her, “because I haven’t yet gone back to the Father. But go to my brothers, and tell them that I am going back to my Father and your Father, to my God and your God.”

18 Mary Magdalene came and told the disciples that she had seen the Lord, and that He had spoken these things unto her.

Sunday Morning — Morning of 18th Nisan (10-11 AM)
Matthew 28:8 And they departed quickly from the sepulcher with fear and great joy, and ran to bring His disciples word. — “Great joy” because they had seen the resurrected Jesus.
9 And as they went to tell His disciples, behold, Jesus met them, saying, “All hail.” And they came, and held Him by the feet, and worshiped Him. — see, they held Him by the feet a few moments later!
10 Then said Jesus unto them, “Be not afraid. Go tell My brethren to go into Galilee, and there shall they see Me.” — Note the different terms: Disciples don’t necessarily include brethren.

Sunday Noon — Noon of 18th Nisan (12:00 Noon)
Matthew 28:11 Now when they were going, behold, some of the guards came into the city and reported unto the chief priests all the things that were done.
12 And when they were assembled with the elders and had taken counsel, they gave a large sum of money unto the soldiers,
13 saying, “Say ye, ‘His disciples came by night and stole him away while we slept.’
14 And if this come to the governor’s ears, we will persuade him and secure you.”
15 So they took the money, and did as they were taught; and this account is commonly reported among the Jews until this day.

Sunday Afternoon — Afternoon of 18th Nisan (2:00 – 5:30 PM)
Luke 24:13 And behold, two of them were going that same day to a village called Emmaus, which was from Jerusalem about seven miles. — typically, adults walk at a speed of 3 to 4 miles per hour, and therefore seven miles would be about two hours, but they were talking so a bit slower.
14 And they talked together of all these things which had happened.
15 And it came to pass that while they communed and reasoned together, Jesus Himself drew near and went with them.
16 But their eyes were held, that they should not know Him.
17 And He said unto them, “What manner of communications are these that ye have one to another as ye walk and are sad?”
18 And one of them, whose name was Cleopas, answering said unto Him, “Art thou only a stranger in Jerusalem, and hast not known the things which have come to pass there in these days?”
19 And He said unto them, “What things?” And they said unto Him, “Concerning Jesus of Nazareth, who was a prophet mighty in deed and word before God and all the people;
20 and how the chief priests and our rulers delivered Him to be condemned to death and have crucified Him.
21 But we trusted that it had been He who should have redeemed Israel. And besides all this, today is the third day since these things were done.
22 Yea, and certain women also of our company, who were early at the sepulcher, made us astonished.
23 And when they found not His body, they came saying that they had also seen a vision of angels, who said that He was alive.
24 And certain of those who were with us went to the sepulcher and found it even so as the women had said, but Him they saw not.”
25 Then He said unto them, “O fools, and slow of heart to believe all that the prophets have spoken!
26 Ought not Christ to have suffered these things and to enter into His glory?”
27 And beginning with Moses and all the prophets, He expounded unto them in all the Scriptures the things concerning Himself.
28 And they drew nigh unto the village whither they were going, and He made as though He would have gone further.
29 But they constrained Him, saying, “Abide with us, for it is toward evening and the day is far spent.” And He went in to tarry with them. — this is likely to be getting dark 5:30 PM
30 And it came to pass, as He sat at meat with them, He took bread and blessed it, and broke and gave it to them.
31 And their eyes were opened and they knew Him. And He vanished out of their sight.
32 And they said to one another, “Did not our hearts burn within us while He talked with us on the way and while He opened to us the Scriptures?”

Sunday Evening — Evening of 19th Nisan (6:00 – 7:30 PM)
Luke 24:33 And they rose up that same hour and returned to Jerusalem, and found the eleven gathered together and those who were with them,
34 saying, “The Lord is risen indeed and hath appeared to Simon!” — and John perhaps
35 And they told what things were done on the way, and how He was known to them in the breaking of bread.

Sunday Evening — Evening of 19th Nisan (10:00 – 11:00 PM)
Luke 24:36 And as they thus spoke, Jesus Himself stood in the midst of them and said unto them, “Peace be unto you.”
37 But they were terrified and afraid, and supposed that they had seen a spirit.
38 And He said unto them, “Why are ye troubled, and why do thoughts arise in your hearts?
39 Behold My hands and My feet, that it is I Myself. Handle Me and see, for a spirit hath not flesh and bones, as ye see Me to have.”
40 And when He had thus spoken, He showed them His hands and His feet.
John 20:20 And when He had so said, He showed unto them His hands and His side. Then were the disciples glad when they saw the Lord.
21 Then said Jesus to them again, “Peace be unto you. As My Father hath sent Me, even so send I you.”
22 And when He had said this, He breathed on them and said unto them, “Receive ye the Holy Ghost.

41 And while they yet believed not for joy, and wondered, He said unto them, “Have ye here any meat?”
42 And they gave Him a piece of a broiled fish and of a honeycomb.
43 And He took it and ate before them. — If Christ had gone to heaven and been accepted by the Father, they didn’t even give Him a meal, poor thing! Moses’ face turned white radiating with the glory of God, making the Israelites afraid to come near him, but nothing about Jesus’ face radiating white after He had returned if He had appeared before the glory of His Father. Perhaps His sacrifice wasn’t accepted, lol!
44 And He said unto them, “These are the words which I spoke unto you while I was yet with you, that all things must be fulfilled which were written in the Law of Moses and in the Prophets and in the Psalms concerning Me.”
45 Then opened He their understanding, that they might understand the Scriptures,
46 and said unto them, “Thus it is written, and thus it behooved Christ to suffer and to rise from the dead the third day,
47 and that repentance and remission of sins should be preached in His name among all nations, beginning at Jerusalem.
48 And ye are witnesses of these things. — Jesus told them many things, but He didn’t tell them that He had gone to heaven and had been accepted by the Father. Perhaps He forgot!

Conclusion: The hour-by-hour timeline above doesn’t support that the resurrected Christ had gone up to heaven and be accepted by the Father. Second, the Lamb in Leviticus 23:12 wasn’t waved! Weird! Why wasn’t this Lamb waved if it were to represent Christ? Third, if waving means going up to heaven and back, then why the 3000 new converts on Pentecost (Acts 2) didn’t similarly go up to heaven as they were also waved (Lev 23:20), each should be giving warning the others “don’t touch me” along the way up and back from heaven on that day of Pentecost, wouldn’t they?

This timeline above is conclusive. The end-time CoG Communities have had their share of nonsensical interpretations which have caused great delusions among themselves. Most of these Blind Guides didn’t even notice the Lamb in Leviticus 23:12! It is nice to believe that Christ was waved and accepted by the Father before the Throne in heaven, but where are the evidence? Not a single one is given. 

Instead the CoG Communities have been infiltrated by the long arms of the sun-worshipping Samaritans to pin down Shavuot on Sundays as they have succeeded in pinning the weekly Sabbath on Sundays with the same success. Now this Samaritan-inspired “White Sunday Pentecost” or “Whitsunday Pentecost” doctrine is a well-entrenched ideology within the CoG Communities!

~~~~~

A Study Index of Fred Coulter’s Passover

•June 19, 2021 • Leave a Comment

A Study Index of Fred Coulter’s Book — “The Christian Passover

What Does Passover Mean? When Should Passover Be Observed — the 14th or the 15th? 

The Christian Passover
By Fred R. Coulter 
York Publishing Company
Third Edition 2010 

With over 50 years in the ministry, Fred Coulter has written a comprehensive book on Passover and since then has been the flagship for those who keep Passover on the early fourteenth of Nisan. His book is now over 28 years, spread over three editions, and claimed to have covered all and every issue of the Passover. There is much truth in this claim, so this series of critiques follow his order of Passover issues in his book. Readers can study these critiques from (a) to (l) — from Chapter One to Chapter Nineteen.

On the issue of erev it is defined by the Orthodoxy as “after noon and until nightfall.” Between the two eves (erevs) is the time between the eve of the first decline of the day and the eve of the onset of the night. There are two evenings, one from the time the sun begins to decline, the other is after the sun has gone down. 

Day / Night | Learn english, English vocabulary, Telling time in english
The time between the eve of the First Evening and eve of the Second Evening is the time “between the two evenings.”

To put it another way: “between the two evenings” is from the time when the sun begins to incline towards the west, which is from the sixth hour [noon or 12 o’clock] and onwards. It is erevim [plural – “evenings”] because there are TWO EVENINGS, for “between the two evenings” is from the time that the sun begins to decline as one evening, and the other evening is after the sun has GONE DOWN.

Fred Coulter has addressed this issue at great length. Of course, like most in the CoG Communities, he has a contrary view.

So all of the critiques of Fred Coulter’s Passover issues are in this Blog site HERE:

Table of Contents

Chapter One   

Passover, its Importance a Matter of Life and Death
— “to eat the Passover” — Exodus 12:43;
— “to kill the Passover” — Exodus 12:21, II Chronicles 35:6;
— “to sacrifice the Passover” — Deuteronomy 16:2;
— “to roast the Passover” — II Chronicles 35:13.

Chapter Two   

The Real Meaning of “Passover”
— and when I see the blood, I will “pass over” (H6452) you Ex 12:13; the Lord will pass over (H6452) the door Ex 12:23; or
— it is the Lord’S Passover H6453 Ex 12:11.
The Ordinances of keeping the Passover

     A Critique of Chapter One and Two (a) HERE ~ ~

Chapter Three   

What is Ben Ha Arbayim (H6153) — “Between the Two Evenings”
— dusk? twilight?
— “after noon and until nightfall”?

Chapter Four   

What is ba erev — at even?
What is ben ha arbayim — between the evening?
— is ben ha arbayim immediately follows erev?
What are all the Passover Ordinances?

    A Critique of Chapter Three and Four (b) HERE ~ ~

Chapter Five   

What is Evening (erev) and Morning (boqer)?
Exodus 16 and Numbers 11 — the Quails and Manna
How is Erev Different from Ben Ha Arbayim?

    A Critique of Chapter Five (c) HERE ~ ~

Chapter Six   

“At sunset, or ba erev, is a very short period of time.” Is it no more than 3-5 minutes?
“The length of time for ben ha arbayim varies around 30-40 minutes?”

Chapter Seven   

Who are behind Everett Fox translation and Schocken Books?
And Schocken Bible?
What Does “Night” (Lailah) and “Morning” (Boqer) Mean?

    A Critique of Chapter Six and Seven (d) HERE ~ —— ~

Chapter Eight 

The Exodus Passover and the Feast of Unleavened Bread
Are they distinct or composite Feast/s?

Chapter Nine   

Did any of the Ordinances change after Exodus?
Are Blood from any Sacrifices Required to be Sprinkled at the Altar?

    A Critique of Chapter Eight and Nine (e) HERE ~ —— ~

Chapter Ten  

Changes in the Old Testament Passover Observance
Was the Passover Killed on an Early or a Late 14th Nisan?
Who exerted Passover and the Unleavened as separate Feasts?
Testimonies from Jewish “Authorities” — Who Are They?

    A Critique of Chapter Ten (f) HERE ~ —— ~

Chapter Eleven   

The Fallouts of Jeroboam’s refusal Jerusalem as Center of Worship
Composite nature of Passover even in Exodus 12!
The Reform Movement — Fleeing from the “Bondage of Judaism”

   A Critique of Chapter Eleven (g) HERE ~ —— ~

Chapter Twelve 

When was a Centralised Passover Instituted?
Was the Temple Passover instituted by King Hezekiah?

  Chapter Thirteen   

Did King Josiah forged a Centralised Temple Passover service?

    A Critique of Chapter Twelve and Eleven (h) HERE ~ —— ~

Chapter Fourteen   

Why the Composite Character in Deuteronomy 16?
Was Deuteronomy 16 Edited or Forged by Ezra?
The Birth and Testimony of the Aramaic Targum

Chapter Fifteen

How the Samaritans infiltrated the Jewish Community
More on Deuteronomy 16 being “Edited” or “Forged”

       A Critique of Chapter Fourteen and Fifteen (i) HERE  ~ —— ~

Chapter Sixteen   

Why was Passover not Practiced in Babylon for the Exiled?
Was Jerusalem the only Place to offer a Sacrifice?
Was Passover also a Sacrifice?

Chapter Seventeen 

The Testimonies from the Targum and Josephus
Leviticus 17 Any Sacrifice inside or outside the Camp
Deuteronomy 16:1-8 A Comparison with the Samaritan Version

     A Critique of Chapter Sixteen and Seventeen (j) HERE  ~ —— ~

Chapter Eighteen

Had Ezra instituted any New Passover Law?
Would endtime “Generation of vipers” be Cast into the Fire?
Why did John express Passover as the “Passover of the Jews”?

    A Critique of Chapter Eighteen (k) HERE ~ —— ~

Chapter Nineteen

Jesus’ Last Supper — Was that Meal a Passover?
If so, how about any Food Remains (Number 9:12)?
John 19:14 — What Time was the Sixth Hour?
Did Jesus keep the Passover? Or
Was He Offering Himself as the Passover?
Could the 70 AD Inferno be a Microcosm of the Great Tribulation?

    A Critique of Chapter Nineteen (l) HERE ~ —— ~

Appendix A JESUS’ MISSING HOURS Part I

JESUS’ LAST HOURS — timeline of Christ’s Hours Before He died
Was That Meal a Passover Meal?
Luke 22:15 — What about Jesus’ Desire to eat “this Passover”?
Could That Night had been the Fourteenth?
Why even the Sadducaic Chief Priests stay outside the Praetorium?
If John was using John 19:14 Roman time what about Luke 22:66?


For a Full Timeline Analysis, Click HERE  ~ —— ~

Appendix B JESUS’ MISSING HOURS Part II

After RESURRECTION — Did Christ went up to Heaven and Back?

For a Full Timeline Analysis, Click HERE  ~ —— ~

~~~~~

NATO Leaders Losing their Ways in a Maze

•June 18, 2021 • Leave a Comment

NATO leaders see rising threats from China, but not eye to eye with each other

POLITICO Reports / June 18, 2021

Tough words about Beijing in summit communiqué but less consensus among allies about what to do.

Nato leaders fret China's Atlantic ambitions | Financial Times
President Biden fret about China’s Indo-Pacific and Atlantic ambitions

Boasting of restored unity thanks to the arrival of US President Joe Biden, NATO leaders on Monday declared that China poses increasing dangers to the security of Western democracies. But they revealed deep disagreements over the urgency in confronting Beijing, or even if it should be NATO’s role at all.

In their closing communiqué of an afternoon summit at NATO headquarters in Brussels, the leaders used remarkably forceful language to describe China as their most troublesome rival after Russia — given Beijing’s fast-expanding nuclear arsenal, stepped-up military cooperation with Moscow, and increasing use of disinformation.

“China’s stated ambitions and assertive behavior present systemic challenges to the rules-based international order and to areas relevant to Alliance security,” the leaders wrote. “We are concerned by those coercive policies which stand in contrast to the fundamental values enshrined in the Washington Treaty,” NATO’s founding charter.

The historic shift in focus comes partly at the urging of Biden, who has made clear he sees China as a growing threat. And NATO Secretary-General Jens Stoltenberg, eager to please the richest and most powerful ally, has taken up the charge.

NATO leaders declare China a global security challenge
China is seen entering the North Atlantic thus NATO leaders declare China a new global security challenge! “Be afraid,” says David Goldman. “Be very afraid.”

Stoltenberg stressed that China was “not an adversary” but posed challenges that must be answered, and he insisted that NATO was not shifting operations to Asia but protecting itself close to home.

“This is about taking care of a core responsibility to be able to protect and defend all allies against any threat from any direction,” Stoltenberg said at his closing news conference. “Because we see China is coming closer to us in cyberspace, we see them in Africa, we see them in the Arctic, we see them trying to control our infrastructure, we had the discussion about 5G.”

He noted that the first-ever mention of China in a NATO leaders’ communiqué was from a summit in London in December 2019. “Before that, we didn’t have any language at all,” he said. “In the current Strategic Concept, China is not mentioned with a single word. Now, you can read a communiqué and you see that we have seen a convergence of views among allies.”

But there didn’t seem to be much convergence when French President Emmanuel Macron spoke to reporters just minutes later.

“On China, as I said during the meeting, I think I can say we shouldn’t confuse our goals,” Macron said. “NATO is a military organization, the issue of our relationship with China isn’t just a military issue. NATO is an organization that concerns the North Atlantic, China has little to do with the North Atlantic.”

“So, it’s very important that we don’t scatter ourselves and that we don’t bias our relationship with China,” he continued. “It is much larger than just the military issue. It is economic. It is strategic. It is about values. It is technological. And we should avoid distracting NATO which already has many challenges.”

Emmanuel Macron, the French presidency and a colonial controversy
Macron: “For my part, China isn’t part of the Atlantic, or perhaps my map is off.” 

Chancellor Angela Merkel of Germany, the wealthiest European allied nation, stressed that Moscow still represented the biggest threat — a point evidenced by it being mentioned 62 times in the communiqué to just 10 mentions of China.

“Russia, above all, is a major challenge,” Merkel said. “China is playing an increasing role, as is the entire Indo-Pacific region. This is of course related to the fact that the United States of America, and of course the transatlantic partners as a whole, are also a Pacific nation. Here, the economic and also the military rise of China is of course an issue.”

But she also cited a risk of overreaction. “If you look at the cyber threats, the hybrid threats, if you look at the cooperation between Russia and China, then you cannot simply negate China,” Merkel said. “In this respect, I do not think that we should overestimate the importance of this, so we have to find the right balance.”

Adding another layer of discord, Macron and Dutch Prime Minister Mark Rutte engaged in a terse exchange of words during the leaders’ meeting over their differing views on how Europe should approach military and security policy. Macron, who has pushed for greater military cooperation among EU countries and the development of strategic autonomy, claimed most other EU leaders were with him and said it was up to Rutte “to clarify his thoughts.”

Security analysts cite a growing risk of a deep rift within the 30-nation NATO alliance if China becomes too great a focus, particularly because European militaries are relatively limited in their capabilities and the US could not simultaneously manage a military conflict in Asia while also protecting Europe along its borders with Russia.  

Biden, at his own news conference after the summit, sought to focus on his overall revitalization of transatlantic bonds, which were strained almost to a breaking point by his predecessor Donald Trump.

“Everyone in that room understood the shared appreciation, quite frankly, that America is back,” he said, adding strong words about US fidelity to NATO’s collective defense clause. “The US Commitment to Article 5 of the NATO treaty is rock solid and unshakeable,” he said.

Biden suggested that Russia and China posed similar risks to NATO. “Russia and China are both seeking to drive a wedge in our transatlantic solidarity,” he said. And the president noted that when NATO last focused on its overall strategic outlook, in 2010, “Russia was considered a partner and China wasn’t even mentioned.”

NATO leaders bid adieu to Afghanistan, but President Biden’s and Narendra Modi’s wish for Nato’s new mission is to help India fight China in the high mountains of Ladakh.

But some allies made no mention of China whatsoever in their public comments, a reflection of how, especially in Eastern Europe and the Baltics, Russia is the sole focus.

“The US is aware of the threats faced by the Baltic States and is well informed about Russia’s increasingly aggressive posture and its aim to integrate Belarus into Russian military structures,” Lithuanian President Gitanas Nausėda said in a statement following a meeting with Biden.

One Central European official said that there was clear recognition that Washington puts a priority on containing China and European countries were not disappointed. “They understand that China must be part of a new ‘transatlantic bargain’ to preserve NATO’s relevance for the US,” the official said, adding: “Plus, the attention given to Russia was pretty substantial and outspoken.”

The war of attrition in Ladakh has made the Indian army miserable, military  reform will be ruined, and the modernization of national defense may be  indefinitely | DayNews
Failing in their Uighur ETIM strategy, President Biden would like to transfer US and other Nato’s troops to these mountains of Ladakh to help India bog down China.

Indeed, Biden’s news conference focused overwhelmingly on Russia, largely because of his summit meeting on Wednesday with President Vladimir Putin.

Asked about Putin’s laughing, during a recent television interview, over Biden saying he believed the Russian president was a killer, Biden laughed dramatically. Asked about his approach, in the context of Reagan’s famous “trust but verify” approach toward the Soviet Union, Biden reversed the phrase.

“I’d verify first, and then trust,” he said “It’s not about trusting, it’s about agreeing. You know when you write treaties with your adversaries, you don’t say ‘I trust you.’ You say this is what I expect and if you violate the agreement we made, then the treaty is off, the agreement is off.”

Biden did not retract the killer accusation but said he hoped Putin might adopt a new approach. “I am hoping that President Putin concludes that there is some interest in terms of his own interest in changing the perception the world has of him in terms of whether or not he will engage in behavior that is more consistent with what is considered to be appropriate behavior for a head of state,” he said.

“Be afraid,” says David Goldman. “Be very afraid.”

“And they shall fall one upon another, as it were before a sword, when none pursueth; and ye shall have no power to stand before your enemies” Leviticus 26:37

Is the Dollar on Life-support?

•June 17, 2021 • 2 Comments

ASIATIMES Report “China is intervening in forex markets to soak up dollars, invest in Treasuries and effectively pay the bill of US fiscal stimulus.”

But why would China try to prop up the dollar? Remember, China’s strategy is to manage a peaceful decline of the United States. its strategy is to wait for the rotting apple to fall on its own rather than to shake the tree risking the wrath and fallout of a Samson seppuku.

See also 1; US Treasury Secretary Yellen and China’s vice premier talk about cooperation and economic recovery 2; China can help US out of its inflation trap

By DAVID P. GOLDMAN / JUNE 15, 2021

NEW YORK – Hating China may be the only thing that American politicians agree about, but China remains the prop and support of the American economy.

Americans can’t spend the trillions of dollars that their federal government has poured out in “stimulus” payments without Chinese imports. And the American Treasury can’t finance its projected US$2.3 trillion deficit – not without substantial pain – unless China recycles its nearly $500 billion trade surplus with the United States into US government bonds.

The US is perilously short of money, and China is flooded with money from its trade surplus. There’s nowhere else the US can raise the money it needs except China, unless it prints more money. What economists once called “Chimerica” – the symbiosis of an American economy that borrows and imports with a Chinese economy that lends and exports – is back with a vengeance.

China’s apparent support for the US dollar has a double impact. It supports the imperiled Treasury bond market, and it also keeps Chinese goods cheap for US consumers. That has a significant impact on US inflation: America’s trade deficit is deepening while import prices are rising.

Life Support Systems Cartoons and Comics - funny pictures from CartoonStock

This will happen not because Biden is well disposed towards China, or because he planned to cut a deal with China, or because a cabal of China-friendly American business persuades him to do so, but simply because he is short of money and China has lots of it.

A forensic analysis of market data suggests that all of this already is happening. China is to thank for the buoyancy of the US Treasury bond market despite a sequence of inflation shocks. China appears to be intervening in the foreign exchange market to prevent its enormous trade surplus from driving down the dollar’s exchange rate against the Chinese renminbi (RMB), and then reinvesting the proceeds of intervention in American money markets.

<<>>

I would [[or wouldn’t]] be surprised to learn that the US Treasury and the PBOC have worked this out in some kind of tacit policy agreement. The current is so strong that the US is being caught up in a Sinocentric vortex of trade and capital flows whether it likes it or not.

Eventually, US-China policy will adjust to the misery of America’s present circumstances.

“Mene Mene Tekel Upharsin.”

“Be afraid,” says David Goldman. “Be very afraid.”

Is The G7 Obsolete?

•June 16, 2021 • Leave a Comment

Martin Jacques says G7 is no longer able to order the world around. So is the G7 obsolete? Is it hopeless, divided and outdated as the Guardian had said? However, according to University of Chicago’s Professor John Mearsheimer, the G20-1 should be a better bet to dispel this sense of gloom, but China already has its Belt and Road Initiative covering over 130 nations! The problem would also mean the need for President Biden to rope the head of “a Killer” over to his “new Atlantic Charter” — but Russia says “We’re smarter than Americans think [who we are].” And second, Xi has already seen such attempts as bluffs since both of Putin’s legs are already well-entrenched in China’s Belt and Road!

Image

GlobalTimes Reports / Jun 08, 2021 / Martin Jacques

Fine words will accompany the G7 summit this week. Much will be promised. And little will be delivered. It has long been like this. The G7 is no longer fit for purpose. Comprising the US, UK, Germany, France, Italy, Canada and Japan, in the 1970s the G7 was the overlord of the global economy. Today, the G7 is but a pale shadow of what it once was, reduced to the role of a declining faction within the global economy. It still talks in grandiose terms about its intentions, but the world has learnt to discount them. It is entirely appropriate that this week’s summit will be chaired by UK Prime Minister Boris Johnson, a grandmaster of verbal exaggeration and empty gestures. 

The role and importance of the G7 has been greatly diminished by the rise of the developing world. The latter now accounts for almost two-thirds of the global economy compared with one-third by the West: in the 1970s, it was exactly the opposite, the West enjoying a two-third share and the developing world just one-third. The most dramatic illustration of the G7’s waning authority came in 2008 when, at the height of the financial crisis, it was effectively displaced by the more representative G20. 

Ever since, the G7 has increasingly become an institution in search of a role. Under Biden, as if to confirm its eclipse as a global institution, there is an ongoing attempt to reframe G7 as the representative and champion of the democratic world in the struggle against autocracy, shorthand for China. To this end, South Korea, India, Australia and South Africa have been invited to attend the G7 summit this week. There is even talk of the G7 becoming the D10 (D being a reference to democracy). This, however, would only serve to emphasize the declining authority of the G7: from global leader to ideological sect.

How Should the U.S. Government Treat Chinese Students in America? |  ChinaFile

The truth, however, is that this proposal is unlikely to gain assent either among existing G7 members or potential new members, excepting perhaps Australia. Here we get to the heart of the crisis of the G7. It is the rise of China, above all else, that has transformed the global economy, sidelined the G7 and, at the same time, reconfigured the various G7 economies. Good relations with China are fundamental to the economic prospects of Germany, France and Italy. That is why they are opposed to the G7 becoming an anti-China crusade. So is Japan; and likewise would-be recruits such as South Korea and South Africa. Here laid bare, then, are the fault lines of the G7 and any potential extended membership. The West is divided and fragmenting. The authority of the US is in decline, no longer able to get its way as it once was.

The best illustration of the growing impotence of the G7 concerns its relationship with the developing world. For eight years, the West has been trying to find a way of responding to the China-proposed Belt and Road Initiative (BRI). The subject is due to be raised again at this week’s G7 summit. All the ideas that have been offered as a basis of a Western alternative to BRI have come to nought. This failure is extraordinarily significant and most revealing about the West on the one hand and China on the other. 

China produces 15 times the number of STEM graduates than the US. How does  the US keep its edge in science and technology? - Quora

BRI is an eloquent articulation of China’s relationship with the developing world, rooted in its own semi-colonial past and its position as a developing country. The West, in contrast, has failed because its history has been precisely the opposite, one of colonization and the exploitation and subjugation of these countries. It has neither the experience, empathy nor motivation that is required. The existential gap between the rich Western world and the developing world is a multidimensional chasm.

Which country is going to rule the world in the coming 20 years: India,  China, the USA or any European countries? - Quora

A dramatic example of the West’s indifference to the needs of the developing world will be on full display at the G7 summit. Although the US and UK, and increasingly Western Europe, have vaccinated a majority of their populations against COVID-19, the UK, to take one example, has not exported a single dose of vaccine to the developing world. It has kept all its vaccines for itself, even though its existing stock far exceeds its own future needs. As each new variant spreads around the world, however, it has become patently clear to everyone that no country will be protected until every country is protected. 

In a pandemic, no country is an island. The US, which has so far failed to export a single dose of vaccine, is promising to export 80 million doses of vaccines later this year. Compare this with China’s record. In addition to the 777 million vaccinations already carried out in China, it has exported more than 300 million doses of vaccines to the developing world. Over half the vaccinations in Latin America, for example, have been sourced by China. It seems all too likely that the West will fail in its moral responsibility to vaccinate the developing world until it is too late and many millions have died unnecessarily. 

“Mene Mene Tekel Upharsin.”

“Be afraid,” says David Goldman. “Be very afraid.”

Why US will lose a war with China over Taiwan

•June 13, 2021 • Leave a Comment

Despite all the rhetorics, China’s strategy is to win a war without fighting a war. Despite all the posturing, China’s strategy is to manage a peaceful decline of the United States. Despite all the theatrics, China’s strategy is to wait for the rotting apple to fall on its own rather than to shake the tree risking the wrath and fallout of a Samson seppuku.

The Global Times by Franz Gayl / Apr 27, 2021

It would seem to some that a US war with China over the island of Taiwan appears imminent. 

Considering the congestion of hostile forces in, above, and below the Taiwan Straits and South China Sea, conflict could explode by accident or design. Once blood is drawn, the US will have few options. If the US elects to fight China over the island of Taiwan, then it will lose. 

Taiwan’s ruling Democratic Progressive Party (DPP) independence hubris is fueled by US cabinet-level China hawks and Congress’ bipartisan, bicameral Taiwan Caucus. The DPP has rejected political reunification in one China and dismissed the “one country, two systems” model under which both Taiwan and Hong Kong have gotten rich. Encouraged by US trivialization of the three joint communiqués, the DPP parades a sense of entitlement, taking for granted an umbrella of protection with full knowledge of the dire consequences for the US 

The Taiwan Relations Act (TRA) may not have been intended to give birth to Taiwan’s renegade secessionists, but it has done exactly that. 

The DPP’s champions in the US Congress dismiss omens of fanatical China grit on the topic of Taiwan. China-bashing and Taiwan-coveting rhetoric forms an echo chamber reminiscent of the groupthink-led American Friends of Vietnam (AFV) lobby that pressured the US to commit to the Vietnam War killing 60,000 American patriots before the US disgracefully abandoned its ally. 

But the Chinese are different. China’s history of the whole-of-society commitment to core national security priorities is legendary. The rebellions and unrests in the 19th century cost millions of Chinese lives. Twentieth century Chinese civil war losses ranged between 5 and 8 million, and 360,000 Chinese died in Korea, while routing and humiliating US and UN forces. In each case, the dynasties emerged stronger. 

90 Taiwan Map Videos and HD Footage

The US Congress’ interests in Taiwan are deeply conflicted, better said corrupt. The reciprocal relationship between defense lobbyists, industry contributions, and a Caucus Member’s reelectability is well documented. The bipartisan support for increasing arms sales to Taiwan and even larger defense expenditures on the US Indo-Pacific Command are logical and transparent as all parties profit from the tension and war. 

Many Americans assume China’s citizenry longs for a liberal democracy like that on the island of Taiwan, and that war will trigger popular revolt. But the Taiwan question is not an ideological dispute. Rather it is a raw and painful open wound in China’s civilizational identity. Today, US othering of Chinese only fuels a fierce nationalism in its 1.4 billion citizens. China has a traditional self-narrative wherein the preservation of face and enforcement of sovereignty are inseparable. 

All the while the balance of power has shifted fundamentally. The US would be wise to regard China as a peer superpower, if only due to her casualty-tolerance – China’s decisive advantage in any fight with the US. China also shares a binding mutual defense treaty with North Korea, and the depths of its friendship and security bonds with Russia should never be underestimated. 

The US can think whatever it wants about China’s ideology, culture, Xinjiang and Hong Kong policies, and sovereign claims to Taiwan, Hong Kong, and surrounding seas. But, whether the US likes it or not, those are ultimately China’s internal affairs. 

As for DPP claims of the Province of Taiwan’s non-Chinese identity, they are historical fiction. Fate made them Chinese just as fate made us Americans. We also know that the free will choice to carve out a territory and people from an existing nation incurs a steep price, one the Confederacy paid not long ago. 

The US has never paid an existential price for violating another nation’s sovereignty, leading to our smug sense of military invincibility. However, with Taiwan being a core Chinese priority, that would be a fatal miscalculation. Still, the US counts on regional allies to share the pain. Yet some will have blood debts to pay if they engage in China’s civil war. For example, India was bloodied badly in the 1960s for testing China’s territorial resolve. Japan’s humiliating 50-year occupation of Taiwan and the Rape of Nanjing also remain fresh, unforgettable wounds for China. The US allies will definitely think twice before militarily intervening in China’s unresolved civil war and internal affairs. — Lee Kuan Yew once said Taiwan is China’s core interests, but only periphery to American interests. No way will Americans have the stomach to wage a costly and bloody war with China on this, less still its fair-weather allies.

Missiles of China | Missile Threat

The US could advise Taiwan’s secessionists to peaceably accept “one country, two systems” and cease its “independence” ambitions. If they don’t stop their rhetoric, the US president could rescind the TRA, as baiting China to force reunification is of the DPP’s own choosing. If Congress obstructs TRA recension, the US president could order all national security agencies to stand down in cross-Straits conflicts, keeping our powder dry for actual existential threats in the future. 

In the end, the prosperous Taiwan people will make every effort to wag the American dog. But Taiwan’s fate poses no existential threat to the US, and the US should not fall into the trap of paying for their hubris with American blood. However, in view of the violent political polarization of the US at home, an ill-advised foreign war with no path to victory would only serve to accelerate America’s decline.

Written by Franz Gayl, a retired Marine Corps infantry officer who serves as a US civil servant in the Pentagon, is now under an “investigation.”

Part II US ‘othering’ of Chinese could be prelude to Taiwan conflict

“And they shall fall one upon another, as it were before a sword, when none pursueth; and ye shall have no power to stand before your enemies” Leviticus 26:37

Wuhan’s “Gain of Function” Exposed

•June 10, 2021 • Comments Off on Wuhan’s “Gain of Function” Exposed

“Gain of Function” experiments are when a natural pathogen is taken into the lab, made to mutate, and then assessed to see if it has become more deadly or infectious.

This research also allows the virus’s potential effects on humans to be studied and better understood. Gain of Function has been considered controversial due to its inherent biosafety risks.

In 2014, the Obama administration imposed a moratorium on Gain of Function which included halting funding for projects, however, this decision was overturned on December 19, 2017 by the National Institute of Health (NIH) under Dr Anthony Fauci who took the decision for the Institute and did not alert any White House officials.

“Scientists working in this field might say – as indeed I have said – that the benefits of such experiments and the resulting knowledge outweigh the risks,” Dr Fauci wrote in the American Society for Microbiology well back in October 2012, deciding to overturn the Obama moratorium five years later on his own authority.

Dr Anthony Fauci has denied any wrongdoing. Asked to testify, he told lawmakers that the NIH committed $600,000 to the Chinese lab through a nonprofit, to study whether bat coronaviruses could be transmitted to humans – but denied funding went towards Gain of Function research.

That appears to be technically true, as the NIH grants actually go to a New York-based nonprofit EcoHealth Alliance (where Dr Peter Daszak is President, later a member of the WHO team sent to investigate the origins of the virus in China) – which then subcontracts some of its work to the Wuhan Institute of Virology.

The National Pulse Reports / June 8, 2021

EcoHealth Alliance President Peter Daszak – who collaborated with the Wuhan Institute of Virology on research funded by Dr Anthony Fauci’s National Institute of Allergy and Infectious Disease – appears to boast about the manipulation of “killer” SARS-like coronaviruses carried out by his “colleagues in China” in a clip unearthed by The National Pulse.

Daszak made the admission at a 2016 forum discussing “emerging infectious diseases and the next pandemic,” which appears to be at odds with Fauci’s repeated denial of funding gain-of-function research at the Wuhan Institute of Virology.

WHO inspector has conflict of interest in Wuhan COVID probe: Prominent biologist

While describing how his organization sequences deadly viruses, Daszak describes the process of “insert[ing] spike proteins” into viruses to see if they can “bind to human cells” as being carried out by his “colleagues in China”:

“Then when you get a sequence of a virus, and it looks like a relative of a known nasty pathogen, just like we did with SARS. We found other coronaviruses in bats, a whole host of them, some of them looked very similar to SARS. So we sequenced the spike protein: the protein that attaches to cells. Then we… Well I didn’t do this work, but my colleagues in China did the work. You create pseudo particles, you insert the spike proteins from those viruses, see if they bind to human cells. At each step of this you move closer and closer to this virus could really become pathogenic in people.

“You end up with a small number of viruses that really do look like killers,” he adds.

The comments follow growing evidence that Fauci’s NIAID has deep financial and personnel ties to the Wuhan Institute of Virology – and that Daszak’s EcoHealth alliance was one of the primary proxies funneling the money to the Chinese Communist Party lab.

Over a dozen research papers carried out under a $3.7 million National Institute of Allergy and Infectious Disease (NIAID) grant list the Wuhan Lab’s Center for Emerging Infectious Diseases Director Shi Zhengli as a co-author alongside Daszak. Shi has included these Fauci-backed grants on her resume.

The Wuhan lab has also listed the National Institutes of Health (NIH) as one of its “partners,” secretly erasing the mention in March 2021.

“I have seen a horrible thing in the house of Israel; there is the whoredom of Ephraim, Israel is defiled” Hosea 6:10

Is the US the Covid-19 Mastermind?

•June 7, 2021 • Comments Off on Is the US the Covid-19 Mastermind?

Was the US a mastermind or just a complicit in China’s Covid-19 research?

ASIATIMES reports by STEPHEN BRYEN And SHOSHANA BRYEN / May 27, 2021

The Joe Biden administration closed the US State Department’s investigation into the origins of the Covid-19 pandemic.

Personnel working inside the bio-level 4 lab at the US Army Medical Research Institute of Infectious Diseases at Fort Detrick.

But as the pandemic recedes in the United States, there is renewed interest by the scientific and journalistic communities about the origins of the virus and whether it could have escaped from China’s Wuhan Institute of Virology (WIV). So, a day later, the president opened a new investigation.

The flip-flop came amid Senator Rand Paul’s claim at a Senate committee hearing on the Covid-19 pandemic that the US collaborated with the Wuhan Institute of Virology in China to make a more deadly, transmittable coronavirus. That’s putting the Chinese lab leak theory, which Beijing vigorously denies, back at the forefront of the Covid-19 origin debate.

Hazard suits at the high-security National Biosafety Laboratory in the Wuhan Institute of Virology, which received $3.7m from the US’ NIH to collect about 15,000 bat sample.

Based on papers published by WIV on the scientific work of Dr Shi Zhengli, the US government investigators have some catching up to do. In 2015, Dr Shi – popularly known as the “bat lady” – published a paper entitled “A SARS-like cluster of circulating bat coronaviruses show potential for human emergence.”

Her colleagues on the study included American researchers associated with the University of North Carolina’s Department of Cell Biology and may be related to work funded by the US government.

It is possible, although we don’t know, that Dr Shi and her team successfully converted a coronavirus, specifically SARS-like virus SHCO14-CoV, from bats to other animals and not only mice. It is also possible, but not proven, that the new virus quickly spread to other animals and then to lab workers, three of whom became sick in November 2019, according to a recent Wall Street Journal report.

This is known as “gain of function” research, which is considered by the US to very dangerous. Between 2014 and 2017, gain of function research, which had been actively subsidized by The National Institutes of Health (NIH) and other agencies, was suspended in the US.

“Gain of Function” experiments are when a natural pathogen is taken into the lab, made to mutate, and then assessed to see if it has become more deadly or infectious.

This research also allows the virus’s potential effects on humans to be studied and better understood. Gain of Function has been considered controversial due to its inherent biosafety risks.

In 2014, the Obama administration imposed a moratorium on Gain of Function which included halting funding for projects, however, this decision was overturned on December 19, 2017 by the National Institute of Health (NIH) under Dr Anthony Fauci who took the decision for the Institute and did not alert any White House officials.

“Scientists working in this field might say – as indeed I have said – that the benefits of such experiments and the resulting knowledge outweigh the risks,” Dr Fauci wrote in the American Society for Microbiology well back in October 2012, deciding to overturn the Obama moratorium five years later on his own authority.

Dr Anthony Fauci has denied any wrongdoing. Asked to testify, he told lawmakers that the NIH committed $600,000 to the Chinese lab through a nonprofit, to study whether bat coronaviruses could be transmitted to humans – but denied funding went towards Gain of Function research.

That appears to be technically true, as the NIH grants actually go to a New York-based nonprofit EcoHealth Alliance (where Dr Peter Daszak is President, later a member of the WHO team sent to investigate the origins of the virus in China) – which then subcontracts some of its work to the Wuhan Institute of Virology.

Slightly later, in 2019, the US temporarily closed some laboratories, including the US Army Medical Research Institute of Infectious Diseases (USAMRIID) at Fort Detrick, Maryland, over safety issues.

Mistakes and errors in labs

According to the CDC: “The two breaches [at Fort Detrick] reported by USAMRIID to the CDC demonstrated a failure of the Army laboratory to ‘implement and maintain containment procedures sufficient to contain select agents or toxins’ that were made by operations in biosafety Level 3 and 4 laboratories …”

Level 4 is, in theory, the most secure type of laboratory known today; China’s WIV is also a Level 4 lab. But not all the Wuhan laboratory followed Level 4 standards and there are, as Fort Detrick shows, lapses that need to be accounted for.

In fact, the same kind of lapses that happened at Fort Detrick, which centered on waste treatment, also happened at the Wuhan lab.

The National Microbiology Laboratory in Winnipeg, Manitoba, Canada’s only level four lab.

Furthermore, Fort Detrick was working with other American and foreign labs, which may have included Chinese facilities. For example, Fort Detrick was connected to Canada’s National Microbiology Lab in Winnipeg, which was thoroughly penetrated by the Chinese, including at least one known member of China’s biowarfare community.

According to Canada’s Globe and Mail newspaper: “One of the Chinese researchers, Feihu Yan, from the People’s Liberation Army’s (PLA) Academy of Military Medical Sciences, worked for a period of time at the Winnipeg lab, a Level 4 facility equipped to handle some of the world’s deadliest diseases.”

There were at least seven Chinese scientists at the lab. Two of them, “Xiangguo Qiu and her biologist husband, Keding Cheng, were fired in January (2021) after the Canadian Security Intelligence Service … recommended that their security clearances be removed on national security grounds,” (allegedly for sending samples of deadly viruses to the Wuhan lab).

On at least one occasion, Qiu, and probably others, visited the Fort Detrick Laboratory. The details are not known, but it can be reasonably surmised that the Winnipeg Lab and Fort Detrick were cooperating, and this cooperation might have included Wuhan.

Unsupervised, this pretty “Snow White” Shi Zhengli was busying herself in the dark catching bats and doing labwork for a “science-maniac” Professor Ralph Baric.

Was Canada a weak link?

Given Fort Detrick’s security level, further investigation is essential. 

It also begs the question of Canada giving Chinese scientists, including at least one from the PLA’s Academy of Military Sciences, top secret clearances.

The US and Canada, as part of the North American Defense Sharing Agreement, share classified information, which means there is a strong possibility that some classified American information made its way to Winnipeg and then to Wuhan or elsewhere in China.

Not only does WIV need further investigation, but so do American institutions including the National Institutes of Health (NIH), the CDC and Fort Detrick.

In 2017 and 2018, the US did at least two inspections of the Wuhan Laboratory. That raises the question of why did a US inspection team gain entry multiple times to a sensitive Chinese laboratory?

The answer seems to be that the Americans had special status because of high-level, top-secret cooperation between the US, China and other partners (eg, Canada).

Ralph Baric in his lab
With the help of a “batwoman Shi Zhengli,” is Professor Ralph Baric the Father of COVID-19?

Top US infectious disease expert Dr Anthony Fauci has said it would have been “almost a dereliction of our duty” if the NIH had not worked with China to study coronaviruses and “collaborate” with “very respectable Chinese scientists.”

“Respectable scientists” working for the Chinese government. That’s another avenue for investigation.

International collaboration suggests the US may have halted gain of function research because it was easier and less politically risky to let China do it. China has lower legal standards – try litigating in China if you have any doubt – and, as Fauci said, the US government funded Chinese labs and happily published papers by Chinese scientists.

Those papers today give us a partial record of what the Chinese with the CDC and NIH – and perhaps even the US Army – were up to.

The CIA changes course

The US intelligence community had to know all of this, and a lot more.

But the CIA and other senior American officials, including James Clapper, the former Director of National Intelligence, insisted that Covid-19 did not come from the Wuhan Laboratory but was zoonotic, namely that it was transmitted in nature by animals.

Today the CIA appears to have tentatively reversed course as American scientists press for more information. 

Donald Trump's South Asia strategy working, says Mike Pompeo | World  News,The Indian Express
Mike Pompeo: “I was the CIA director. We lied, we cheated, we stole … we had entire training courses … It reminds you of the glory of the American experiment.”

A proper investigation would have to ask why the US would trust China, knowing how sloppy the Chinese are about food and safety standards. The faulty ventilators, Covid-19 test kits and N-95 masks for physicians and health workers that were sent abroad by China after the outbreak of the epidemic illustrated this clearly for the world to see.  

But beyond sloppiness, it seems the US decided to fund and shift dangerous research to Chinese labs run by the Chinese state. The Biden administration erred in closing the investigation and is right to have opened a new one.

Is FORT DETRICK the SOURCE of COVID-19?

DailyMail reports “COVID-19 is Man-Made.” / 29 May 2021 / Findings from Norwegian scientist Dr Birger Sørensen and British Professor Angus Dalgleish

RT Reports / 28 May, 2021 / ‘Benefits outweigh the risks’?

“I have seen a horrible thing in the house of Israel; there is the whoredom of Ephraim, Israel is defiled” Hosea 6:10

“Ephraim shall be desolate in the day of rebuke; among the tribes of Israel have I made known that which shall surely be” Hosea 5:9

Come Covid Clean America!

•June 5, 2021 • Comments Off on Come Covid Clean America!

Amid growing controversy about the virus’s origins, US President Joe Biden has ordered intelligence agencies to investigate the emergence of Covid-19. In a statement, Mr Biden asked US intelligence groups to “redouble their efforts” and report to him within 90 days.

But 116 NATIONS had already backed the VIRUS PROBE over a year ago, but Not the UNITED STATES! Why?

The Daily Telegraph / May 18, 2020

Many countries have signed up to support Australia’s call for an international COVID-19 inquiry at the World Health Assembly, but not the leading Nation of this world.

Electron microscope image (Coronavirus SARS-CoV-2 virus particles) made available by the National Institute of Allergy and Infectious Diseases Integrated Research Facility in Fort Detrick

At least 116 countries have now signed up as co-sponsors of the draft motion calling for an investigation, but not the United States.

Britain, Canada, India, Indonesia, Japan, New Zealand and Russia have put forth their support.

The EU draft resolution now has 116 co-sponsors, after the entire African Group and its member states joined the initial list of 62 countries, which included Australia, Russia, the UK and Japan.

The countries now backing the inquiry are Albania, Australia, Bangladesh, Belarus, Bhutan, Brazil, Canada, Chile, Colombia, Djibouti, Dominican Republic, Ecuador, El Salvador, Guatemala, Guyana, Iceland, India, Indonesia, Japan, Jordan, Kazakhstan, Malaysia, Maldives, Mexico, Monaco, Montenegro, New Zealand, North Macedonia, Norway, Paraguay, Peru, Qatar, Republic of Korea, Republic of Moldova, Russian Federation, San Marino, Saudi Arabia, the African Group and its Member States, the European Union and its Member States, Tunisia, Turkey, Ukraine and United Kingdom of Great Britain and Northern Ireland. — But but wait: where is the United States?

Why IS the United States SO reluctant to open Fort Detrick for an investigation? If the operation surrounding Fort Detrick is clean there is nothing to hide. But if something there is fishy, then there are lots to hide!

ABC reports / 18 May 2020

Another European diplomat told the ABC China might well vote for the motion even if it didn’t join as a co-sponsor.

He said Beijing opened the door to supporting the EU motion last week when its Foreign Ministry spokesman Zhao Lijian said it was “not the same thing” as Australia’s push for a probe.

Meanwhile, United States diplomats have been pressing for tougher language that calls for a probe into how the virus started in China.

WHO names B1617 fourth COVID-19 variant of concern | CIDRAP
B1617 a fourth COVID-19 variant of concern

US President Donald Trump said repeatedly the coronavirus originated in a Chinese virology lab but declined to provide any evidence for his claim that is likely to further increase tension with China over the origins of the pandemic.

Asked about providing evidence, he responded, “Yes, yes I have,” he said, declining to give specifics. “I can’t tell you that. I’m not allowed to tell you that.”

US Secretary of State Mike Pompeo told reporters: “China could have spared the world a descent into global economic malaise. They had a choice but instead – instead – China covered up the outbreak in Wuhan. China is still refusing to share the information we need to keep people safe.”

“Mr Pompeo repeatedly spoke up but he cannot present any evidence. How can he? Because he doesn’t have any,” Chinese foreign ministry spokeswoman Hua Chunying said.

FORT DETRICK, the nerve center of US biological weapons program, was “shut down” in July 2019 but resumed back on November 25, 2019. Is this FORT the Source of COVID-19?

Chinese Foreign Ministry spokesperson Hua expressed stance on the issue of origin-tracing at the press conference: “If the United States truly respects facts, it should open the biological lab at Fort Detrick, give more transparency to issues like its 200-plus overseas bio-labs, invite WHO experts to conduct origin-tracing in the United States.”

Is FORT DETRICK the SOURCE of COVID-19?

The Lord shall smite thee with madness, and blindness, and astonishment of heart; and thou shalt grope at noonday, as the blind gropeth in darkness. — That was written in Old Testament time in Deuteronomy 28:28-29, but at the enlightened endtime, the intended Israelites are groping in the light.

Taiwan’s “first battle will be the last”

•June 4, 2021 • Comments Off on Taiwan’s “first battle will be the last”

Taiwan’s “first battle will be the last” former President Ma Ying-jeou said.

US says Taiwan defence spending to rise with China threat, East Asia News &  Top Stories - The Straits Times
President Tsai Ing-wen prays that “Beijing will pay a great price.”

By Kelvin Chen, Taiwan News / 2020/08/11

TAIPEI (Taiwan News) — Former President Ma Ying-jeou said the US will not come to Taiwan’s aid in the case of a conflict in the Taiwan Strait.

On a Monday afternoon, Ma was invited by a non-governmental organization to deliver a speech on cross-strait relations and Taiwanese national security. He stated that China’s strategy of striking Taiwan is to “let the first battle be the last,” suggesting that the communist nation aims to launch a quick war so that Taiwan does not have time to wait for American military support, CNA reported.

The president should prevent war from happening, Ma remarked, referring to President Tsai Ing-wen’s recent comment to foreign media that if Taiwan is attacked by China, Beijing will “pay a great price.” She also said that after the nation endures the first wave of attacks, she hopes countries around the world will come to assist it.

Ma said he was worried because the nation’s military is aware of China’s strategy. Once war has begun, it will be over in a very short period of time, he predicted, giving Taiwan no chance to wait for the US military.

The former two-term president added that in fact, there is no way the US would even come to the rescue in such a situation.

Taiwan's President Ma Ying-jeou remembers Nationalist victory in Sino-Japan  war, East Asia News & Top Stories - The Straits Times
Taiwan’s “first battle will be the last” former President Ma Ying-jeou predicted Taiwan’s prospect of winning a war with China on August 10, 2020.

Ma stated: “Whoever is president should not tell our compatriots how many days [the nation] can last in a war but rather tell our compatriots that he or she can prevent war from happening.”

Taiwan’s Protests by independence advocates 

“Be afraid,” warns David Goldman for his home country; but he also has one for its illegitimate ally, Taiwan: “Be very afraid.”

China’s Hypersonic Mach 10 Missiles

•June 3, 2021 • Comments Off on China’s Hypersonic Mach 10 Missiles

Mach 30 ‘tunnel’ and Mach 10 missiles will put China decades ahead of the US

The Sun by Mark Hodge / 31 May 2021

ASIATIMES by DAVE MAKICHUK / JUNE 2, 2021

China Tests New Ballistic Missile 'DF-17' With Hypersonic Gliders - YouTube
China’s DF-17 Hypersonic Missile – Mach 10

”There is a Chinese saying, it takes 10 years to sharpen a sword. We have spent 60 years sharpening two swords. And they are the best.” — Chinese researcher Han Guilai

Imagine a wind tunnel, capable of simulating flights at Mach 30 — that’s 23,000 mph, or, 30 times the speed of sound.

It may sound like science fiction, but in fact, China has built a hypersonic wind tunnel in Beijing which could put the superpower decades ahead of the West, according to a report in UK’s .

Researcher Han Guilai, of the Chinese Academy of Sciences, said that together with another facility, also in Beijing, China will be about 20 to 30 years ahead of other powers.

China and countries such as the US and Russia have invested heavily in the development of hypersonic flight technology including missiles.

The futuristic tech could make it possible for super-fast jets to fly anywhere in the world in two hours or less.

It could also make space travel accessible to ordinary people as the hypersonic aircraft could cut costs by more than 90 per cent, reports say.

Wind tunnels have helped China push ahead with the technology.

Instead of using mechanical compressors, Beijing uses chemical explosions to generate high speed air flow.

Here's How China DF-17 Hypersonic Missiles Can Sink US Aircraft Carriers -  YouTube

Fuel burns in the JF-22 at speeds 100 million times faster than a regular gas stove creating shock waves similar to those experienced by jets at hypervelocity.

At America’s most advanced wind tunnel, named the LENS II, simulated flights last 30 milliseconds.

In comparison, JF-22’s average flight simulation can reach 130 milliseconds, Guilai said.

He said: “Our experiment time is much longer than theirs, so the aircraft model can be larger than theirs, and the experiments can be more advanced than theirs.

“This determines our leading position in the world.”

The technology is also hugely important when it comes to weapons. The lethal DF-17 ”carrier killer” can perform extreme manoeuvers as it hurtles at Mach 10 — some 7,600 mph — towards a target; the DF-17 could tear through a big ship like the US Navy’s latest carrier, the USS Gerald R. Ford — putting it out of action.

Shanghai-born Qian Xuesen, considered ”the father of China’s rocket program,” coined the term ”hypersonic” in 1946 after he found that the behaviour of air flow was completely different at five times faster than sound.

The life of Qian Xuesen, father of China's space programme | SpaceTech Asia
Qian Xuesen (11 Dec 1911 – 31 Oct 2009)

Qian single-handedly led China’s space and military rocketry efforts after he was drummed out of the United States during the red-baiting of the McCarthy era.

Upon his return, Qian began a remarkably successful career in rocket science, boosted by the reputation he garnered for his past achievements (in MIT and Caltech) as well as Chinese state support for his nuclear research. He led and eventually became the father of the Chinese missile program, which constructed the Dongfeng ballistic missiles and the Long March space rockets.

A former US Secretary of the Navy, Dan Kimball — later head of the rocket propulsion company, Aerojet — would later say about Qian’s expulsion that it was ”the stupidest thing this country ever did. He was no more a Communist than I was, and we forced him to go [back to China].”

“The children of Ephraim, being armed and carrying bows, turned back in the day of battle” Psalm 78:9

Huawei to launch more Satellites for 6G

•May 31, 2021 • Comments Off on Huawei to launch more Satellites for 6G

Huawei is scheduled to launch 10,000 satellites to cover for its 6G network

By GeospatialWorld – 04/26/2021

Huawei, one of the leading providers of information and communication technology (ICT) infrastructures and smart devices, is going to launch two satellites together, along with two Chinese partners this year, as reported by a global news website.

Huawei to launch more satellites for 6G

The launch is scheduled to be in July, with the aim to verify the 6G network technologies. Huawei has taken lead in the research and development (R&D) 6G technology around the world.

The two Chinese partners are said to be network operator China Mobile and a national space firm, details of which has not been unveiled, but has great significance for China’s core technologies such as networking and switching.

According to Ma Jihua, a senior tech industry analyst based in Beijing, “The satellite move is natural as Huawei pushes ahead its layout on 6G networks, which is 50 times faster than 5G.”

Ma explained that 6G networks convey higher frequencies need using the satellite for communication instead of base stations, whereas 5G networks rely on base stations to transmit signals.

Earlier this month, Huawei’s rotating chairman Xu Zhijun announced at Huawei global analysts conference that the Chinese tech giant will launch its 6G networks in 2030, and it will release a 6G white paper soon to explain to the industry what 6G is.

During a global 6G summit in 2019, Huawei had proposed it vision to launch more than 10,000 small satellites to provide 6G services covering the world,

10,000 small satellites to transmit 6G services

According to Ma, the potential of 6G technologies is something that no government or firm could ignore despite the fact that it is still at the early R&D phase.

China’s satellite constellation, as current projects Hongyun and Hongyan have been involved in, aims to enable broader online access for people and businesses in China’s remote and poorer areas. While the 6G satellite is more used for tests and providing data in popular urban areas, Ma added.

The Five Eyes is a system of electronic espionage by Australia, Canada, the United States, New Zealand and the United Kingdom. They have excluded Huawei from their auctions. 

“Their decision (to ban Huawei) will put the Five Eyes ten years behind China (and the EU if it resists US pressure) in 5G and its associated technologies” Godfree Roberts

Are We Human Guinea Pigs?

•May 30, 2021 • Comments Off on Are We Human Guinea Pigs?

“We are Human Guinea Pigs”: Alarming Casualty Rates for mRNA Vaccines

An Alarming Global Research Report:

By F. William Engdahl / May 27, 2021

Corbella: Are we being treated like guinea pigs by feds extending time  between shots? | Calgary Herald
Are we being treated like guinea pigs?

On May 8 the European Medicines Agency (EMA) an agency of the European Union (EU) in charge of the evaluation and supervision of medical products, using the data base EudraVigilance which collects reports of suspected side effects of medicines including vaccines, published a report that barely warranted mention in major mainstream media.

Through May 8, 2021 they had recorded 10,570 deaths and 405,259 injuries following injections of four experimental COVID-19 shots: COVID-19 mRNA VACCINE of MODERNA (CX-024414); COVID-19 mRNA VACCINE of PFIZER-BIONTECH; COVID-19 VACCINE of ASTRAZENECA (CHADOX1 NCOV-19); and Johnson & Johnson’s Janssen COVID-19 VACCINE (AD26.COV2.S).

A detailed analysis of each vaccine gives the following:

The Pfizer-BioNTech mRNA gene-edited vaccine resulted in the largest fatalities – 5,368 deaths and 170,528 injuries or nearly 50% of the total for all four.

Guinea Pigs as Pets | Oklahoma State University

The Moderna mRNA vaccine was second with 2,865 deaths and 22,985 injuries. That is to say, the only two gene manipulated mRNA experimental vaccines, Pfizer-BioNTech and Moderna, accounted for 8,233 deaths of the total registered deaths of 10,570. That’s 78% of all deaths from the four vaccines currently in use in the EU.

And among the serious side effects or injuries recorded by the EMA, for the two mRNA vaccines which we focus on in this article, for the Pfizer “experimental” vaccine, most reported injuries included blood and lymphatic system disorders including deaths; cardiac disorders including deaths; musculoskeletal and connective tissue disorders; respiratory, thoracic and mediastinal disorders, and vascular disorders.

For the Moderna mRNA vaccine, most serious injuries or causes of death included blood and lymphatic system disorders; cardiac disorders; musculoskeletal and connective tissue disorders; disorders of the central nervous system. Note that these are only the most serious injuries related to those two genetically manipulated mRNA vaccines. The EMA also notes that it is believed that only a small percent of actual vaccine deaths or serious side effects, perhaps only 1% to 10%, are reported for various reasons. Officially more than 10,000 persons have died after receiving the coronavirus vaccines since January, 2021 in the EU. That is a horrifying number of vaccine-related deaths, even if the true numbers are far greater.

Injuries: European Database

“The Lord shall smite thee with madness, and blindness, and astonishment of heart; and thou shalt grope at noonday, as the blind gropeth in darkness” Deuteronomy 28:28-29.

Taiwan’s Endless Troubles

•May 27, 2021 • Comments Off on Taiwan’s Endless Troubles

Taiwan’s continuous whammy threatens its own future

AsiaTimes reports Drought, power outages and a Covid-19 outbreak will crimp TSMC’s and others’ ability to deliver ramped-up chip production / MAY 24, 2021

Taiwan’s Covid-19 Surge / May 26, 2021

Taiwan’s chipmakers are being hit simultaneously with drought, power shortages and a worst-yet wave of Covid-19, a confluence that threatens to undermine already strained global supply chains.

That threat is greatest to chip producer TSMC, the world’s leading supplier of cutting-edge semiconductors that power everything from iPhones to newfangled electric vehicles.

At least one engineer employed by the chipmaker at its vital Taichung fab tested positive for the virus last weekend, while the central Taiwanese city grapples with a viral spread from Taipei with the confirmation of 11 fresh infections, according to Taiwanese papers.

Taiwan Chipmakers Prepare for Drought | EE Times

But the worst of the flare-up is likely yet to come after what started as sloppy quarantine arrangements for aircrew members at Taipei’s main airport ignited a community outbreak two weeks ago. The pathogen has spun out of control on the island, once praised for almost vanquishing the virus.

The island logged 334 new cases on Monday, with another 256 infections reported but not instantly confirmed in the past week. The spike is steep given the island’s modest total of fewer than 5,000 cases so far.

TSMC has sought to allay concerns, saying that only one infection among its technicians would not cause it to reduce output. With Taiwan slipping into a Covid crisis, however, more infections are feared among TSMC‘s army of engineers and workers in plants across the island.

In the meantime, the impact of Taiwan’s perennial power shortage has also had its toll on TSMC. Within five days in the past week, the island of 24 million residents was hit by two massive power outages when blackouts occurred in domino fashion.

In the second accident on May 18, 20 million industrial and household users from Taipei to Taichung were left without power.

Taiwan Drought Threatens to Hurt Production of Chips | Barron's

Power supplies are drying up further amid Taiwan’s longest spell of drought in more than half a century, with hydropower plants operating way below capacity and many reservoirs and rivers running dry.

Taiwan’s Economic Daily reported last week that TSMC had been hiring fire engines to deliver water to its headquarters campus and plants in Hsinchu. The city that is hailed as Taiwan’s Silicon Valley will start rationing water next month.

“The problems TSMC is now grappling with all of a sudden and on multiple fronts in Taiwan can be symptomatic of the island’s constraints, complacency and vulnerability that will increasingly hamper the growth of its key companies in difficult and unsettled times,” Chen Cze-yao, a professor of economics at a Taiwanese university, told Asia Times.

Earlier on March 22, 2021 RT reports Taiwan’s air force has confirmed that one pilot died and another remains missing after two antiquity F-5E fighter jets collided and crashed into the sea off the island’s southeastern coast during a training mission.

Taiwan loses two fighter jets in apparent collision | Aviation News | Al  Jazeera
Taiwan loses two ancient jets in apparent collision

It is believed that both pilots ejected before the jets hit the water but so far only one pilot has been found. Air force Chief of Staff Huang Chih-wei said the pilot was found unconscious and airlifted to hospital by helicopter but later died.

Designed back in the last century, the well-polished F-5 fleet that should have been on display in a museum for children to amuse with, has now finally got itself grounded, all training missions stopped and any pretension of a great power exposed.

The collision is the third such crash in six months and raises questions about the capacity of Taiwan’s air force, particularly amid increasing pressure from Beijing and incursions by Chinese military air assets.

In October a similar antiquitous F-5 crashed while a month later a more modern F-16 also crashed off the coast of Taitung. The pilots died on both occasions.

“Be afraid,” warns David Goldman for his home country; but he also has one for its illegitimate lover, Taiwan: “Be very afraid.”

Is there a Calendar Omen?

•May 21, 2021 • Comments Off on Is there a Calendar Omen?

The Essenes had their own calendar, but they were wiped out during the 70 AD Inferno, so is there a connection? Is there a Calendar Omen?

The Scriptures command us to celebrate Passover in the spring at the time of the ripening of the barley, so the Jewish or the Hebrew calendar has to be a solar calendar. But in another Scripture, it commands us to remember the new moon, so the Jewish calendar has to be a lunar too.

A close-up on: the Great Sanhedrin: Jews during the Empire - napoleon.org
The Nasi presiding over the Great Sanhedrin in ancient times

Since Biblical times, various astronomical phenomena have been used to establish uniquely Jewish definitions for the day and its hours, the months and the year.

The length of days and hours vary by the season, controlled by the times of sunset, nightfall, dawn and sunrise. The months and years of the Hebrew calendar are established by the cycles of the moon and the sun.

Though the months follow the lunar cycle, the lunar months must always align themselves with the seasons of the year, which are governed by the sun. Thus, the Hebrew calendar is “Luni-Solar.” The discrepancy between the solar year (365 days) and the lunar year (354 days) was resolved by every so often adding a thirteenth month to the year, to form a “leap year.”

The Jewish Calendar – Silver Trumpets

In the early times of our history, the High Court (Sanhedrin) in Jerusalem was assigned the tasks of determining the beginning of each month and the balancing of the solar with the lunar years. They relied on direct observation of the New Moon, astronomical data, and other considerations.

In the fourth century after the Temple’s destruction, however, when oppression and persecution threatened the continued existence of the Court, a fixed calendar was instituted — based on the Sanhedrin’s closely guarded secrets of calendrical calculation. Called the Hillel calendar, this is the permanent Hebrew calendar according to which the New Moons and festivals are calculated and celebrated today by Orthodox Jews all over the world.

Like the original system of observation, it is based on the Luni-Solar principle. It also applies certain rules by which complex astronomical calculations are combined with the religious requirements into an amazingly precise system.

Exodus 121 And the Lord spoke unto Moses and Aaron in the land of Egypt, saying, 2 “This month shall be unto you the beginning of months; it shall be the first month of the year to you.

From the wording of this verse, “shall be unto you,” the sages deduced that the responsibility of pinpointing and consecrating the chodesh, the crescent new moon, was entrusted to the leaders of our nation, the Sanhedrin, the rabbinical supreme court of every generation.

Moon Path... | Moon cycles, Time lapse photography, Camera tattoo

Preceding the Sanhedrin were the one hundred and twenty priests who comprised the Great Assembly that Ezra had established.

Originally, there was no fixed calendar. There was no way to determine in advance the exact day of a coming holy day or festival, because there was no way to determine in advance when the month would begin. Each month anew, the Sanhedrin would determine whether the month would be 29 or 30 days long — depending on when the following month’s new moon was first sighted — and would sanctify the new month.

The Sanhedrin (Hebrew synedrion, “sitting together,” hence “assembly” or “council”) were assemblies of elders (known as “rabbis” after the destruction of the Second Temple), who were appointed to sit as a tribunal in every city in the ancient Land of Israel.

There were two classes of Jewish courts, the Great Sanhedrin and the Lesser Sanhedrin. A lesser Sanhedrin of 23 judges was appointed to sit as a tribunal in each city, but there was only supposed to be one Great Sanhedrin of 71 judges, which among other roles acted as the Supreme Court, taking appeals from cases which were decided by lesser courts.

Members of the Sanhedrin were to be recruited from the following sources: Priests (Kohanim), Levites (Levi’im), and ordinary Jews who were members of those families having a pure lineage such that their daughters were allowed to marry priests.

The Apostle Paul Session 1 His Life and Times. - ppt video online download
Arrow shows the Chamber of Hewn Stones where the Sanhedrin convened

In general usage, the “Sanhedrin” without qualifier normally refers to the Great Sanhedrin, which was presided over by the Nasi, who functioned as its head or representing as President, and was a member of the court; the Av Beit Din or the chief of the court, who was second to the nasi; and sixty-nine general members (Mufla). 

Hillel II (Hillel the Nasi), held the office of Nasi of the Sanhedrin between 320 and 385 AD and he is regarded as the creator of the modern fixed Hebrew Calendar the Jews observed from 359 AD onward to modern time.

In the Second Temple period, the Sanhedrin met in the Temple in Jerusalem, in a building called the Chamber of Hewn Stones. This Sanhedrin convened every day except the yearly festivals and on sabbath days (Shabbat).

THIRD TEMPLE - Leeland Jones- THIRDTEMPLE - Leelan - YouTube
Inside the Chamber of Hewn Stone

Members of the Sanhedrin were well schooled in astronomy. They knew exactly when the new moon would have appeared, and where it would have been visible. Nevertheless, the sanctification of the moon depends on the crescent new moon actually being seen by at least two witnesses. The word “this” (in the above-quoted verse in Exodus 12:2, “This month shall be to you . . .”) implies something that is actually seen. These witnesses could be local or from the Disporal who arrived (would be lavishly entertained there, in order to attract potential witnesses to travel) to Jerusalem to testify.

The rabbis of the Sanhedrin would question the witnesses in the order of their arrival. They knew what the proper responses to their questions ought to be, and were thus quickly able to identify fraudulent claims. Starting with the elder of each pair, they would ask: “Tell us how you saw the moon:

In which direction was it in relation to the sun? (The observation is limited to the time of sunset)
Was it to the north or south?
How high in the sky did the moon appear to be?
In which direction were the crescent’s tips facing?
How wide was it?”

After they had finished questioning the first witness, they would bring in his partner and question him in similar fashion. If the two accounts corroborated, the evidence was accepted.

Publicizing the New Month

The following night (the second night of the month), huge bonfires were lit on designated mountaintops. Lookouts stationed on other mountaintops would see that a fire had been lit, and would light their own fires. This chain of communication led all the way to Babylonia, so that even very distant communities knew that the day beforehand had been declared the New Month (Rosh Chodesh).

Eventually, the Samaritans started lighting fires mischievously on the wrong days in order to confuse the Jewish Diaspora. To prevent this confusion, the fire-on-mountaintop method of communication was discontinued, and instead running messengers were dispatched from Babylonia and all other far-flung Jewish settlements. This took a lot longer, a delay which had (and still has) halachic implications with regards to observance of the second day of the Festivals in the Diaspora.

Was It an Essene Settlement? · The BAS Library
The Essenes living on their own

Nowadays

The lunisolar Hebrew calendar, or the Hillel calendar, was named after Hillel II because he was the presiding Nasi of the Sanhedrin when the calculated calendar was established, is actually a brilliant invention that filled a desperate need. Originally, the new moons were formerly sighted by multiple witnesses and officially declared throughout Israel. But after the Second Temple destruction and the subsequent dispersion, it was impractical to declare the new moon to every Jewish community in the world, and under Constantius II, it was actually outlawed.

As a remedy, the Sanhedrin instituted the Hillel calendar in 359 AD. This calendar averages 29.5 days per month and 365.2468 days per year (compared to the average solar year length of 365.2422). 

Implementing the Hillel calendar was the Sanhedrin’s last big decision before disbanding. Whenever the Hillel calendar will be decommissioned in the future to return to sighting and declaring the New Moon days, it would have to be at the authority of a reconvened Sanhedrin.

So until then, this calendar is what unites Jewish people worldwide in celebrating any Festivals on the same days, and reading the same Torah portion together each week. So Hillel and his rabbinical court, the Sanhedrin, established the perpetual calendar which is followed today.

The Sanhedrin considered several factors in the course of their deliberations whether to declare a leap year on a given year. The primary factor, which may or may not override other factors, was the spring equinox.

(a) If the spring equinox would fall later than the first half of Nissan (from the 16th onward), then the year was automatically declared a leap year. This is because, as mentioned earlier, the verse states: “Guard the month of spring, and make [then] the Passover offering.”

(b) However, it wasn’t enough for Passover to fall after the equinox, when it was “officially” spring; spring-like conditions needed to be evidenced. If in the land of Israel, the barley had not yet ripened, and the trees were not yet blossoming with seasonal fruit — that, too, was sufficient reason to delay Nissan by adding a second month of Adar. Spring had to be felt; it had to be bright and green.

(c) There were also several non-season-related factors which the Sanhedrin considered. For example, if the roads or bridges were in disrepair due to the winter rainy season, impeding the ability of the pilgrims to travel to Jerusalem for Passover.

But where did the Sanhedrin get their authority?

Deuteronomy 16:18 “Judges and officers shalt thou make thee in all thy gates which the Lord thy God giveth thee, throughout thy tribes; and they shall judge the people with just judgment. 

19 Thou shalt not distort judgment; thou shalt not respect persons, neither take a bribe; for a bribe doth blind the eyes of the wise and pervert the words of the righteous.

Deuteronomy 17:11 According to the sentence of the law which they shall teach thee and according to the judgment which they shall tell thee, thou shalt do. Thou shalt not decline from the sentence which they shall show thee to the right hand nor to the left. 

12 And the man who will do presumptuously, and will not hearken unto the priest who standeth to minister there before the Lord thy God, or unto the judge, even that man shall die; and thou shalt put away the evil from Israel.

13 And all the people shall hear, and fear, and do no more presumptuously.

Moses knew he would die soon and his understanding had been conveyed to the judges, the Levites and priests where the true interpretation of the law were taught. So in the book of Deuteronomy Moses spoke and explained unto all Israel “according unto all that the Lord had given him” as to how to keep them, the blessing they would have if they obey, or cursing if they disobey, in a language they could understand. Men may have good intentions, but may do things seen as presumptuously? 

The Essenes: The Mystery Holy Men Behind the Dead Sea Scrolls? | Islamic  paintings, Islamic art, Arabian art
The Essenes, known also as Sun-worshippers, are now extinct

And the man who will do presumptuously, and will not hearken unto the priest who standeth to minister there before the Lord thy God, or unto the judge, even that man shall die

It’s a death penalty, so what is presumptuous or presumptuously? 

Below are some of its synonyms: 

arrogant, bumptious, cavalier, chesty, haughty, high-and-mighty, high-handed, high-hat, huffish, huffy, imperious, important, lofty, lordly, masterful, overweening, peremptory, pompous, presuming, pretentious, self-asserting, self-assertive, sniffy, supercilious, superior, uppish, uppity

Moses as a god unto Pharaoh:

Exo 7:1 And the LORD said unto Moses, See, I have made thee a god H430 to Pharaoh: and Aaron thy brother shall be thy prophet.

The KJV translates elohim as “judges” in Exodus 21:6; Exodus 22:8; and twice in Exodus 22:9

Exo 21:6 Then his master shall bring him unto the judges H430; he shall also bring him to the door, or unto the door post; and his master shall bore his ear through with an aul; and he shall serve him for ever.

Exo 22:8 If the thief is not found, then the master of the house shall be brought unto the judges H430, to see whether he has put his hand unto his neighbour’s goods.

Exo 22:9 For all manner of trespass, whether it be for ox, for ass, for sheep, for raiment, or for any manner of lost thing, which another challenge to be his, the cause of both parties shall come before the judges H430; and whom the judges H430 shall condemn, he shall pay double unto his neighbour.

The Jewish “leap year” which occurs seven times in a 19-year cycle has 13 months instead of the regular 12. This is so that the lunar-based Jewish year should remain aligned with the solar seasons (12 lunar months make up a total of 354 days — slightly more than 11 days short of the 365.25 day solar cycle). The added month is called “Adar I” and is inserted before the month of Adar (termed “Adar II” in leap years).

New Testament Omen

The significance of the destruction of the Temple in 70 AD should not be ignored. It came forty years after John the Baptist had given a stern warning about another consuming fire recorded in Luke 3:16. The number 40 generally symbolizes a period of testing, trial or probation. During Moses’ life he lived forty years in Egypt and forty years in the desert before God selected him to lead his people out of slavery.

Because of their perversion, God destroyed Sodom and Gomorrah during Abraham’s time. The Blind have ignored John’s warning about another consuming fire recorded in the Gospel of Luke. John said unto them:

“I indeed baptize you with water; but One mightier than I cometh, the straps of whose shoes I am not worthy to unloose. He shall baptize you with the Holy Ghost and with FIRE. 17 His winnowing fan is in His hand, and He will thoroughly purge His floor and will gather the wheat into His garner; but the chaff He will burn with FIRE unquenchable,” Luke 3:16-17.

The Essenes #2 [2BC.to 1AD.]. Regarding the naming of this sect… | by Mina  Georgy | Medium
Dining together – Commual living among the Essenes

The word F-I-R-E is highlighted above, with a hope that the Blind could see the word“FIRE.” When we look back, one cannot avoid concluding that God had deemed that the Essenes were worthy of extinction during the AD 70 INFIRNO. Everything about the Essenes were destroyed by FIRE.

“Shall a trumpet be blown in the city, and the people not be afraid? Shall there be evil in a city, and the LORD hath not done it?” Amos 3:6

Or by the Roman SWORD?

“Think not that I am come to send peace on earth. I came not to send peace, but a SWORD,” Matthew 10:34

The Sadducees and a large portion of the Shammai Pharisees also followed suit; only the Hillel branch of Pharisees limped off to Yavne and survived; the Nazareens survived too, they fled to Pella on the northeastern side of the Jordan Valley.

If the 70 AD inferno was only a microcosm, a foretaste, how could those who deviate from the God ordained Calendar, who have similar deceptive beliefs as the original Essenes, escape John’s warning during the Last Days? Wouldn’t there be another Sodom and Gomorrah? And wouldn’t they also share its fate? It’s an unpleasant ending, but that’s what the Scriptures indicate.

The Essene/Qumran has their own 364 day solar calendar totally at odds with the calendrics of the Sanhedrin. Their sacred year always began on the vernal (spring) equinox and is, by definition, Wednesday (because God Created the “lights in the firmament” for “signs and seasons” on the 4th Day), 1st day of the 1st month (Nisan or Abib). Consequently, the Essene Passover will always begin at 6 PM Tuesday, 13 days later (Nisan 14). The key point being Essene Passover always began “Tuesday” evening, 13 days after the vernal equinox. To outsiders, the Essenes would appear to observe the vernal equinox and (regardless of whatever the previous day was) declare that day to be Wednesday 1 Nisan of their calendar.

The way of Sodom and Gomorrah? If not, why not?

The Essenes were pious, they practised celibacy, collective ownership, and plagued obedience to their leaders, chose not to possess slaves but served each other, to maintain a pure lifestyle, to abstain from criminal and immoral activities, they practised daily purification by water rituals and baptism and even refrain from defecation on the Sabbath. Yet the Essenes were wiped out during the AD 70 inferno.

But why? Why did they faced their Sodom and Gomorrah in AD 70! 

Had the Essenes acted presumptuously by repudiating the Calendar that God has instituted through the Sanhedrin? Were they found guilty of repudiating the Passover sacrifice in Jerusalem? Had the Essenes acted presumptuously?

If so, could this AD 70 INFERNO be just a microcosm during the endtime for those who promote their own calendar?

“Shall a trumpet be blown in the city, and the people not be afraid? Shall there be evil in a city, and the CREATOR of this Universe has not brought it about?”

What are the Oracles of God?

Extreme Drought across the Pacific

•May 21, 2021 • Comments Off on Extreme Drought across the Pacific
Taiwan rations water, drills extra wells amid record drought
Taiwan’s dried-up Sun Moon Lake

DW reports Taiwan drought could threaten global supply of electronic chips, posing a potential risk to the heavily water-reliant production of computer chips.

The two production hubs in Hsinchu and Taichung — where the world’s largest contract chipmaker Taiwan Semiconductor Manufacturing Company (TSMC) has factories — will have to reduce their water consumption if it does not rain by June 1, according to Reuters news agency.

The two science parks will not be affected by the measures, but must cut their water consumption by 17% in line with the country’s highest alert level, set by the economic ministry.

A News - Taiwan is drilling wells, seeding clouds to help the sub-tropical  island ride out its worst drought in more than half a decade, after  replenishing typhoons failed to make landfall
Praying to break Taiwan’s worst drought in 67 years

Taiwan alone produces some 20% of all semiconductors. Companies there, including TSMC, have been expanding to meet the increased demand. However, expansion has put extra strain on the water supply.

The island has also been rocked by energy challenges, with hydroelectric power plants running at reduced capacity, with both consumers and chipmakers increasing demand on the power grid.

In the past week, two major blackouts have hit the country.

On top of water and energy supply problems, authorities are also tackling a major outbreak of COVID-19 with an island-wide soft lockdown.

CBS NEWS Reports / April 12, 2021

Extreme drought across the Western US has become as reliable as a summer afternoon thunderstorm in Florida. And news headlines about drought in the West can seem a bit like a broken record, with some scientists saying the region is on the precipice of permanent drought.

drought.png

That’s because in 2000, the Western US entered the beginning of what scientists call a megadrought — the second worst in 1,200 years — triggered by a combination of a natural dry cycle and human-caused climate change.

In the past 20 years, the two worst stretches of drought came in 2003 and 2013 — but what is happening right now appears to be the beginning stages of something even more severe. And as we head into the summer dry season, the stage is set for an escalation of extreme dry conditions, with widespread water restrictions expected and yet another dangerous fire season ahead.

2020 was the worst fire season in the modern history of the West, with California and Colorado experiencing their largest fires on record. As can be seen in the below visual, the intensity of fires and acres burned tracks with increasing temperatures. Simply put, the warmer and drier it gets, the larger fires become.

acres-burned-2020-final.png

Because of a warming climate, fire season in the West is now two to three months longer than it was just a few decades ago. That means, with the dry season already getting underway in the West, the time to prepare for wildfires is fast approaching.

“And this the writing that is written, MENE, MENE, TEKEL, UPHARSIN.”

World Baffled by Australia’s Belligerence

•May 18, 2021 • Comments Off on World Baffled by Australia’s Belligerence

As relations between Australia and China continue to sour, other countries have admitted they’re baffled by Australian’s warlike behavior.

News Report by Natalie Wolfe / May 7, 2021

Nations around the world continue to express disbelief at the way Australia is handling its fraught relationship with China, with the US now joining the chorus.

Reporters for CNN, one of the biggest news companies in the US, this week penned an article about the escalating conflict between Australia and the global superpower.

“For a country with a much smaller military and no nuclear weapons, Australia is suddenly hinting an awful lot about a war with China,” the CNN article said.

On Tuesday, it was revealed that one of Australia’s top generals told troops last year there was a “high likelihood” of war with China.

Major-General Adam Findlay gave the candid and confidential briefing to Australia’s special forces soldiers last year, according to a report in The Age and The Sydney Morning Herald.

China to impose huge 'anti-dumping' tariffs up to 200% on Australian wine |  ABC News - YouTube

General Findlay, who has since stepped down but still advises the Australian Defence Force, reportedly said that China was already engaged in “grey zone” warfare and that Australia must prepare for the “high likelihood” it could spill over into actual conflict.

And on Anzac Day, newly appointed Defence Minister Peter Dutton said a conflict with China over Taiwan shouldn’t “be discounted”, and that Australians had to be “realistic” about the tensions between the two nations.

Australia going to war with China is ‘ridiculous’

The CNN article described the idea of Australia going to war against China on it own as “ridiculous”.

China spends 10 times more money on military than Australia does, according to the Stockholm International Peace Research Institute.

“Plus, China is a nuclear power. Australia is not,” the article said.

Australia and China relations have struggled since our nation called for a public investigation into China and how COVID-19 originated.

What is the relationship like between Australia and China? - Quora

Yun Jiang, the managing editor of the China Story blog at the Australian National University, said a lot of the issues were coming from Australia’s own politicians.

“Focusing on an external enemy has usually been quite effective in uniting public sentiment and rallying around the Government,” she told CNN.

“I think it’s irresponsible for the Government to talk it up like that. War is very serious business.”

China’s Foreign Ministry spokesman Lijian Zhao responded, “These people are the real troublemakers. I have noticed that many people in Australia have expressed disapproval on social media, saying that such inflammatory language are outrageous and extremely crazy.”

“Woe to the crown of pride, to the drunkards of Ephraim, whose glorious beauty is a fading flower, which is on the head of the fat valleys of them that are overcome with wine!” Isaiah 28:1

A Critique of UCG’s Pentecost 

•May 15, 2021 • Leave a Comment

A Critique of UCG’s Pentecost 

President — Victor Kubik
Chairman — Len Martin

United Church of God
P.O. Box 541027
Cincinnati, OH 45254-1027

Pentecost and Its Observance — A Doctrinal Study Paper (20 pages)
Approved by the Council of Elders September 1997

How to Count Pentecost, Feast of Weeks (Exodus 34:22), Feast of Firstfruits (Numbers 28:26), Festival of Fifty Days, Feast of Heptads, Festival of Seven Heptads, Wave Sheaf, Omer, “the firstfruits of thy labors which thou hast sown in the field (Exodus 23:16).”

This is a Critique of UCG’s Pentecost, the Feast of Weeks, or the Feast of Firstfruits. The counting to Pentecost is an extremely interesting subject and we’ll follow it in every issue discussed. Besides the main issue of when to start counting towards Pentecost is the issue of what the firstfruits mean. What or who do they represent? Are they humans or is it Christ?

Quoted are UCG’s “Pentecost and Its Observance” doctrinal paper, a Study Paper,1997, posted on its website. They are indented, in PINK, and in block form so as to differentiate UCG’s from other narratives or my comments. The Scriptures, in RED, must be our primary focus and guide, and sometimes the Scriptures, which include the Septuagint and the Targum, say things very different from what we think! 

And so with that in mind, we’ll begin:

The expression refers to the fact that Pentecost was the fiftieth day in a specific counting commanded in the Old Testament. The festival is one of the seven annual Holy Days listed in Leviticus 23. 

And you shall proclaim on the same day that it is a holy convocation to you. You shall do no customary work on it. It shall be a statute forever in all your dwellings throughout your generations (Leviticus 23:21).

This same Festival is referred to as “the Feast of Harvest, the firstfruits of your labor” (Exodus 23:16). (Pentecost and Its Observance pg 1)

Only one-tenth of an ephah “sheaf” finally accepted

That’s right! The “Feast of Harvest” is “the firstfruits of your labor” or the firstfruits of thy labors which thou hast sown in the field. Question. If this “firstfruits” represents Christ, what labor did we humans contribute to His resurrection? NOTHING!

Human beings contribute virtually nothing to the redemption of humanity. God the Father plans and carries out the redemption with His Son. Hence the teaching that Christ is the firstfruits “of thy labors” doesn’t have any merit.

In studying the observance of Pentecost, it is important to understand the historical context. It was in 1974 that the Worldwide Church of God began observing Pentecost on Sunday (the 50th day after the Sunday during the Days of Unleavened Bread). Mr. Armstrong’s position was that the issue should not be complicated with a number of technicalities. There was no attempt to ignore these technicalities and the subsequent study paper addressed most of them. To arrive at the correct biblical position in this matter, we need to study the relevant passages of scripture. After all, our position must rest on scripture and not necessarily on what has been practiced historically.

Leviticus 23

In dealing with Leviticus 23, we must address the term “Sabbath” and what it means in this context.  There are three references to the word Sabbath (or Sabbaths) in verses 15-16.

And you shall count for yourselves from the day after the Sabbath, from the day that you brought the sheaf of the wave offering: seven Sabbaths shall be completed. Count fifty days to the day after the seventh Sabbath; then you shall offer a new grain offering to the LORD.

The English word “Sabbath” or its plural “Sabbaths” is translated from the Hebrew shabbath or its plural form shabbathoth. Although there are some translations that use the word “weeks,” this is not the most common translation.  In fact, in the King James Version (KJV) the word shabbath (or its plural shabbathoth) is only translated Sabbath and is never translated weeks. There is another word in Hebrew which is translated weeks. This can be found in Deuteronomy 16:9  and also in Exodus 34:22. The word used in these verses for weeks is shabuoth. The singular form of this word is shabua. In the King James Version, and the New King James Version this Hebrew word is never translated as Sabbath. In twenty occurrences in the KJV, this word is translated as “week” (or weeks) nineteen times and on one occasion it is translated “seven.” The Englishman’s Hebrew-Chaldee Concordance of the Old Testament makes this point quite clearly. The word shabbath can be found 108 times and in every instance it is translated Sabbath or Sabbaths and never weeks. According to this same source, the Hebrew word shabuoth is never translated as Sabbath, but is in every instance but one translated as weeks. (Pentecost and Its Observance pg 8-9)

It is interesting to note that the writer intends to arrive at the correct biblical position in this matter by seeking the relevant Scriptures, but the evidence is that this stated intent is only lip service. After all, UCG’s position has always been centered on what had been practiced historically.

The King James Versions say:

Leviticus 23:15 “‘And ye shall count unto you from the morrow after the sabbath, H7676 from the day that ye brought the sheaf of the wave offering; seven sabbaths H7676 shall be complete:16 Even unto the morrow after the seventh sabbath H7676 shall ye number fifty days; and ye shall offer a new meat offering unto the LORD.

Leviticus 23:15-16 seven sabbaths [h7676 shabbat] according to Strong, this shabbat could be translated as:

(a) sabbath
(b) day of atonement
(c) sabbath year
(d) WEEK
(e) produce (in sabbath year)

According to Strong’s Concordance, this shabbat could be translated as a weekly sabbath or an annual sabbath like the Day of Atonement. It is also the same word for the seventh year where the land needs a rest. But the most important point in Strong’s Concordance is that it could also mean week, or a block of seven days. The JPS 1917 and the New JPS 1988 translate Leviticus 23:15-16 as follows:

Leviticus 23:15 And ye shall count unto you from the morrow after the day of rest (footnote: Sabbath), from the day that ye brought the sheaf of the waving; seven weeks shall there be complete; 16 even unto the morrow after the seventh week shall ye number fifty days; and ye shall present a new meal-offering unto the LORD. (JPS 1917)

Leviticus 23:15 And from the day on which you bring the sheaf of elevation offeringthe day after the sabbathyou shall count off seven weeks. They must be complete; 16 you must count until the day after the seventh weekfifty days; then you shall bring an offering of new grain to the LORD. (New JPS 1988)

Note: the word sabbath [h7676 shabbat] could be translated as week or weeks. To restrict the word to only the weekly sabbath is misguided. The above extract is as if Moses had written the Original Scriptures in the English James King Version. The King James translation is generally good, but at times, could be ridiculous, as translated in Numbers 25:4 

KJV: And the Lord said unto Moses, Take all the heads of the people, and hang them up before the Lord against the sun, that the fierce anger of the Lord may be turned away from Israel. — this includes all men, women and children; all are to be hung! Genocide!

Compared to:

Amplified Bible: The Lord said to Moses, “Take all the leaders of the people [who have committed sin with the Moabites], and execute them in broad daylight before the Lord, so that the fierce anger of the Lord may turn away from Israel.”

Septuagint: And the Lord said to Moses, Take all the princes of the people, and make them examples of judgment for the Lord in the face of the sun, and the anger of the Lord shall be turned away from Israel.

Look at the official UCG logo and it tells a story. The church has the mistaken notion that the center of this Universe is the British Isles instead of Jerusalem, whereas God’s main interest is centered in Jerusalem. Here are the evidence:

II Kings 21:4 . . . the Lord said, “In Jerusalem will I put My name.”
II Kings 21:7 . . . the Lord said to David and to Solomon his son, “In this house and in
Jerusalem, which I have chosen out of all tribes of Israel, will I put My name for ever.
II Chronicles 6:6 . . . but I have chosen
Jerusalem, that My name might be there.
II Chronicles 33:4 . . . the Lord had said, “In
Jerusalem shall My name be for ever.”
Ezra 7:19 The vessels also that are given thee for the service of the house of thy God, those deliver thou before the God of
Jerusalem.
Ezra 8:30 So the priests and the Levites took the weight of the silver and the gold and the vessels, to bring them to
Jerusalem unto the house of our God.
Psalm 116:19 in the courts of the Lord’s house, in the midst of thee, O
Jerusalem. Praise ye the Lord!
Psalm 125:2 As the mountains are round about
Jerusalem, so the Lord is round about His people from henceforth, even for ever.
Psalm 135:21 Blessed be the Lord out of Zion, who dwelleth in
Jerusalem! Praise ye the Lord!
Psalm 147:12 Praise the Lord, O
Jerusalem! Praise thy God, O Zion!
Isaiah 2:3 And many people shall go and say, “Come ye, and let us go up to the mountain of the Lord, to the house of the God of Jacob; and He will teach us of His ways, and we will walk in His paths.” For out of Zion shall go forth the law, and the word of the Lord from
Jerusalem.
Isaiah 28:14 Therefore hear the word of the Lord, ye scornful men, that rule this people which is in
Jerusalem.
Jeremiah 3:17 At that time they shall call
Jerusalem the Throne of the Lord, and all the nations shall be gathered unto it, to the name of the Lord, to Jerusalem.
Ezekiel 5:5 “Thus saith the Lord God: This is
Jerusalem. I have set it in the midst of the nations and countries that are round about her.
Micah 4:2 And many nations shall come and say, “Come, and let us go up to the mountain of the Lord, and to the house of the God of Jacob. And He will teach us of His ways, and we will walk in His paths.” For the law shall go forth from Zion, and the word of the Lord from
Jerusalem.
Zechariah 8:3 “Thus saith the Lord: ‘I am returned unto Zion, and will dwell in the midst of
Jerusalem; and Jerusalem shall be called a city of truth, and the mountain of the Lord of hosts, the Holy Mountain.’
Zechariah 14:8 And it shall be in that day, that living waters shall go out from
Jerusalem, half of them toward the eastern sea and half of them toward the hinder sea; in summer and in winter shall it be.

UCG’s Self-Absorbing Logo

The focus of UCG is not in Jerusalem, but on the British Isles. It may seem innocuous and insignificant, but God says He is a jealous God. Their focus are on themselves, their elitist Anglo-Saxonisn — an indication of where members of the Council of Elders came from — their minds unfocused on the themes of God, but all about their self-centered hubris. 

“History Doesn’t Repeat Itself, But It Rhymes.” 

“Ephraim compasseth me about lies, and the house of Israel with deceit” (Hosea 11:12).

The house of Judah operates with hypocrisy but the house of Ephraim operates with lies and deceits!  The Scriptures say so!

And here are some examples:

In an August 2002 speech that kicked off the Bush White House administration’s campaign for war against Iraq, Cheney asserted, “Simply stated, there’s no doubt that Saddam Hussein now has weapons of mass destruction. There is no doubt he is amassing them to use against our friends, against our allies, and against us.”

In October 2002, Defense Secretary Donald Rumsfeld claimed he had “bullet-proof” evidence that Saddam was tied to Osama bin Laden. And a National Intelligence Estimate said Iraq had “continued its weapons of mass destruction program.”

“However, there is no doubt at all that the development of weapons of mass destruction by Saddam Hussein poses a severe threat not just to the region, but to the wider world.” – Tony Blair, House of Commons, 10 April 2002.

Prime Minister Tony Blair defended himself in 2005: “I have never told a lie. No. I don’t intend to go telling lies to people. I did not lie over Iraq.”

But these are only following their first lie by King Jeroboam, an Ephraimite:

“It is too much for you to go up to Jerusalem,” says King Jeroboam. “Behold thy gods, O Israel, which brought thee up out of the land of Egypt!” (I King 12:28).

So he (King Jeroboam) offered upon the altar which he had made in Bethel the fifteenth day of the eighth month, even in the month which he had devised of his own heart, and ordained a feast unto the children of Israel; and he offered upon the altar and burned incense (I King 12:33).

Jeroboam was of the house of Ephraim; he was not supposed to offer sacrifices, which were reserved only for the Aaronic Priesthood of the house of Judah. Further let’s take a closer look into this prophecy regarding the House of Manasseh rallying with the House of Ephraim against Judah:

Manasseh, Ephraim; and Ephraim, Manasseh; and they together shall be against Judah. For all this His anger is not turned away, but His hand is stretched out still (Isaiah 9:21).

Manasseh and Ephraim are united against Judah; their quarrels, contentions, and wars among themselves, whereby they fight, devoured, and consumed each other, though they were brethren; which explains and confirms what is before said, of no man sparing his brother, and everyone eating the flesh of his own arm. 

Cliffords Tower, York, England Free Stock Photo - Public Domain Pictures
Massacre of Jews in Clifford’s Tower 1189-1190

In 1190 THE MASSACRE OF THE JEWS at Clifford’s Tower the British expelled all Jews from his kingdom and only some four hundred years were they allowed to return in the 17th century.

Furthermore, the pogroms of 1189 and 1190 are just the tip of an iceberg. Here in Wikipedia it documents more than two hundred years (1066–1290) of persecutions.

The Targum bore testimony the words in Isaiah 9:21:

“they of the house of “Manasseh” with those of the house of “Ephraim”, and they of the house of “Ephraim”, with those of the house of “Manasseh”, shall be joined together as one, to come against them of the house of Judah.”

Rashi: “Manasseh” shall be joined with “Ephraim”, and “Ephraim” shall be joined with “Manasseh”, and they together shall be joined against Judah;’

Gill: for all this his anger is not turned away, but his hand [is] stretched out still;

that is, the anger of God, that was not turned away; he had not yet stirred up all his wrath, he had not done with them, he had still other judgments to bring upon them; and his hand continued to be stretched out to inflict them, seeing they were not brought to repentance by what was already done unto them; so the Targum,

“for all this they do not return from their sins, that he may turn away his anger from them, but still retain their sins; and yet his stroke will be to take vengeance on them.”

The anger of God will soon hit Ephraim and Manasseh. Blind and deceitful Guides! Ephraim compasseth the world with lies! Such parallels are astonishing! Why have they ignored the warning of the Prophets, Isaiah, Jeremiah, Ezekiel, and especially Ezra? Even other English versions have translated “seven weeks” correctly in Leviticus 23:15,16. Blind Guides! Why have UCG blushed off these other translations? These are:

The Companion Bible (Bullinger)
Common English Bible (CEB)
Complete Jewish Bible (CJB)
Contemporary English Version (CEV)
Christian Standard Bible (CSB)
Darby Translation (DARBY)
Easy-to-Read Version (ERV)
English Standard Version (ESV)
Expanded Bible (EXB)
GOD’S WORD Translation (GW)
Good News Translation (GNT)
Holman Christian Standard Bible (HCSB)
International Children’s Bible (ICB)
International Standard Version (ISV)
Lexham English Bible (LEB)
The Message (MSG)
Modern English Version (MEV)
Names of God Bible (NOG)
New American Bible (Revised Edition) (NABRE)
New Century Version (NCV)
New English Translation (NET Bible)
New International Version (NIV)
New Life Version (NLV)
New Living Translation (NLT)
Revised Standard Version (RSV)
The Voice (VOICE)
Wycliffe Bible (WYC)

Also, if Leviticus 23:11,15-16 are restricted to a weekly Sabbath, there is no proof as to which one, since there are over 50 weekly sabbaths during the year. Another problem arises when the fourteenth of Nisan falls on a weekly Sabbath. And so there are different interpretations among the different CoG Communities adding confusion to confusion. Why choose one instead of another especially where there is no solid evidence to be found?

Council of Elders
UCG’s Council of Elders – a display of a self-serving Anglo-Saxonisn elitist Church

Further in Deuteronomy 16:9 it says:

Deuteronomy 16:9 Seven weeks shalt thou number unto thee: begin to number the seven weeks from such time as thou beginnest to put the sickle to the corn.

Putting the Scriptures in Leviticus 23 and Deuteronomy 16 together, they may appear to say different things. Surely they don’t, but how do we reconcile them? 

First we must realize that the books of Genesis, Exodus, Leviticus and Numbers were mainly the words of God to His subjects — from Adam to Abraham, on to Moses — but in the book of Deuteronomy it was Moses speaking to the Israelites. Deuteronomy 1:1 says “These are the words which Moses spoke unto all Israel on this side of the Jordan . . . 3 And it came to pass in the fortieth year . . .  that Moses spoke unto the children of Israel according unto all that the Lord had given him.”

In a language meant to be more easily understood, Moses uses the word šāḇûa [h7620] in Deuteronomy:

Deuteronomy 16:9 Seven weeksH7620 shalt thou number unto thee: begin to number the seven weeksH7620 from such time as thou beginnest to put the sickle to the corn.

Deuteronomy 16:9 Seven weeks [h7620 shabua] Strong translates shabua as seven, period of seven (days or years), heptad, week

A. period of seven days, a week
Feast of Weeks
B. heptad, seven (of years)

UCG points out that shabua is never translated as a sabbath. That is true, but UCG fails to explain that shabua is generally described as a block of seven days, or heptad. So what is a block of sevens?  It is a group or series of seven — it could be days or years.

Ambassador Bible College Class of 2021 with faculty members – same tune different lyrics

In all, the Bible has used “šāḇûa H7620twenty times. We should study each of them in detail. Here are all their uses, all 20 of them, in 17 verses:

Gen 29:27 Fulfil her week, H7620 and we will give thee this also for the service which thou shalt serve with me yet seven other years. — this is a block of seven years

Gen 29:28 And Jacob did so, and fulfilled her week: H7620 and he gave him Rachel his daughter to wife also. — again, this is a block of seven years

Exo 34:22 And thou shalt observe the feast of weeks, H7620 of the firstfruits of wheat harvest, and the feast of ingathering at the year’s end. — This is the Feast of Weeks, which could also be called the Feast of Firstfruits, the firstfruits of thy labors which thou hast sown in the field

Lev 12:5 But if she bear a maid child, then she shall be unclean for two weeks, H7620 as in her separation: and she shall continue in the blood of her purifying threescore and six days. — this is a block of two weeks

Num 28:26 Also in the day of the firstfruits, when ye bring a new meat offering unto the LORD, after your weeks H7620 be out, ye shall have an holy convocation; ye shall do no servile work — this is the Feast of Firstfruits, which could also be called the Feast of Firstfruits, the firstfruits of thy labors which thou hast sown in the field

Deu 16:9 Seven weeks H7620 shalt thou number unto thee: begin to number the seven weeks H7620 from such time as thou beginnest to put the sickle to the corn. — this is the Feast of Weeks, and is NEVER called the Feast of Sabbaths. The difference is that the count starts immediately; no need to wait until the weekly Sabbath has arrived

Deu 16:10 And thou shalt keep the feast of weeks H7620 unto the LORD thy God with a tribute of a freewill offering of thine hand, which thou shalt give unto the LORD thy God, according as the LORD thy God hath blessed thee: — this is the Feast of Weeks, NEVER the Feast of Sabbaths

Deu 16:16 Three times a year shall all thy males appear before the LORD thy God in the place which he shall choose; in the feast of unleavened bread, and in the feast of weeks, H7620 and in the feast of tabernacles: and they shall not appear before the LORD empty: — again, this is the Feast of Weeks or the Feast of Firstfruits, the firstfruits of thy labors which thou hast sown in the field

II Ch 8:13 Even after a certain rate every day, offering according to the commandment of Moses, on the sabbaths, and on the new moons, and on the solemn feasts, three times in the year, even in the feast of unleavened bread, and in the feast of weeks, H7620 and in the feast of tabernacles. — this is the Feast of Weeks or the Feast of Heptads

Jer 5:24 Neither say they in their heart, Let us now fear the LORD our God, that giveth rain, both the former and the latter, in his season: he reserveth unto us the appointed weeks H7620 of the harvest. — this is a block of weeks

Eze 45:21 In the first month, in the fourteenth day of the month, ye shall have the passover, a feast of seven H7620 days; unleavened bread shall be eaten. — a block of seven days: this is the most obvious illustration that shabua is NOT connected to the weekly sabbath. It starts IMMEDIATELY after Passover! And NO NEED to wait until the weekly Sabbath to start! The blind couldn’t see this because they are blind

Dan 9:24 Seventy weeks H7620 are determined upon thy people and upon thy holy city, to finish the transgression, and to make an end of sins, and to make reconciliation for iniquity, and to bring in everlasting righteousness, and to seal up the vision and prophecy, and to anoint the most Holy. — a block of seventy weeks

Dan 9:25 Know therefore and understand, that from the going forth of the commandment to restore and to build Jerusalem unto the Messiah the Prince shall be seven weeks, H7620 and threescore and two weeks: H7620 the street shall be built again, and the wall, even in troublous times. — a block of sixty-nine weeks

Dan 9:26 And after threescore and two weeks H7620 shall Messiah be cut off, but not for himself: and the people of the prince that shall come shall destroy the city and the sanctuary; and the end thereof shall be with a flood, and unto the end of the war desolations are determined. — a one week block; the seventieth week

Dan 9:27 And he shall confirm the covenant with many for one week: H7620 and in the midst of the week H7620 he shall cause the sacrifice and the oblation to cease, and for the overspreading of abominations he shall make it desolate, even until the consummation, and that determined shall be poured upon the desolate. — a one week block; the seventieth week

Dan 10:2 In those days I Daniel was mourning three full weeks. H7620 — a block of three weeks

Dan 10:3 I ate no pleasant bread, neither came flesh nor wine in my mouth, neither did I anoint myself at all, till three whole weeks H7620 were fulfilled. — a block of three weeks

See the source image

All their uses show heptad is a block of seven — days or years — but NEVER is it used as a weekly Sabbath, nor does it have to align with the weekly Sabbath. It is a BLOCK of seven, and it can start on any day. 

The term was first used in Genesis 29:27-28 when Jacob had to serve seven years marriage to Leah, and another seven to marry Rachael. The seven years period began immediately when Jacob and Laban concluded their agreement.

When Moses wrote or spoke in Deuteronomy 16, he uses this word shabua that was different from that expressed in Leviticus, to clarify that the start of the count to Pentecost need not start at the beginning of a week, but that it can start “on the morrow after the Sabbath,” and that Sabbath is an annual Sabbath, the First Day of Unleavened Bread, followed by seven blocks of days. 

As the wordings in Deuteronomy16 show, Moses would clarify seemingly unclear issues in Leviticus 23, or to elucidate complex subjects. And when Ezra returned from Exile, he, too, used expressions which appeared different from what God or Moses used. We can see those expressions in the Targum.

The Targum makes it extremely clear:

Leviticus 23:15 And number to you after the first feast day of Pascha, from the day when you brought the sheaf for the elevation, seven weeks; complete they shall be.

The reference is from the day “after the first feast day of Pascha.” Since Passover also means Unleavened Bread, this is the day after the first Day of Unleavened Bread. And this is confirmed in Septuagint 23:11 and he shall lift up the sheaf before the Lord, to be accepted for you. On the morrow of the first day the priest shall lift it up. “The first day,” of course, refers to the first Day of Unleavened Bread; and to the morrow after is the sixteenth of Nisan. 

The Targum is an important source of our Scriptures. Blind Guides! Why would we ignore such an important witness? Naked Preachers! 

Let’s go and check into what the Targum is and what it says:

The Targum known in Hebrew: תרגום, plural: the targumim play an important role in translating many of our modern editions. The range of its origin was from 530 BC to 500 AD. When the Israelites returned from their exile in Babylon in the 6th century BC, most of them could no longer speak Hebrew; they spoke Aramaic. Nevertheless, the Scriptures have always been read in Hebrew even if no one in the greater community could speak it.

Golds World of Judaica - Targum Onkelos
Blind Guides wouldn’t use the Targum, a Cornerstone of Scriptural Understanding

Something had to be done so that the people would understand God and His Word. The sages, starting with Ezra, found an answer. After hearing a priest read a few verses of the Torah scroll in Hebrew, they then heard a translation in Aramaic called a Targum, which simply means translation. Hence the Targum is an Aramaic translation of the Hebrew Bible (Tanakh) that was written or compiled in Palestine or in Babylonia from the Second Temple period until the early Middle Ages (late first millennium). 

One might think that God would have given the Levites privileged land as their inheritance to match their privileged position, but God actually gave them no land inheritance at all. Instead, they received agricultural and monetary tithes from the people as their inheritance. In this capacity, the Levites and priests had the opportunity to minister to the people through the instruction of the Torah. 

Back in Jerusalem, for instance, after returning from Babylonian exile, Ezra, a Levite and high priest, read and translated the Torah in Hebrew into the common Aramaic language, and he, or other Levites, explained the Torah so the people could understand. 

“The Levites … instructed the people in the Law while the people were standing there. They read from the Book of the Law of God, making it clear and giving the meaning so that the people understood what was being read” (Nehemiah 8:7–8).

Another way of saying: The Law was read by Ezra, verse by verse, and each verse was followed by a recitation by the Levites of the Aramaic version. Hence, we have to assume that the action of Ezra narrated in Nehemiah 8:8 implied not only the reading of the Law, but also the interpretation of its language — its translation in fact from Hebrew to Aramaic, and that, further, this practice was long followed in all the synagogues among the returning Exiles in Judea.

The Targum is like a mirror: when placed against the end-time CoG Communities, it reflects their nakedness. And the Targum stated clearly that the counting is the morrow after the first festal day of Pascha. Leviticus 23:11-13 And he shall uplift the sheaf before the Lord to be accepted for you. AFTER THE FIRST FESTAL DAY OF PASCHA (OR, THE DAY AFTER THE FEAST‑DAY OF PASCHA) on the day on which you elevate the sheaf, you shall make the sacrifice of a lamb of the year, unblemished a burnt offering unto the Name of the Lord . . . 15 AND NUMBER TO YOU AFTER THE FIRST FEAST DAY OF PASCHA, from the day when you brought the sheaf for the elevation, seven weeks; complete they shall be.

A Partial Week?

Are the weeks (shabuoth) referenced in Deuteronomy 16 truly full weeks, each ending with a Sabbath?  Can there be partial weeks in this count?  A partial week will result when a day other than the first day of the week is used as day one.  If the count were intended to start on any other day of the week, say, a Wednesday, seven weekly cycles would be completed on a Tuesday. In this case we would have a partial week, Wednesday to Sabbath, six complete weeks from Sunday to Sabbath, and another partial week from Sunday to Tuesday.  Notice how this would look if you began your count on a Wednesday:

Wednesday to Sabbath = one partial week, 4 days 6 full weeks (Sunday to Sabbath) = 42 days Sunday to Tuesday = one partial week, 3 days Total of 49 days, followed by the 50th day on Wednesday (morrow after the 49th day)

We could also count seven Sabbaths, and not have 49 days. In the hypothetical example above we count the seven Sabbaths, and then we still have to count the remaining days of Sunday through Tuesday to complete the seven weekly cycles.  It should be noted here that the NRSV (New Revised Standard Version), Moffat, NIV, and the JPS (Jewish Publication Society) all translate Leviticus 23: 15 “seven Sabbaths shall be complete” as “seven weeks” or “seven full weeks.”  The King James Version and the New King James Version are both faithful to the original Hebrew text where the word shabbath is used.  If weeks were the intended meaning in these verses, then a different Hebrew word should have been used– shabuoth.

It is certainly true that seven full weeks could be satisfied by seven weekly cycles, independent of when the weekly cycle started.  Thus, it would be permissible to have two fragments of a week and six complete weeks (from the first day through the seventh day or Sabbath) according to this explanation.  But is this what is intended by the scriptures?

An argument could be made here that God starts the week on the first day and ends it on the seventh day, the creation week being an example (Genesis 1).  This argument, however is not necessary in the determination of how to count to the day of Pentecost.  It is to be noted here that Deuteronomy was written after Leviticus.  The instructions from Leviticus have to be taken into account, as Deuteronomy supplements Leviticus.  There is no contradiction between the two. (Pentecost pg 12-13)

This is correct, that the “seven full weeks could be satisfied by seven weekly cycles, independent of when the weekly cycle started.” Pentecost is NEVER called the Feast of Sabbaths, it’s the Feast of Weeks, or Feast of Heptads (blocks of sevens). The Feast of Weeks could start at any day of the week. The best illustration is Ezekiel 45:21 where it testifies the seven-day Feast of Unleavened Bread could start at any time of the week.

Look at Ezekiel 45:21 again:

In the first month, in the fourteenth day of the month, ye shall have the passover, a Feast of Haptads (a block of seven) H7620 days; unleavened bread shall be eaten.

Note carefully, the seven days Feast of Unleavened Bread starts IMMEDIATELY after Passover, so it could be a Monday, or any day after Passover, but the most important characteristic is that it starts IMMEDIATELY to begin the block of seven weeks! There is no waiting even for a single day. That’s why Pentecost is called the Feast of Weeks but never the Feast of Sabbaths.

The Pharisees and Sadducees were both sects of the Jews in the first century. The two groups had numerous differences, one of them being the method of counting Pentecost.  It is acknowledged that during the first century C.E. and up until the destruction of the Temple in 70 C.E., the Sadducees controlled worship at the temple. . . . 

It is only after the destruction of the Temple that the Pharisees gain control and the Sadducees, for the most part, disappear:

Except under Salome Alexandra the Pharisees have the role of a minority up to A.D. 70.  Their great period comes only with the fall of the hierocracy.  When the capture of Jerusalem shatters the Sadducean ideal, Pharisaism provides the direction needed for reconstruction. Politically independent, it nurtures community life in the synagogue.  The failure of the Zealots clears the way for more moderate leaders such as Jochanan ben Zakkai. Jabneh with its chakamim [sages], which plays no part in the revolt, forms a center for reorganization. (Pentecost pg 16)

On first appearance, the Sadducees seemed to have control over the worship at the temple, but it wasn’t the case. Josephus, an eye witness living during the first century, wrote in his Antiquities of the Jews, saying that the Pharisees were the dominant religious party during the time of Christ, and that they controlled the worship services. 

Now, for the Pharisees, they live meanly, and despise delicacies in diet; and they follow the conduct of reason; and what that prescribes to them as good for them they do; and they think they ought earnestly to strive to observe reason’s dictates for practice. They also pay a respect to such as are in years . . .  on account of which doctrines they are able greatly to persuade the body of the people; and whatsoever they do about Divine worship, prayers, and sacrifices, they perform them according to their direction (Antiquities 18.1.3).

The bulk of the common people followed the Pharisees. And although the Sadducees were occupying the upper stratum of the Jewish aristocracy, they were few in numbers, hence they were unable and unwilling to carry out their own beliefs in the Temple service, “because the multitude would not otherwise bear them” but to carry “the notions [directions] of the Pharisees”:

Image result for josephus pics

But the doctrine of the Sadducees is this: That souls die with the bodies; nor do they regard the observation of any thing besides what the law enjoins them; for they think it an instance of virtue to dispute with those teachers of philosophy whom they frequent: but this doctrine is received but by a few, yet by those still of the greatest dignity. But they are able to do almost nothing of themselves; for when they become magistrates, as they are unwillingly and by force sometimes obliged to be, they addict themselves to the notions of the Pharisees, because the multitude would not otherwise bear them. (Antiquities 18.1.4).

The Unger’s Bible Dictionary tells us further political-religious amalgamation called the Sadducees:

“Their political supremacy was, however, of no long duration. Greatly as the spiritual power of the Pharisees had increased, the Sadducean aristocracy was able to keep at the helm in politics. The price at which the Sadducees had to secure themselves power at this later period was indeed a high one, for they were IN THEIR OFFICIAL ACTIONS TO ACCOMMODATE THEMSELVES TO PHARISAIC VIEWS. With the fall of the Jewish state the Sadducees altogether disappear from history. (“Sadducees,” Pg 954).

The strength of the Sadducees was mainly in politics and living luxurious lives. “What servant would work all day without obtaining his due reward in the evening?” they asked themselves, and so they broke away from the Law and lived in great luxury, using silver and gold vessels at banquets; and they established schools which declared the enjoyment of this life to be the goal of man, at the same time pitying the Pharisees for their bitter privation in this world with no hope of another world to compensate them. These schools were called, after their founders, Sadducees after their apparent founder, Zadok; and Boethusians, after Boethus the high priest brought over by King Herod the Great from Alexandria.

In the book Faith in the Future, we find a chapter which discusses this subject in some detail.  The chapter is entitled “Shavuot/Pentecost, Israel’s Wedding” and the book was written by Jonathan Sacks, who is currently Chief Rabbi of the United Hebrew Congregations of the British Commonwealth:

In Judaism, mysteries have a habit of becoming controversies, none more so than in the case of Shavuot, otherwise known as Pentecost or the Feast of Weeks.  Shavuot generated one of the great arguments in Jewish history. . . The argument became acute in the days of the second Temple when Jews were divided into several groups, most notably the Sadducees and Pharisees.  We know all too little about this period, but we can say this.  Of the two groups, the Sadducees were the more affluent and influential.  They were closely connected to the Temple hierarchy and to the political elite.  They were as near as Jewry came to a governing class. . . The Torah had specified that the counting of seven weeks should begin on the “day after the Sabbath.”  The Sadducees took this literally.  The counting should begin on Sunday, so that Shavuot would always fall on Sunday seven weeks later.  The Pharisees invoked tradition and argued instead that in this case “sabbath” meant “festival,” specifically the first day of Pesach.” 

From the above quotes, it may be deduced that the Pharisees were unable to convince the Sadducees that the Feast of Weeks always falls on a fixed date of Sivan 6.  The two groups were clearly divided over this issue. (Pentecost pg 17)

When it comes to Temple services Josephus testifies that the Sadducees submitted themselves to the notions of the Pharisees, because the multitude would not otherwise tolerate them. But why, you may ask. There was a Talmudic report of a Sadducean high priest, R Abbahu, who suffered badly by following the Sadducaic interpretation.

It was reported that coming out of the Holy of Holies on the Day of Atonement, he was hit from behind between his shoulders. He fell forward and hit the floor on his face. It was believed that an angel kicked him, a type of sound was even heard in the Temple courtyard, whose sole of a foot had the mark of a calf-hoof, (Ezekiel 1:7). 

A mark of a calf’s hoof appeared right at the center of Abbahu’s forehead and his nose started to discharge worms. And he died a terrible death a few days later. (Yoma 19b)

This testimony of God’s judgement recorded in the Talmud would have struck fear and trepidation and permeated the Land of Israel for numerous generations to come, about where the LORD’s position is and how His laws should be interpreted, but another major event would come to be ignored.

The significance of the destruction of the Temple in 70 AD should not be understated. It came forty years after John the Baptist had given a stern warning about another consuming fire recorded in Luke 3:16. The number 40 generally symbolizes a period of testing, trial or probation. During Moses’ life he lived forty years in Egypt and forty years in the desert before God selected him to lead his people out of slavery.

Because of their perversion, God destroyed Sodom and Gomorrah during Abraham’s time. The Blind have ignored John’s warning about another consuming fire recorded in Luke 3:16. John said unto them:

“I indeed baptize you with water; but One mightier than I cometh, the straps of whose shoes I am not worthy to unloose. He shall baptize you with the Holy Ghost and with FIRE. 17 His winnowing fan is in His hand, and He will thoroughly purge His floor and will gather the wheat into His garner; but the chaff He will burn with FIRE unquenchable.” (Luke 3:16)

The word “FIRE” is highlighted above, with a hope that the Blind could see finally. When we look back, one cannot avoid concluding that God had deemed that the Sadducees and the Boethusians were worthy of extinction during the 70 AD INFIRNO. Everything about the Sadducees and the Boethusians were destroyed — they “disappeared.” A large portion of the Shammai Pharisees also followed suit; only the Hillel branch of Pharisees limped off to Yavne and survived. 

Now, just as the victims of Sodom and Gomorrah have revived today, so were those of the Sadducees and Boethusians! They, too, have revived as a “Reform Movement.”

So says the United Hebrew Congregations on its website:

We are a Reform congregation with a traditional mind-set and a progressive heart. As a congregation affiliated with the Union for Reform Judaism, we strive to attain the high ideals of the movement. We make informed, meaningful choices from Jewish tradition to guide our observance, take an open-minded approach to Jewish religious belief and practice, and provide a home where members can cultivate, explore, and expand their spirituality.

The origins of Reform Judaism started in 19th-century Germany, where its early principles were formulated by Rabbi Abraham Geiger (1810-1874). Since the 1970s, the Movement adopted a policy of inclusiveness and acceptance, inviting as many as possible to partake in its communities, rather than “strict theoretical clarity,” and away from the “Bondage of Judaism.”

AbrahamGeiger.png
Abraham Geiger (1810-1874)

Reform Judaism initially developed as lay Jews simply lost interest in the strict observances required of Orthodoxy, with many seeking shorter services, more frequent sermons, and organ music, modeled after Protestant churches. Thus Reform Judaism’s own mandate is “a process of constant evolution” and it “rejects any fixed, permanent set of beliefs, laws or practices.” In an attempt to alter the appearance and ritual of Judaism and to mimic German Protestantism, they stated that the old mechanisms of religious interpretation were obsolete and a new one had to be found. 

Hence Geiger sought a more coherent ideological framework to justify innovations in the liturgy and religious practice. Discrimination and persecution against Jews were rampant for the next hundred years in Germany. Works were hard to come by and such new interpretation made sense in a community struggling to survive. 

One characteristic of their progressive revelation was the institution of a “Second Sabbath” on Sunday, modeled on the Second Passover, as most people desecrated the day of rest. “If you cannot keep the Sabbath on its appointed time, you keep it on the next available day,” and so the Sabbath was shifted from Saturday to Sunday. “God would accept it,” they justify themselves and encourage each other.

America was opening up to immigrants and in a new Land of the Free, the five-day workweek soon made the Sunday Sabbath redundant. But nevertheless, the Movement had already had its momentum and today the Reform Movement’s largest center is in North America. 

Reform Judaism encourages adherents to seek their own means of engaging a new Judaism, enhancing “individualism.” Tolerance for LGBT and ordination of LGBT rabbis were also pioneered by the Movement. It started slowly then gathered speed. Intercourse between consenting adults was declared as legitimate by the Central Conference of American Rabbis in 1977, and openly gay clergy were admitted by the end of the 1980s. Same-sex marriage were sanctioned by the end of the following decade. In 2015 the Union for Reform Judaism (URJ) adopted a Resolution on the Rights of Transgender and Gender Non-Conforming People, urging clergy and synagogue attendants to actively promote tolerance and inclusion of such individuals.

If the 70 AD inferno was only a microcosm, a foretaste, how would the Reform Movement and its CoG Communities, who have similar deceptive beliefs as the original Sadducees and Boethusians, escape John’s warning during the Last Days? Isn’t this a return to the days of Sodom and Gomorrah? And also to share its fate? And why is it so coincidental that the end-time lackadaisical churches described as “wretched” and “blind” and “naked”? It’s an unpleasant descripture, but that’s what the Scriptures say.

How did the Sadducees just “disappeared” in 70 AD?

These Blind Guides may have grand aspirations but they are misguided! The Targum ireflects their nakedness. When placed against the end-time CoG Communities, it reflects their wretchedness. Woe unto the shepherds of Israel (the shepherds of the United States, Britain and related countries), says the Lord, for they feed themselves but not the sheep!

Although Ezekiel’s message was to both the “house of Israel” and the “house of Judah” its main message after chapter 24 was to the “house of Israel.” Captivities were the end results historically for both kingdoms, but today, the main focus in Ezekiel chapter 34 is on the Northern Kingdom with dire warning, especially its shepherds: 

Ezekiel 34:1 And the word of the Lord came unto me, saying,2 “Son of man, prophesy against the shepherds of Israel, prophesy and say unto them, ‘Thus saith the Lord God unto the shepherds: Woe to the shepherds of Israel that feed themselves! Should not the shepherds feed the flocks? 3 Ye eat the fat, and ye clothe yourselves with the wool, ye kill the ones that are fed; but ye feed not the flock. 4 The diseased have ye not strengthened, neither have ye healed that which was sick, neither have ye bound up that which was broken, neither have ye brought again that which was driven away, neither have ye sought that which was lost; but with force and with cruelty have ye ruled them. 5 And they were scattered because there is no shepherd, and they became meat to all the beasts of the field when they were scattered. 6 My sheep wandered through all the mountains and upon every high hill; yea, My flock was scattered upon all the face of the earth, and none did search or seek after them. — Adam Clarke: The prophet is commanded to declare the dreadful judgments of God against the covetous shepherds of Israel, who feed themselves, and not their flocks; . . . the using these tithes and offerings, not to enable them the better to fulfill the work of the ministry, but to pamper their own bodies, and support them in an idle voluptuous life . . . and maintain their own luxury and idolatrous prodigality . . . The fat sheep point out the rich to whom these pastors often disguised the truth, by a cruel condescension and complaisance . . . And the consequence was, grievous wolves, false and worldly interested teachers, seized on and made a prey of them.

~~~~~

A Strange Coincidence for Taiwan?

•May 14, 2021 • Comments Off on A Strange Coincidence for Taiwan?
Tripsavvy's LGBTQ Travel Guide For Taipei, Taiwan
Taipei Pride parade – a beacon for Asia?

When Taiwan became the first place in Asia to allow same-sex marriage on May 24, 2019, many thousands of gay people were cheering and waving the rainbow flags on the streets of the capital Taipei.

And the Taipei Pride parade a few months later drew 200,000 participants from all over the world to celebrate Taiwan’s image as a beacon of gay rights in Asia.

“One year has passed, the values we want to protect still exist and at the same time, we have let more people embrace happiness together,” President Tsai Ing-wen, who won her reelection by a landslide and was sworn in for a second term, said, expressing her pleasure that her Taiwanese society had become more diverse and open since passing the law.

Dried Up Sun Moon Lake in Taiwan Turns into Beautiful Grassland after the  Drought - EverydayOnSales.com News
Dried-up Sun Moon Lake

Two years on, the island has been suffering its worst drought in 67 years, with the island reservoirs at dangerously low levels. Taiwan’s Sun Moon Lake is so low that parts of it have dried and turned to grass. Jetties that normally float are sprawled awkwardly on dry land, and tour boats are crowded at the tail ends of pontoons still in the water.

Taiwan is supposed to be one of the rainiest places in the world – its climate is subtropical in the northern and central regions, and tropical in the south. Typhoons are common in summer and autumn, and it also gets monsoons. It rains so often here that umbrellas are placed at subway stations and businesses for anyone to borrow.

Taiwan’s reservoirs are usually full, but in 2020 not one monsoon made landfall. And it could happen again in 2021. There have been mass prayer events to the sea goddess Matsu, but still no rain, only some drizzles!

The government also resorted to cloud seeding around several reservoirs, but the measure did not yield any positive result. Now, most reservoirs in Taoyuan, Hsinchu, and Miaoli are less than 15% full. Several in central Taiwan are less than 10%.

Chinese believe where there is crisis, there is opportunities! Taiwan’s true pride, TSMC, is currently at its Prime. Like eveything else, this could change. Their goddess Matsu who was originally revered by Fujianese across the Taiwan Strait might have other idea.

林默娘公園林默娘像.jpg
Would Taiwan’s deity, Matzu, listen to their prayers?

The Diplomat Reports (May 1, 2021) As Drought Worsens Chip Shortage, Taiwan Fights Brain Drain to China

Taiwan, home to two-thirds of the world semiconductor manufacturing capacity during the worst global chip shortage in recent memory, is under enomous pressure to alleviate this global chip shortage, but worst still, is fighting a recruitment drive of its engineers by its mainland Chinese competitors.

Taiwan’s labor ministry has ordered online job boards to remove all listings by Chinese employers attempting to recruit Taiwanese engineers to their semiconductor firms, an escalation in an intensifying technology standoff as mainland too, is also looking to Taiwan to alleviate its chip shortage.

The move comes as Taiwan continues to withstand a historic drought that has threatened the speed of chip production, which requires lots of water.

Taiwan’s Pride, TSMC – Still at its Prime

On April 27, Taiwan President Tsai Ing-wen called for the island to conserve more water, especially in the semiconductor hub of Taichung.

Taiwan has ensured that water keeps flowing to its chipmakers during its drought. TSMC has used large water trucks to help store water, and the company is building a plant that would treat industrial water for reuse.

While the world watches the impact Taiwan’s drought has on its chipmakers, the water shortage has also harmed the island’s agriculture industry. Taiwan has shut off irrigation to tens of thousands of acres of farmland, harming production of crops ranging from rice to lychees.

So is there a Strange Coincidence for Taiwan? Your take.

“Be afraid,” warns David Goldman of tsunamis to come, “Be very afraid!”

Washington is playing a Game without a Strategy

•May 11, 2021 • Comments Off on Washington is playing a Game without a Strategy

Washington is playing a losing game with China

EastAsiaForum 9 May 2021

Author: Chas W Freeman Jr, Brown University

America’s latest policies toward China will prove self-defeating. US–China relations now exemplify Freeman’s third law of strategic dynamics: for every hostile act there is a more hostile reaction.

US Secretary of State Antony Blinken (2nd R), joined by National Security Advisor Jake Sullivan (R), speaks while facing Yang Jiechi (2nd L), director of the Central Foreign Affairs Commission Office, and Wang Yi (L), China's State Councilor and Foreign Minister, at the opening session of US-China talks in Anchorage, Alaska, 18 March 2021 (Photo: Frederic J Brown/Pool via Reuters).
Chas Freeman: Washington is playing the China Game without any Strategy.

Washington would be easy to spot in a game of chess. It’s the player with no plan beyond an aggressive opening. That is no strategy at all. The failure to think several moves ahead matters.

Washington developed some well-founded complaints about Chinese economic behaviour — and launched a trade war. Washington was alarmed about China’s potential to outcompete America — and tried to cripple it with an escalating campaign of ‘maximum pressure’. Washington saw China as a threat to US military primacy — and sought to contain it.

Facebook
China’s Strategy on STEM Scientists and R&D

US farmers have lost most of their US$24 billion Chinese market. US companies have had to accept lower profits, cut wages and jobs, defer wage hikes, and raise prices for American consumers. The US shift to managed trade has cost an estimated 245,000 American jobs, while shaving about US$320 billion off US GDP. 

American families are paying as much as US$1,277 more a year on average for consumer goods. There has been almost no reshoring of American jobs outsourced to China. The United States can expect job losses of 320,000 by 2025 and a GDP US$1.6 trillion less than it would have been.

China’s overall trade surplus rose to a new high of US$535 billion in 2020. Beijing improved its position by lowering barriers, striking free trade deals with countries other than the United States, and sponsoring a trade dispute-settlement mechanism to replace the US-sabotaged WTO.

China is investing 8 per cent more each year in education. China already accounts for a quarter of the world’s STEM workforce. Its science investment is almost on par with that of the United States and rising at an annual rate of 10 per cent as America’s falls. Its infrastructure is universally envied. China accounts for 30 per cent of global manufactures, versus America’s 16 per cent, and the gap is growing. It became the world’s largest consumer market in 2020. Its economy is ferociously competitive. China has many problems, but it has its act together and appears on top.

Imagine if only half of this Annual $750B Military Drainage had been reallocated to STEM and R&D!

The principal challenge that China presents is not military but economic and technological. But the United States is geared only to deal with military threats. China has become the antidote to the US post-Cold War-enemy-deprivation syndrome and a gratifying driver of US defence spending.

There are US aircraft and ships aggressively patrolling China’s borders, but no Chinese aircraft and ships off America’s coast. US bases ring China. There are no Chinese bases near America.

Still, the once indispensable nation ups its defence budget to make its ability to overwhelm China more credible. Yet, in the long run, this indispensable nation cannot outspend China militarily and cannot even hope to beat it on its home ground.

Just Whose Coast Is the Coast Guard Guarding? by Ted Galen Carpenter / May 11, 2021

“The Lord shall smite thee with madness, and blindness, and astonishment of heart; and thou shalt grope at noonday, as the blind gropeth in darkness,” (Deuteronomy 28:28-29)

A ‘Catastrophic’ Risk, Warns Henry Kissinger

•May 6, 2021 • Leave a Comment

Endless US-China Contest Risks ‘Catastrophic’ Conflict, Henry Kissinger Warns

Henry Kissinger warns of 'catastrophic' conflicts unless China and US  settle their differences | South China Morning Post

Excerpts from NEWSWEEK By David BRENNAN – 3/26/21

Few people are as well connected or have more diplomatic experience than Kissinger, particularly when it comes to America’s bilateral ties with China. Beijing is not “determined to achieve a world domination,” Kissinger said in a recent Chatham House webinar “they’re trying to develop the maximum capability of which their society is able.”

The 97-year-old Kissinger called on the US to create a balance with existing global forces, saying

“And if you imagine that the world commits itself to an endless competition based on the dominance of whoever is superior at the moment, then a breakdown of the order is inevitable. And the consequences of a breakdown would be catastrophic.”

The veteran diplomat warned the US of creating a pre-World War One situation:

“Is it possible for us to develop a foreign policy thinking together with allies and understood by other countries that looks for world order at the basis of that sort of analysis? And if we don’t get to an understanding with China on that point, then we will be in a pre-World War One-type situation in which there are perennial conflicts that get solved on an immediate basis but one of them gets out of control at some point.”

The Straits Times (May 1, 2021) published another speech given and reaffirmed his thoughts that United States-China tensions threaten to engulf the entire world and could lead to an Armageddon-like clash between the two military giants.

Strains with China are “the biggest problem for America, the biggest problem for the world,” Mr Kissinger told the McCain Institute’s Sedona Forum on global issues.

“Because if we can’t solve that, then the risk is that all over the world a kind of cold war will develop between China and the United States.”

More from RT “For the first time in human history, humanity has the capacity to extinguish itself in a finite period of time,” Kissinger said, “the nuclear issue is added the high tech issue, which in the field of artificial intelligence, in its essence is based on the fact that man becomes a partner of machines and that machines can develop their own judgement.” This is not just about nuclear missiles, as it was in the days of America and the Soviet Union, but also about the ability of advanced technology to reimagine and refine warfare in ways not conceived previously.

Speaking of Ephraim:

“In all your dwelling places the cities shall be laid waste, and the high places shall be desolate, that your altars may be laid waste and made desolate, and your idols may be broken and cease, and your images may be cut down, and your works may be abolished” Ezekiel 6:6.

China’s new battle into Space

•May 4, 2021 • Comments Off on China’s new battle into Space

China’s space station means lift-off on a new battle for the galaxy … and just like on Earth, Beijing has America worried

By CGTN – April 29, 2021

Joe Biden’s prediction of a technological war with Beijing will be played out in outer space. And as the creation of a new space station and other successful missions demonstrate, China is intent on winning the strategic battle.

On Thursday, China sent the core module of its first-ever space station, the Tianhe – or ‘Harmony of the Heavens’ – up into orbit. It’s long been under development, and marks a huge breakthrough in the country’s space program.

The space-based construction effort requires 10 additional launches from 2021 through 2022: two more module launches, four crewed missions and four cargo vessel flights, as reported by China Global Television Network (CGTN).

Three types of Long March carrier rockets will jointly launch the remaining 10 missions. When completed, China’s orbiting outpost will form a T-shape with Tianhe at the center and two other modules, Wentian and Mengtian, on each side.

The only current space station in orbit is the ISS which is a collaboration between Russia, the US, Canada, Europe and Japan. China has been blocked from participating in it.

China is pioneering a space program that is not only advancing very quickly, but successfully. This will almost certainly put NASA to the test, and it is a competition which, as we saw previously, is likely to massively broaden our perspective and understanding of the universe around us.

China has made no secret of its space ambitions. It has poured significant funding into its space efforts, and in 2019 became the first country to send an uncrewed rover to the far side of the Moon.

President Xi Jinping has also thrown his support behind the country’s space endeavours and the Chinese state media regularly cast the “space dream” as one step in the path to “national rejuvenation.”

This national rejuvenation in developing space capabilities are manifold. Satellites facilitate military and civilian communications. Human spaceflight garners international prestige, while also providing opportunities for cutting-edge research.

China Is Set to Launch First Module of Massive Space Station
From Tiangong to Tianhe (2021-2022)

Experiments conducted in space have resulted in numerous breakthroughs that have been used to address medical, environmental, and technological challenges back on Earth.

The ISS is due to be retired after 2024, which could potentially leave Tianhe as the only space station in Earth’s orbit.

China welcomes collaboration on the CSS from scientists all over the world but also could use this to gain diplomatic leverage, since countries interested in continuing research in space could be compelled to look to the Chinese space program in the absence of other alternatives.

But US law prohibits NASA scientists from collaborating directly with China.

“Woe to the crown of pride, to the drunkards of Ephraim, whose glorious beauty is a fading flower, which is on the head of the fat valleys of them that are overcome with wine!” Isaiah 28:1

China’s new missiles into the US

•May 3, 2021 • Comments Off on China’s new missiles into the US

China’s new nuclear submarine missiles expand range in US: analysts

The Type 094A Nuclear Submarine

SCMP reports May 2, 2021

China’s newly commissioned nuclear-powered submarine is armed with the country’s most powerful submarine-launched ballistic missile (SLBM) capable of hitting the US mainland, according to a military source and analysts.

The Type 094A, or Jin-class nuclear-powered ballistic missile submarine (SSBN), was presented last Friday as part of the celebration to mark the 72nd anniversary of the PLA Navy. It was capable of firing the JL-3, or Julang (Big Wave) SLBM with a range over 10,000km (6,200 miles), a source close to the navy said.

“The Type 094A is an upgraded version of the Type 094 that overcame one of the key problems – noise – by improving hydrokinetic and turbulent systems, allowing it to carry the more powerful JL-3,” said the source, who requested anonymity because of the sensitivity of the subject.

JL-3 | Tiananmen's Tremendous Achievements
The JL-3 SLBM with a range of 10,000 km

“Before the upgrade, the submarine was armed with the inferior JL-2 that could only hit the northeast United States, but now it’s able to cover the whole American continent.”

Chinese submarines have been dogged by the problem of being too noisy and easy to detect but that has largely been remedied in recent years by Chinese naval engineer Rear Admiral Ma Weiming, who is now taking the lead in a cutting-edge propulsion technology, according to state media.

“The children of Ephraim, being armed and carrying bows, turned back in the day of battle” Psalm 78:9

Annabel Yao – China’s Rising Soft Power!

•May 3, 2021 • Comments Off on Annabel Yao – China’s Rising Soft Power!
Annabel Yao: Ái Nữ Của Ông Trùm Huawei Đã Từng Từ Chối Trở Thành Con Dâu  Vua Sòng Bài Macau

Countries that can successfully leverage their national power are able to affect the behavior of other political actors. This can be accomplished through traditional “hard” power measures, such as threats or coercion, or through “soft” power, which enables countries to persuade or attract others to support their interests.

A country’s soft power is heavily dependent upon its global image and international prestige. In the case of China, the central government has developed top-down strategies for enhancing China’s soft power, which in conjunction with public diplomacy, are designed to cultivate a positive international image of China.

And this mood seems to be shifting. Annabel Yao, the daughter of Huawei founder Ren Zhengfei, is one example of soft power; she has forayed her aspiring career into the entertainment industry instead of the cutthroat world of Huawei.

On January 18, 2021, she debuted her first single, sung in a mix of Chinese and English, is called Backfire.

Younger sister of Huawei's Meng Wanzhou is jealous of her popularity |  Vancouver Sun

“I never saw myself as a princess,” she said in the documentary, which shows her preparations ahead of the debut and touches on her billionaire father.

“Just like most people my age, I needed to put a lot of effort into studying to get into a good school,” she added, having graduated with a degree in computer science from Harvard University.

But she has drew much criticism, with some saying she lacks voice and moves. Others ridiculed her as self-indulgent, insincere and insensitive.

Thiên kim tiểu thư tập đoàn Huawei chính thức gia nhập showbiz, từ gia thế  đến học vấn đều 'hàng khủng'

“Her singing and dancing abilities are not enough to make her a star,” complained one Weibo user.

“Based on your talent, was it possible for you to become an artist without your family background?” asked another.

Another commented on Yao’s privileged upbringing with a withering assessment: “Can’t sing, can’t dance, but if you have money…”

Others however expressed opposition to attempts to discredit Yao because of her family’s fortune, and pointing out that all big names in entertainment rely on family support.

“I also felt lost after college, but I kept trying different things before I found what I was passionate about,” she said, defending herself, prefering to shake her bum to advance China’s soft power than her father’s dog-eat-dog world of Huawei.

FORT DETRICK – SOURCE of COVID-19?

•April 30, 2021 • 6 Comments
This image has an empty alt attribute; its file name is main-qimg-b2c88901d9e4c44d436d6ddf6e8f931b
FORT DETRICK, the nerve center of US biological weapons program, was “shut down” in July 2019 but resumed back on November 25, 2019. Is this FORT the Source of COVID-19?

Is FORT DETRICK the SOURCE of COVID-19?

In the months leading up to the Outbreak of COVID-19 in China, US media reported an outbreak of a fatal respiratory disease of unknown cause near Fort Detrick. What’s more, Fort Detrick was suddenly and mysteriously closed in July 2019, just before the onset of an unknown infectious disease a few months later, and the US government has so far been reluctant to explain why. Suspicions are growing and there are calls for an international investigation of the largest biological and chemical weapons site in the United States, but the the US Administration has repeatedly rejected such call.

In August 1945, Japan surrendered to the Allies and Unit 731’s leader, General Shiro Ishii, ordered his more than 10,000 workers to bury the evidence by destroying the facilities, killing and burying the remaining prisoners, releasing all disease-infected animals, and taking their secrets to the grave.

The United States granted General Ishii and a number of other prominent Unit 731 workers immunity from war crime investigations in exchange for the medical research they accumulated from their experiments.

On 6 May 1947, Douglas MacArthur, as Supreme Commander of the Allied Forces, wrote to Washington that “additional data, possibly some statements from Ishii, can probably be obtained by informing Japanese involved that information will be retained in intelligence channels and will not be employed as ‘War Crimes’ evidence.”

The Soviet-US rivalry was soon to turn into the Cold War, and the US wanted to get ahead of the USSR in biological warfare research. The Americans did not want the publicity of an international war crime trial, which would leak any of the secret and valuable research to the Soviets that the Japanese had accumulated at the high cost of hundreds of thousands of human lives.

Unfortunately, this decision not only undermined the integrity of the Tokyo Tribunal, but also deprived the victims of Unit 731 of any kind of justice, and its effects are still in evidence more than 70 years later. Until recently, Japan denied the very existence of Unit 731 and the crimes it committed on primarily Chinese, but also Korean, Russian and Allied prisoners of war. This lack of accountability is evident in Japan’s revisionist history, and relations between China and Japan are strained, in part due to Japan’s refusal to acknowledge its wartime actions

Thomas Powell Quora reported how consequently the US government gave immunity and took Unit 731 scientists home to America; how Fort Derrick was where many of the Japanese scientists (including Shiro Ishii “took his research data and begged for remission” for himself and his associates) ended up; and where the US’s bio-weapon program got started. Of particular interests to American bio-weapon scientists were data about “Caucasian and Asiatic prisoners with fatal pathogens to determine possible racial differences in natural immunity.”

Excerpts from Global Times, who asks for an explanation:

USAMRIID, (the US Army Medical Research Institute of Infectious Diseases at Fort Detrick, Maryland) the US largest research center for biochemical weapons, has long been enmeshed in scandal. 

The institute once had shady connections with Unit 731, a Japanese Imperial Army unit notorious for its atrocious and lethal chemical experimentation on Chinese and Russian people during World War II, said a Chinese biosecurity expert who spoke on anonymity.

The US had a backdoor deal with then detainees of Unit 731 after the war, granting immunity from prosecution to many of the unit’s members in exchange for its biological warfare and experiment data for USAMRIID, the expert told the Global Times.

CAMP DETRICK / UNIT 731 Transplant / USAMRIID / FORT DETRICK – Aerial view

What are Fort Detrick’s remaining secrets? Why did the closure of Fort Detrick coincide with the timeline of “vaping illness,” the pandemic flu and COVID-19, and why don’t US politicians, Democrates and Republications, ask the Fort to be opened for investigation and give Americans an explanation? The US has been preaching about transparency and being clean, so why not takes this opportunity to prove to the world that the United States is, indeed, transparent and clean? What an opportunity!

Ralph Baric in his lab
Professor Ralph S. Baric; from SHC014 with the help of a “naive Snow White” Shi Zhengli, is this virologists the Father of COVID-19?

Time reported high cancer rate, Agent Orange and anthrax, weaponized botulism and radioactive carbon here. John Hopkins Public Health news here. Baltimore Sun here.

For those living near Fort Detrick and are affected by sickness, diseases, cancer or any other illness, please check here.

Would a Chernobyl incident happen one day at Fort Detrick and the Supreme Court finally consent to opening up the secret Fort for an investigation?

And below is a testimony from an anonymous “Samantha Hill” — an ex-employee of the bioweapon lab at Fort Detrick, using a twitter account to testify that Professor Ralph Baric – “a science-maniac” – is the creator of the COVID-19 virus and that she had now fled back to India when her continual presence there had become dangerous:

Image

Research into deadly viruses and biological weapons at US army bio weapon lab shut down over fears these deadly viruses could have escaped. Perhaps one day when racial issues become so polarized, a new President, probably one of colored like a probable President Harris, President Haley (or even the International Criminal Court in The Hague, Netherlands) would be compelled to open the Fort for investigation. And if found guilty, this could be one possible way Ephraimites may be carried away screaming into captivity as prophesied.

More from The Independent Aug 6, 2019; New York Times Aug 5, 2019;

A couple of US athletes became sick during the Wuhan Army Games (Oct 18–27, 2019) and until today why is this mysterious “sickness” remains classified?

More from Politico for a briefing by Stephen Kinzer’s new book Poisoner in Chief: Sidney Gottlieb and the CIA Search for Mind Control, September 15, 2019

In 1954, a prison doctor in Kentucky isolated seven black inmates and fed them “double, triple and quadruple” doses of LSD for 77 days straight. No one knows what became of the victims. They may have died without knowing they were part of the CIA’s highly secretive program to develop ways to control minds—a program based out of a little-known Army base with a dark past, Fort Detrick.

Suburban sprawl has engulfed Fort Detrick, an Army base 50 miles from Washington in the Maryland town of Frederick. Seventy-six years ago, however, when the Army selected Detrick as the place to develop its super-secret plans to wage germ warfare, the area around the base looked much different. In fact, it was chosen for its isolation. That’s because Detrick, still thriving today as the Army’s principal base for biological research and now encompassing nearly 600 buildings on 13,000 acres, was for years the nerve center of the CIA’s hidden chemical and mind control empire.

Detrick is today one of the world’s cutting-edge laboratories for research into toxins and antitoxins, the place where defenses are developed against every plague, from crop fungus to Ebola. Its leading role in the field is widely recognized. For decades, though, much of what went on at the base was a closely held secret. Directors of the CIA mind control program MK-ULTRA, which used Detrick as a key base, destroyed most of their records in 1973. Some of its secrets have been revealed in declassified documents, through interviews and as a result of congressional investigations. Together, those sources reveal Detrick’s central role in MK-ULTRA and in the manufacture of poisons intended to kill foreign leaders.

Excerpts from Samantha Hill’s testimony for further analysis below:

Why was China so naive and silly as to allow the Wuhan Institute of Virology to receive foreign funding ($3.7m) from the US’ NIH to “collect about 15,000 bat samples / to identify bat coronaviruses that were at high risk of jumping to humans”? More in Science Magazine
Poorly supervised, a pretty “Snow White” Shi Zhengli was doing labwork and legwork – “Gain-of-Function” – on behalf of Professor “Science-Maniac” at UNC, Chapel Hill
Has Professor Ralph Baric been developing this COVID-19 virus to produce an effect only on the non-white??

In innumerable times, President Trump, a Republican, said the virus will soon go away. For a record here, on March 25, 2020 BBC (and numerous media) reported Trump says: “We’re going to be opening relatively soon… I would love to have the country opened up and just raring to go by Easter.”

Had President Trump been misguidedly briefed on something from their research at Fort Detrick about the “China virus” that fellow Americans knew nothing about? As reported in POLITICO, here is what Nikki Harly said of Trump: “He was getting bad advice from bad people who were filling his head with self-destructive fantasies.”

Covid BioWeapon: Is this Made in the USA?

Dark and glommy days lie ahead for the modern descendents of Ephraim; for the LORD looks down from HEAVEN and says:

“I have seen a horrible thing in the house of Israel; there is the whoredom of Ephraim, Israel is defiled” Hosea 6:10.

“Ephraim shall be desolate in the day of [My] rebuke” Hosea 5:9.

And His Judgement of removing EPHRAIM’s Mandate of Heaven is sure:

“The Lord shall cause thee to be smitten before thine enemies; thou shalt go out one way against them and flee seven ways before them, and shalt be removed into all the kingdoms of the earth.”

“And thy carcass shall be meat unto all fowls of the air and unto the beasts of the earth, and no man shall frighten them away. The Lord will smite thee with the boils of Egypt, and with the hemorrhoids, and with the scab, and with the itch, whereof thou canst not be healed,” (Deuternomy 28:25-27).

With few exceptions, most Mandates run around 200, 250 or 300 years. Another GREAT Change is about to take place!

China’s African Iron Ore Strategy

•April 30, 2021 • Comments Off on China’s African Iron Ore Strategy
The Simandou range of hills in Guinea

China’s opportunity is its Africa’s giant iron ore field and its strategy may spell danger for Australia.

Australia is currently the largest source of feed for China’s steel mills, with around 60% of China’s iron ore imports originating from Australian mines. But ongoing tension between the countries have alarmed the iron ore and steel industry, with speculation over the future of the China-Australia iron ore trade.

The top focus for China’s diversification push is Guinea, an impoverished but mineral rich country in West Africa. A 110 km range of hills called Simandou is known to hold the world’s largest reserve of untapped high-quality iron ore.

A dream deferred | Article | Africa Confidential

This Simandou range of hills deep in the hinterland of Guinea boasts the world’s largest untapped iron ore reserves. Advocates of the site have labelled it a “Pilbara killer,” and the site is said to boast the world’s largest untapped iron ore reserves. They could reshape the global supply chain of the critical ingredient of steel, the world’s second-most traded commodity behind crude oil and has the potential to change the dynamics of the global iron ore market and put China in the driver’s seat.

With the iron ore price hovering around US$160 a tonne and Australia exporting about 20 million tonnes of ore from the Pilbara every week, the country is earning about $585 million a day from China (or around $200 billion a year).

Simandou is one great alternative, which is expected to have an estimated reserves of 2.4 billion tonnes of ore grading 65% iron metal. The project is expected to start its first production in 2025/26.

A new variant emerging in India is uncontrollable

•April 29, 2021 • Comments Off on A new variant emerging in India is uncontrollable
Johns Hopkins’ Daily cases in India – 28/4/21

Why India’s Covid crisis matters to the whole world

A new variant emerging in India called B.1.617 is uncontrollable. It has 13 mutations that result in amino acid changes; and it has been described as a ‘double mutant.’

By Rebecca Morelle
BBC News 28/04/2021

The harrowing scenes from India have shocked the world, as the country struggles with soaring cases of Covid.

But the outbreak isn’t just a crisis for India – it’s a crisis for everyone.

“The virus doesn’t respect borders, or nationalities, or age, or sex or religion,” says Dr Soumya Swaminathan, the World Health Organization’s chief scientist.

“And what’s playing out in India now unfortunately has been played out in other countries.”

Millions of Devotees take holy dips in the river Ganges

The pandemic has revealed just how interconnected the world is. And if a country has very high levels of infection, then it’s likely to spread to other countries.

Even with travel restrictions, multiple tests and quarantine, infections can still leak out; and if a traveller has come from somewhere where the virus is very prevalent, they have a higher chance of taking the virus with them. On a recent flight from New Delhi to Hong Kong about 50 passengers tested positive for Covid-19.

A new variant has emerged in India called B.1.617. It’s been dubbed by some as the “double mutant” because of two key mutations on the spike of the virus. There’s some lab evidence that suggests it’s slightly more transmissible and that antibodies may find it harder to block the virus, but scientists are still assessing how much immunity is lost.

“I don’t think there’s any evidence that it’s an escape mutation [which would mean] it fundamentally can’t be stopped by the vaccines,” Dr Jeff Barrett, director of the Covid-19 Genomics Initiative at the Wellcome Sanger Institute, told BBC News.

“I think we have to obviously watch carefully, but there’s at present no reason to panic about it.”

Globally, the pandemic shows no sign of easing, with the virus devastating country after country.

The situation in India is a bleak reminder that none of us will be safe until everyone is safe.

And earlier the Australian Strategist reports India being ‘the global nerve centre of … multinational supply chains in the post Covid-19 world’ and endoses Prime Minister Modi misplaced confidence:

In his virtual address to the UN General Assembly on 26 September, Modi boasted that India’s pharmaceutical industry had sent essential medicines to more than 150 countries and promised: ‘India’s vaccine production and delivery capacity will be used to help all humanity in fighting this crisis.’

And The Malay Mail and many other news report 28 Apr 2021 the setbacks

Covid pyres make Uttar Pradesh build iron curtain - Telegraph India

WHO: Indian Covid variant found in at least 17 countries.

The UN health agency said the B.1.617 variant of Covid-19 first found in India had as of yesterday been detected in over 1,200 sequences uploaded to the GISAID open-access database “from at least 17 countries”.

“Most sequences were uploaded from India, the United Kingdom, USA and Singapore,” the WHO said in its weekly epidemiological update on the pandemic.

I create darkness; I create evil; I, the LORD, do all these things (Isaiah 45:7).

Huawei Soaring Ahead with 6G

•April 27, 2021 • Leave a Comment
Infographic: China Leads the 6G Charge | Statista
China Leads The 6G Charge, the United States isn’t far behind.

Huawei set to launch test satellites for 6G technology verification

Excerpts from Global Times: Apr 24, 2021

An even greater danger: China claims to have launched world's first 6G  satellite

Chinese technology giant Huawei is reportedly set to launch two satellites together with two Chinese partners in July this year, with aims including the verification of the 6G network technologies that the company has taken the lead in the research and development (R&D) around the world.

Compared with the construction of 5G networks that rely on base stations to transmit signals, 6G networks, conveying higher frequencies, need using satellite for communications instead of base stations where there will be low penetrability.

Late last year, China launched world’s first 6G experiment satellite from the Taiyuan Satellite Launch Center in North China’s Shanxi Province, marking a breakthrough in the exploration of terahertz space communication technologies in China’s space field.

Actually back in 2019, Huawei proposed its vision to launch more than 10,000 small satellites to provide 6G services covering the world, during a global 6G summit.

engineering.com - Forget 5G. What's in Store for 6G?
Huawei sets its 6G target for service with 10,000 small satellites by 2030

The satellite, carrying a terahertz satellite communication load, planned to establish a transceiver link on the satellite platform and carry out terahertz load tests.

Huawei’s rotating chairman Xu Zhijun announced at Huawei global analysts conference held earlier this month that the Chinese tech giant will launch its 6G networks in 2030.

The Register says on April 27, 2021

China’s State Intellectual Property Office has proclaimed the nation already dominates the world in development of patents pertinent to sixth-generation mobile networks.

The Office (CNIPA) chose World Intellectual Property Day (April 26th) to assert China’s 6G dominance, telling state-controlled media that its analysis of patent applications relevant to the next-gen standard found 38,000 relevant pieces of work of which 35 percent come from China (from 5G: China 19.3%; S Korea 23%).

Currently, there are over 38,000 patents globally related to 6G technologies, the report says. With 13,449 6G patents, or 35% of the global total, Chinese institutions and companies have filed the most patent applications than any other country. The United States comes in second place with 18%.

Speaking of Ephraim:

And thou shalt become an astonishment, a proverb, and a byword among all nations whither the Lord shall lead thee,” Deuteronomy 28:37

TSMC founder Morris Chang’s Gloomy Prediction

•April 27, 2021 • Leave a Comment
TSMC's Announcement Of A New U.S. Semiconductor Fab Is Big News
Morris Chang’s gloomy prediction for US plant

TSMC founder Morris Chang says China’s semiconductor industry is five years behind, but chip making will not flourish in the United States.

SCMP by Josh Ye – 22 Apr, 2021

In a rare public appearance since retiring nearly three years ago, Morris Chang, the 89-year-old founder of the world’s largest contract chip maker, said China is not yet a competitor in chipmaking and that Taiwan should defend its leadership in semiconductor manufacturing.

Chang, who established Taiwan Semiconductor Manufacturing Co (TSMC) in 1987, is seen as the father of Taiwan’s success in the foundry business. At a forum hosted by Economic Daily in Taipei on Wednesday, Chang spoke about separate efforts by China and the US to build up their own chip-making capabilities.

In his speech, Chang also took a swipe at US chip giant Intel, describing its recent decision to enter the contract chip making market as “very ironic” because it turned down an opportunity to invest in TSMC more than three decades ago. Contract chip makers like TSMC typically take orders from so-called fabless chip makers like Qualcomm, which design their products but outsource the manufacturing.

As well as the efforts in China and the US, the European Union (EU) is looking to bring core semiconductor manufacturing back to the continent. Even before US President Joe Biden pledged to invest US$50 billion to strengthen chip manufacturing at home, the EU announced a goal of doubling its share of semiconductor production to 20 per cent of the world total by 2030.

Chang said the US is at a disadvantage compared with Taiwan because it lacks engineers dedicated to the semiconductor manufacturing sector, adding that the “US level of dedication to manufacturing was absolutely no match for that of Taiwan.”

“What I need right now are capable and dedicated engineers, technicians and operators. And they have to be willing to throw themselves into manufacturing,” he added. “In the US, doing manufacturing isn’t popular. It hasn’t been popular for decades.”

“Computers of different brands can often be hooked together but not people of different culture,” he said, referring to the preponderance of Taiwanese and Taiwan-trained managers and technicians at TSMC.

TSMC Responds to Pressure for US-Based Fab, Announces Plans for $12 Billion  Chip Factory in Arizona - News
TSMC to build a $12 billion fab in Phoenix

“It was a breeze for us to rotate technicians and staff among the three fabs across the island and when employees change over from one location to another, they even do not need to move their homes thanks to Taiwan’s bullet trains and highways and well-rounded transport and logistical support.”

“It’s unlikely we can replicate all these in Arizona.”

Refering to its $12 billion semiconductor fab in north Phoenix, Chang said the unit cost of chipmaking in the US is higher than in Taiwan, adding that subsidies from the federal and state governments “will not last forever” and are not enough to offset the long-term competitive weakness of making chips in the US.

Eventually, competing against an even more strict and disciplined 996 culture across the Pacific, TSMC American workers will unionize themselves which will inevitably and consequently destroy their newly found establishment as they had destroyed their car manufacturing industry as demonstrated by their now bankrupt Detroit.

Chang said that Samsung Electronics remains TSMC’s biggest rival in outsourced wafer fabrication, adding that South Korea enjoys many of the same advantages as Taiwan, which include an ability to foster top-notch talent for the industry.

“South Korea has similar competitive edges as Taiwan,” he said. “However, what is good in South Korea is not necessarily good if they need to operate in foreign countries.” He meant, of course, Samsung’s still undecided next chip plant in Texas, Arizona, or New York as the prime example of such a fab in a foreign country, the United States.

Currently, about 75% of semiconductor manufacturing capacity, as well as many suppliers of key materials, are concentrated in Japan, South Korea, Taiwan and China, according to a report by the Semiconductor Industry Association. The SIA further pointed out that Taiwan accounted for 92% of global production of advanced chips below 10 nanometers, a number that refers to the linewidth between transistors on a chip and is used as an indicator of performance — the smaller the number, the more advanced the chip.

Speaking of Ephraim:

“In all your dwelling places the cities shall be laid waste, and the high places shall be desolate, that your altars may be laid waste and made desolate, and your idols may be broken and cease, and your images may be cut down, and your works may be abolished” Ezekiel 6:6.

Whistleblower Sibel Edmonds

•April 26, 2021 • Leave a Comment

Excerpts from Wikipedia

Sibel Deniz Edmonds is a former contract translator for the Federal Bureau of Investigation (FBI) and the founder and editor-in-chief of the independent news website NewsBud.

The FBI hired her as a translator shortly after 9/11 but fired her after less than seven months. She identified herself as a whistleblower and challenged her termination; however, the courts dismissed her lawsuit for wrongful termination because the FBI would need to disclose privileged information. She accused a colleague of covering up illicit activity involving Turkish nationals, alleged serious security breaches and cover-ups and that intelligence had been deliberately suppressed, endangering national security. Following her accusations, the US attorney-general imposed a state secrets privilege order on her, which prevents her from revealing more information about the FBI. The PEN American Center awarded her the PEN/Newman’s Own First Amendment Award in 2006 for her claims. She published a memoir in March 2012, titled Classified Woman – The Sibel Edmonds Story.

Sibel edmonds on RT.png

Sibel Edmonds is the founder and publisher of the Boiling Frogs Post, an online media site that claims to offer nonpartisan investigative journalism. In 2016 as editor-in-chief Sibel expanded and founded NewsBud independent news media with associates, partnered with BFP.

There is clearly a focus on bringing China down. It has been happening for many years. For example, in 2006, the US military came up with findings as follows:

The US Quadrennial Defense Review of 2006 stated that China has “the greatest potential of any nation to militarily compete with the US and field disruptive military technologies that over time offset traditional US advantages”.

The above findings confirm China as the country that the US must bring down so that it does not overtake the US as the top economy of the world and the top superpower of the world. But as Sibel testifies above, the US has been trying to contain China’s rise as early as 1996.

“For the head of Syria is Damascus, and the head of Damascus is Rezin; and within threescore and five years shall Ephraim be broken, that it be not a people” Isaiah 7:8

Australia’s rising military suicides

•April 20, 2021 • Leave a Comment
Chart of the day: The complex link between defence and suicide - ABC News

ABC News (April, 19, 2021)

Australian Prime Minister Scott Morrison has announced that a Royal Commission will be established to investigate the rising number of suicides among military personnel, after public outrage pressured the government to act.

Speaking to reporters on Monday, Morrison unveiled the plan to establish the independent inquiry into the number of current and former military personnel committing suicide, after government figures showed more than 500 had taken their own life since 2001.

If a Royal Commission is established, Australia, which has more than 3,000 troops deployed around the world, would join the United States, Britain and Canada in exploring ways to prevent suicide rates among serving and former military personnel.

The Lord shall smite thee with madness, and blindness, and astonishment of heart; and thou shalt grope at noonday, as the blind gropeth in darkness,”(Deuteronomy 28:28-29)

The Scary War Game Over Taiwan

•April 16, 2021 • Leave a Comment

“The children of Ephraim, being armed and carrying bows, turned back in the day of battle” Psalm 78:9

The Scary War Game Over Taiwan That the US Loses Again and Again

By Richard Bernstein, RealClearInvestigations
August 17, 2020

Around a large table with a map and icons representing ships, submarines, planes, missile batteries, land-based forces, space-based sensors, and other apparatuses of modern warfare, officials from the Pentagon and the Rand Corp. fight a thus far unimaginable conflict.

The Red Team, composed of experts on the Chinese military, aims to use all available forces to capture Taiwan, the island 90 miles off the coast that China regards as a renegade province and that it has repeatedly vowed to retake, by force if necessary.

China’s strategy would be to get an invasion fleet across the Taiwan Strait before the US could come to its tiny ally’s aid. “And once that happens we’d face an Iwo Jima situation,” says a defense analyst, referring to a costly campaign to dislodge occupying Japanese in World War II.China 'is gearing up to invade Taiwan' amid calls in US for American troops  to defend island if it's attacked

The Blue Team, made up US military personnel with operational experience — fighter pilots, cyber warriors, space experts, missile defense specialists – must try to defeat the Chinese invasion.

It doesn’t generally go well for the Blue Team.

“It’s had its ass handed to it for years,” David A. Ochmanek, a former deputy assistant secretary of defense for force development and now a defense analyst at Rand, told RealClearInvestigations. “For years the Blue Team has been in shock because they didn’t realize how badly off they were in a confrontation with China.”

War game simulations are not the real world, of course, where an array of economic, diplomatic and cultural considerations inform a country’s military decisions and actions. And few experts on China seem to think that the country will actually go to war over Taiwan anytime soon.

But as the US seeks a closer alliance with Taiwan – illustrated by the visit of Health and Human Services Secretary Alex Azar there last week, the highest-level official US delegation to the island in 40 years – the possibility of war between the two superpowers may be more than theoretical: A bill now before both houses of Congress, the Taiwan Defense Act, would end the long-held American policy of “strategic ambiguity” – which aims to keep China guessing as to the US response to any attempt to take Taiwan by force – and require the US “to delay, degrade, and ultimately defeat” an attempt by China “to use military force to seize control of Taiwan.”

David Ochmanek, ex-Pentagon official and defense analyst: The American side in Taiwan war-game simulations has “had its ass handed to it for years.”

The proposed legislation reflects strong bipartisan support for Taiwan in Congress. But it’s hard to predict. whether public opinion, already tired of long American wars in Asia, would support the faraway island, where the US maintains has no US military presence now although it maintains forces in the region. Nonetheless, if passed the measure would be far more than a tough talk statement of belief – it would impose serious legal obligations that would demand action. This adds an urgency to the questions officials are now asking: What would happen if China launched an all-out military effort to seize Taiwan? Does the United States possess the wherewithal to meet the obligations of the Taiwan Defense Act?

These questions are hotly debated among military specialists and within the Pentagon, but at a time of national preoccupations over COVID-19 and the looming presidential election, they have received scant notice in the mainstream press. And yet, given the rise of tensions with China, they are perhaps among the most important facing the country.

If China Invades Taiwan, This Is What The Fleet Could Look Like

Taiwan became a separate entity from Mainland China in 1949, when the defeated Nationalist forces retreated to the island, 90 miles off China’s southeast coast, and set up a rival government. Over the years, even as every major country has officially recognized Beijing as the rightful government of all of China, Taiwan has become a full-fledged democracy, with public opinion there overwhelmingly opposed to any formula that would reattach the island to the mainland and its authoritarian ways.

Despite China’s often warlike rhetoric and its continuous efforts to isolate Taiwan diplomatically – not allowing it, for example, to participate in World Health Organization meetings even during the coronavirus pandemic – most analysts think it does not want to use military force against Taiwan.

Taiwanese amphibious troops in exercises this year to show determination to defend Taiwan from Chinese threats.

David Ochmanek, ex-Pentagon official and defense analyst: The American side in Taiwan war-game simulations has “had its ass handed to it for years.”

In the short term China seems to be hoping that the Trump administration’s hard line is more a matter of electoral politics than a permanent American position. US intelligence has also concluded that Beijing hopes Trump loses in November to former Vice President Joe Biden (who faces criticism over his son Hunter’s lucrative deals in China.)

Still, China’s tense relations, not just with the US but many Western nations, are not rooted in electoral politics. There is a more general alarm over aggressive Chinese policies, including the mass detention of Uighurs; its claims in the South China Sea; its crackdown on Hong Kong’s traditional freedoms; its cyberattacks against other governments; and fears that it is using high-tech products it exports to spy on citizens of other countries. China shows no sign of moderating its policies, especially in areas that it regards as its “core interests,” and no core interest is more important to it than establishing its sovereignty over Taiwan.

As China faces more criticism, there’s no question that achieving what Beijing calls the “reunification of the motherland” would be a crowning glory for the Chinese Communist Party and its authoritarian leader, Xi Jinping. Senior Chinese officials continually issue warnings that they are ready to use force if other means of achieving reunification fail, and that is the reason for China’s massive military buildup, which, as the Pentagon’s war games show, has created a new and unprecedented challenges for the United States.

China staging large-scale war games in 2016 featuring mock beach landings, helicopter assaults and tank battles along its east coast facing Taiwan.

As several military analysts put it, the days of unfettered American military superiority in the Western Pacific are over. China has, the analysts say, achieved what’s called anti-access area denial, or A2/AD, which would prevent American forces from being able to penetrate anywhere near Taiwan once a war there started.

Given this capability, China, with its 2-million-strong military, might directly attack Taiwan, with a standing force of 220,000, hoping that the US would stay out of the conflict. But the US would have powerful reasons for not allowing that to happen. Aside from the destruction of a friendly democracy, a Chinese seizure of Taiwan would enormously expand China’s power and position in Asia, especially if combined with its absorption of the entire South China Sea into its maritime territory. This would be a major step forward for China, now clearly a strategic revival and an enemy of democracy, in its goal of replacing the US as the dominant power in all of Asia.

If China felt that the US would intervene, military planners from the Pentagon and Rand who have gamed out scenarios believe a war over Taiwan would most likely begin with a massive attack by advanced Chinese missiles against three American targets: its bases on Okinawa and Guam, its ships in the Western Pacific, including aircraft carrier groups, and its air force squadrons in the region.

Military analysts predict the American side would initially counter with Patriot anti-missile missiles. But the sheer number of Chinese missiles would mean that hundreds of them would reach their targets. American submarines operating near Taiwan would be able to sink some Chinese ships, including amphibious landing craft bringing the Chinese invading force to Taiwan. But the number of submarines near enough to the battle zones at the time of the Chinese strike would, analysts say, be around 20 or 25, each armed with about 12 torpedoes and 10 or so Harpoon missiles, not nearly enough to overcome China’s flood-the-zone strategy. Military analysts seem to agree that in the first day or two, there would likely be thousands of American deaths and the loss of billions of dollars’ worth of materiel.South China Sea: Beijing FEARS Taiwan's “Aircraft Carrier Killer” Could  Destroy Warships World | New | FR24 News English

“We’re playing an away game against China,” Rand’s Ochmanek said. “When bases are subjected to repeated attacks, it makes it exponentially more difficult to project power far away.”

“The casualties that the Chinese could inflict on us could be staggering,” said Timothy Heath, a senior international defense researcher at Rand and formerly a China analyst at the US Pacific Command headquarters in Hawaii. “Anti-ship cruise missiles could knock out US carriers and warships; surface-to-air missiles could destroy our fighters and bombers.”

Lyle Goldstein, US Naval War College: “My appraisal is that Taiwan would fold in a week or two.”

China would have its own challenges. At the same time as it worked to keep the US out of the battle zone it would have to address the trickier and riskier part of the operation: getting an invasion force, consisting of tens of thousands of troops, across the 90 miles separating Taiwan from the Mainland.

“They are giving off a lot of signals about how this campaign would unfold,” Lyle J. Goldstein, a China and Russia specialist at the Naval War College in Rhode Island, told RCI. “They’re talking a lot about airborne assault in two varieties, by parachute and by helicopters. It’s what’s called vertical envelopment. Amphibious assault is old school. It may be necessary but it’s not the main military effort. The new school is to bring lead elements over by air, secure the terrain and then bring in more forces over the beach. The intensity and scale of training in the Chinese military now for airborne assault is, to me, shocking.

“There would be 15, maybe 20 different landings on the island, east, west, north, and south, all at once, some frogmen, some purely airborne troops,” Goldstein continued, saying he was expressing his own views, not official assessments of the US “The Chinese high command would watch these bridgeheads to see which of them is working, while the Taiwan command is looking at this amid decapitation attempts and massive rocket and air assaults. The Chinese would seize several beachheads and airports. Their engineering prowess would come into play in deploying specialized floating dock apparatuses to ensure a steady flow of supplies and reinforcements—a key element. My appraisal is that Taiwan would fold in a week or two.”

In short, China’s strategy would be to get an invasion fleet across the Taiwan Strait before the US could come to its ally’s aid. “And once that happens we’d face an Iwo Jima situation,” Ochmanek said, referring to the small Japanese-held island in the Pacific that the US took in one of the most casualty-heavy battles of World War II. “Once Taiwan was occupied, the option of retaking it with an amphibious assault of our own would be very unattractive.”

Taiwan’s military fired missiles from the air and the island’s shore facing China in a live-fire exercise to demonstrate its ability to defend against any Chinese invasion.

Goldstein has likened an American commitment to defend Taiwan, of the sort that would be required by the proposed Taiwan Defense Act, to be a kind of Cuban Missile Crisis in reverse, a reference to the 1962 confrontation between the US and the Soviet Union, which ended when the Soviets backed away from its effort to put nuclear missiles on the island just 90 miles from Florida.What if China and Taiwan Went To War? - YouTube

The overwhelming American advantage on Cuba then mirrors what Goldstein sees as an overwhelming Chinese advantage on Taiwan today – “vast conventional superiority” in a region of the world far closer to it than to the US, combined with “the wide recognition that the island’s fate is a ‘core interest’ that united Chinese citizens behind the cause.”

China also seems aware of the comparison. A typical statement earlier this month in Global Times, the nationalist mouthpiece of the Chinese Communist Party, put it this way: “The Mainland has many cards, including military cards, and it is very important that our will to play those cards at critical moments will be far better than Washington’s.”

Other experts, however, believe that the situation is not quite as bleak as the war games would indicate, or at least that it can be remedied. They argue: 1) that the American deterrent even now is still strong enough to make China very hesitant to use force on Taiwan, and 2) that the US can and should adapt to China’s capacity with new weapons and new tactics that would enable the country to prevail if it did come to an armed confrontation.

According to most analysts, the key to defending Taiwan would require stopping China’s ability to transport a large occupying force the 90 miles across the Taiwan Strait. Chinese military publications are full of pictures of what such an assault would look like – hundreds of amphibious tanks landing on Taiwan’s beaches, troops arriving on new landing craft called 075 units (now being built), and thousands of troops parachuting into the country at night. They have also been heralding the use of helicopters flying below Taiwan’s radar to land advance troops.

American long-range anti-ship missiles, LRASMs, can be fired from ships as far as 600 miles away. Turning back invading Chinese in this way “comes down to sinking about 300 Chinese ships in about 48 hours,” Ochmanek said.

American long-range anti-ship missiles, LRASMs, can be fired from ships as far as 600 miles away. Turning back invading Chinese in this way “comes down to sinking about 300 Chinese ships in about 48 hours,” Ochmanek said.

Some analysts say that the US could counter that threat by shifting from a reliance on aircraft carriers and long-range bombers to weapons such as stand-off missiles – that is, missiles fired from beyond the range of any Chinese attack, especially a new generation of long-range anti-ship missiles, or LRASMs, that can be fired from ships as far as 600 miles away.

A second component of a Taiwan defense would be space-based reconnaissance using artificial intelligence to locate enemy targets, which the LRASMs would hit; a third would be an American version of flooding the zone, with unmanned undersea drones that could fire torpedoes at Chinese landing craft.

“All of these things are doable,” Ochmanek said. “There’s no magic here, no technological breakthroughs.” He estimates that the Defense Department could make the needed changes if it diverted about 5 percent of its budget— about $35 billion — a year. Taiwan, he said, also needs to move away from the glamorous, showy weapons, like F-16 fighter planes, that it buys from the United States. “The F-16s are not going to get off the ground once the war starts,” Ochmanek said. “They need anti-ship cruise missiles, sea mines, mobile artillery, mobile air defenses, unmanned aerial vehicles.

“It comes down to sinking about 300 Chinese ships in about 48 hours,” he said.

Analysts believe Taiwan could spend more on defense than it does – currently about $13 billion a year, which is a small fraction of the estimated $225 billion to $260 billion that the mainland spends. But, they say, it already possesses sea mines and coastal missile defenses that could take a heavy toll on a Chinese invading force – assuming they aren’t wiped out in an initial Chinese missile attack. It could shoot down helicopters with Stinger missiles, which the US has agreed to sell Taiwan.

Taiwanese forces could shoot down Chinese helicopters with Stinger missiles, which the US has agreed to provide.

“What both sides can do is turn the sea and air space around Taiwan into a no-go zone,” Heath said. “China could do that, but we could make it very hard for any surface ship to survive near Taiwan, including Chinese transport vessels loaded with troops. That alone might stop an invasion.”

And if it doesn’t? China would face the risk of a larger war with the United States, which might involve nuclear weapons and an outcome Beijing could not guarantee. “The biggest threat to China is that a regional anti-China coalition forms,” Heath said. “And so if the United States can succeed in building its alliances in Asia, that would be a powerful deterrent, because China can’t afford to go to war with Asia.”

Others, like Goldstein, fully agree that China would be reluctant to go to war, but they argue also that if war should happen, it’s unrealistic — indeed, Goldstein says it’s dangerously self-deluding – to think that the combined forces of Taiwan and the US would prevail.

“I don’t agree that all we’d have to do is sink 300 ships,” he said. “Chinese war planners would expect to lose a thousand ships. They would put 10,000 boats, ferries, barges and fishing craft into the water, with thousands of decoys, far more than there would be LRASMs or submarines to sink them.”

“The children of Ephraim, being armed and carrying bows, turned back in the day of battle” Psalm 78:9
Gill: but turned back in the day of battle; fled from the enemy, could not stand their ground when the onset was made:
Trapp: Carnal confidence seldom comes home otherwise than weeping.

For the full report, click HERE

~~~~~

See the source image

Read How The US 7th Fleet Could Meet Its Waterloo In The South China Sea HERE

{}{}{}

Sleep Disorders Skyrocketing Among US Military

•April 14, 2021 • Leave a Comment

Sleep Disorders Are Skyrocketing Among US Military Personnel, Study Finds

Excerpts from Military.com

12 Apr 2021
Military.com | By Patricia Kime

A new study has found that serious sleep disorders are on the rise in the US military — conditions that can affect readiness and cause short- and long-term physical and mental health problems for troops and veterans.

Army Reserve wheeled vehicle mechanic sleeps

According to research from the University of Texas Health Science Center at San Antonio, insomnia diagnoses increased 45-fold, and obstructive sleep apnea rose 30-fold, among US service members from 2005 to 2019.

The increases should concern military leaders and doctors as well as the Department of Veterans Affairs, which provides medical treatment for veterans with service-related conditions, said retired Army Col. (Dr.) Vincent Mysliwiec, a sleep expert and one of the study’s authors.

“A large percentage of military veterans have insomnia and sleep apnea. We’re trying to develop a better understanding of the factors that go into sleep disturbances that can develop into sleep disorders in the military,” he said.

Rates for insomnia across the services rose consistently beginning in 2005 and peaking in 2015 before dropping slightly. Sleep apnea diagnoses peaked in 2016, but remained higher than they had been previously, according to the research.

The highest rates for both disorders were found in the Army, with more cases diagnosed than expected; the Air Force, Navy and Marine Corps had lower-than-expected rates. Yet all services saw increases.

Those most likely to be diagnosed with either disorder were married, male, White, age 40 or older, and higher-ranking enlisted soldiers.

“These findings are concerning because service members across the military branches are otherwise healthy and have similar physical requirements. Their sleep disorders developed and were diagnosed while they were in the military,” Mysliwiec said.

Mysliwiec said he’d like to see more focus on healthy sleep habits and scheduling to ensure that service members don’t suffer from disrupted sleep or run the risk of developing a sleep disorder.

“There’s this perception that military personnel, in some way, shape or form, cause their sleep disorders. That’s just wrong,” he said. “‘Oh, they drink lots of caffeine. That causes their sleep disorders.’ Well, they drink lots of caffeine because they have to work 12-, 14-, 16-hour days and need to stay awake. They have to have a coping mechanism.

“How do we prevent people from needing to get these drinks to stay awake and perform their military duties? And if we do make them work 36 hours, do we give them time to sleep and recover after?” he added.

The Lord shall smite thee with madness, and blindness, and astonishment of heart; and thou shalt grope at noonday, as the blind gropeth in darkness,”(Deuteronomy 28:28-29)

A Critique of John Ritenbaugh’s Pentecost 

•April 10, 2021 • Leave a Comment

A Critique of John Ritenbaugh’s Pentecost 

Sermon: Pentecost, Consistency, and Honesty
The Basics of Counting to Pentecost
Given 26-Feb-05; Sermon #707; 77 minutes

John W. Ritenbaugh

Church of the Great God
PO Box 471846
Charlotte, NC 28247-1846

Feast of Harvest (Exodus 23:16), Feast of Weeks (Exodus 34:22), Feast of Firstfruits (Numbers 28:26), Festival of Fifty Days, Heptad, Feast of Heptads, Festival of Seven Heptads, Wave Sheaf, Omer, Shavuot, “the firstfruits of thy labors which thou hast sown in the field (Ex 23:16).”

See the source image
A Sheaf of Grains – is this the Omer offering?

This is a Critique of John Ritenbaugh’s Pentecost (the Feast of Weeks, or the Feast of Firstfruits). The Counting to Pentecost is an extremely important subject and we’ll follow it in every point discussed. Besides the main issue of when to start counting towards Pentecost is the issue of what the firstfruits meant. Does the sheaf represent humans or does it represent Christ?

Quoted are Ritenbaugh’s transcript “Pentecost, Consistency, and Honesty” posted on his website. They are indented, in PINK, and in block form so as to differentiate his from other comments. The Scriptures, in RED, must be our primary focus and guide, and sometimes the Scriptures, which include the Septuagint and the Targum and, often, say things very different from what we believe.

And so with that in mind, we’ll begin:

I am giving this message because there is much confusion within the Church of God regarding the subject of Pentecost. I do not know whether peoples’ salvation hangs in the balance because of disobedience, but at the same time I know that the subject is not unimportant.(The Basics of Counting to Pentecost)

This is very true, the subject is extremely important. In Acts 2, had the disciples waited for the wrong day in Jerusalem when the rushing mighty wind came they would have missed receiving the holy spirits. Today, many churches ignore such significance to their own detriments. So identifying the right day is extremely important.

The year 2005 is a year in which Passover falls on a weekly Sabbath, and this always creates disputing because the Church of God is not unified as to the proper counting method for locating Pentecost. The result of this disagreement is that various groups will observe Pentecost one week apart. (The Basics of Counting to Pentecost)

There is certainly unity in truth, but God’s enemies are usually scattered (Psalm 68:1 “let His enemies be scattered,” so this year 2021, some churches have Pentecost on May 16, others like CGG have it on May 23 despite supposingly all counting from the weekly sabbath) in different opinions.

The proper keeping of the Sabbath is a major sign giving direction. That is what a sign does. A sign gives direction by pointing to certain things. Most important in this case is that it points to the relationship between God and His people. In regard to Pentecost, the weekly Sabbath points to the proper day that the sheaf was to be waved, and thus to Pentecost—another Sabbath to be observed.

Leviticus 23:9-16 is the foundation of this particular doctrine.

Leviticus 23:9-11 And the LORD spake unto Moses, saying, Speak unto the children of Israel, and say unto them, When you be come into the land which I give unto you, and shall reap the harvest thereof, then you shall bring a sheaf of the firstfruits of your harvest unto the priest: And he shall wave the sheaf before the LORD to be accepted for you: on the day after the Sabbath the priest shall wave it. (The Basics of Counting to Pentecost)

The Septuagint, one that the NT writers most often used, translates “the day after the sabbath” as “on the morrow of the first day.” Obviously this “first day” is not the first day of the week, but the first Days of Unleavened Bread, which is the 15th. It is a high day, one of the annual Sabbaths. The day after the first Days of Unleavened Bread is obviously the 16th of Nisan. 

Exodus 31:13 “Speak thou also unto the children of Israel, saying, ‘Verily My Sabbaths ye shall keep; for it is a sign between Me and you throughout your generations, that ye may know that I am the Lord who doth sanctify you.

The Hebrew translators of the Septuagint living around 300 BC knew that the omer counting began after the first Day of Unleavened Bread on the 16th of Nisan. Most New Testament writers had relied heavily on the Septuagint when quoting the Old Testament, and is a great testimony to clarify “the morrow after the sabbath” to mean the first Days of Unleavened Bread. Hence the Sabbath referred to in Leviticus 23:11 is always the 16th of Nisan.

Leviticus 23:11 and he shall lift up the sheaf before the Lord, to be accepted for you. On the morrow of the first day the priest shall lift it up. (Septuagint, translated by Brenton)

The Septuagint is backed up by the Targum, whose existence was attributable to its founder, Ezra (480–440 BC), a high priest. Ezra led a large body of exiles back to Jerusalem, where he discovered that when he read the Torah in Hebrew, the exiles couldn’t understand him. The Targum was in oral form initially but later on it was written down in Aramaic. 

Ezra 7:10 For Ezra had prepared his heart to seek the law of the Lord and to do it, and to teach in Israel statutes and judgments.

In another way of saying: When the Exiles returned to Jerusalem, the Law was read by Ezra, verse by verse, and each verse was followed by a recitation by the Levites from the Hebrew to the Aramaic version. 

“The Levites … instructed the people in the Law while the people were standing there. They read from the Book of the Law of God, making it clear and giving the meaning so that the people understood what was being read.” (Nehemiah 8:7–8)

Nehemiah 8:7 NKJV and the Levites helped the people to understand the Law; and the people stood in their place. 8 So they read distinctly from the book, in the Law of God; and they gave the sense, and helped them to understand the reading.

John Gill comments on the above “they first read it in Hebrew, and then translated it into Chaldee, that the people might better understand it, being just come out of Babylon . . . not hereby how to read it, but chiefly to understand what was read, that they might clearly know their duty to God and men.” The action of Ezra narrated in Nehemiah 8:8 implied not only the reading of the Law, but also the interpretation of its language — its translation in fact from Hebrew to Aramaic, and that, further, this practice was long followed in all the synagogues among the returning Exiles in Judea. 

As a result, the Targum portion in Leviticus 23:9-16 is even clearer:

And the Lord spake with Mosheh, saying: 10 Speak with the sons of Israel, and say to them: When you have entered into the land which I give you, and you reap the harvest, you shall bring the sheaf of the first fruits of your harvest unto the priest; 11-13 And he shall uplift the sheaf before the Lord to be accepted for you. After the first festal day of Pascha (or, the day after the feast‑day of Pascha) on the day on which you elevate the sheaf, you shall make (the sacrifice of) a lamb of the year, unblemished a burnt offering unto the Name of the Lord . . . (The Targum, translated by J.W. Etheridge)

Ezra was a man of God, and “the good hand of God is upon him” (Ezra 7:9). For Ezra had prepared his heart to seek the law of the LORD, and to do it, and to teach in Israel statutes and judgments. Why would any modern mere man doubt him? It is rather contemptuous to do so!

37 Nehemiah ideas | nehemiah, bible, old testament

The Encyclopaedia Britannica says: 

The status and influence of the Targums became assured after the Second Temple was destroyed in AD 70, when synagogues replaced the Temple as houses of worship. For it was in the synagogue that the practice of reading from the Old Testament became widely observed, along with the custom of providing these readings with a translation into Aramaic. When Scripture was read aloud in the synagogue, it was translated aloud by a meturgeman, or professional interpreter (hence the name Targum), for the benefit of the congregation. The translator tried to reproduce the original text as closely as possible, but since his object was to give an intelligible rendering of the biblical text, the Targums eventually took on the character of paraphrase and commentary, leaving literal translation behind. To prevent misconceptions, a meturgeman expanded and explained what was obscure, adjusted the incidents of the past to the ideas of later times, emphasized the moral lessons to be learned from the biblical narratives, and adapted the rules and regulations of the Scriptures to the conditions and requirements of the current age. The method by which the text was thus utilized as a vehicle for conveying homiletic discourses, traditional sayings, legends, and allegories is abundantly illustrated by the later Targums, as opposed to the more literal translations of the earlier Targums.

After the Babylonian exile, most Jews spoke Aramaic as their first language, so translation became necessary to understand the Biblical readings. Many of the Targum contained interpretations or explanatory notes in addition to the literal translation. Though the written Targums gradually came into being, it was the living tradition of the Oral translation and exposition that were recognized as authoritative throughout the Second Temple period and the early centuries of the Christian Era.

This waving, according to historical records, could be either of an actual cutting of grain (the sheaf), or the grain could be cut, with all of the berries shaken off it, and then an omer (a couple of quarts) was put in a bottle, and it was raised before God. That is all that was done. It was lifted up there as if it were being raised up for Him to see. (The Basics of Counting to Pentecost)

THE OMER BARLEY OFFERING Leviticus... - The Temple Institute | Facebook
Only one-tenth has Oil and Frankincense added

The waving of the wave sheaf gives a false implication. It’s the omer that is waved. First, let’s understand the process from the wave sheaf to the omer, from the grains to a more finished product. 

First, let’s understand what the “wave sheaf” is. The wave sheaf as firstfruits must be reaped by three men, each with his own sickle and basket and each had his basket full. They then brought them to the courtyard of the Temple to be thrashed and parched (on a pan perforated with holes, so that each grain might be touched by the fire and exposed to the wind) and then to go through all thirteen sieves until they became clean, and only one tenth of the measure selected.

Oil and frankincense were added. Now known as the omer, it was offered early the next morning at about 9 AM, the time of the morning sacrifice in the Temple as a special offering waved before God.

The Wave Sheaf Offering, composed of MANY individual grains, representing the FIRSTFRUITS, but it’s only when only one-tenth taken, oil and frankincense added and processed into a final cake, is it the omer offering! But the “he lamb” in Leviticus 23:12, which the Blinds couldn’t see, representing Christ, wasn’t waved:

Leviticus 23:9 And the Lord spoke unto Moses, saying,

10 “Speak unto the children of Israel and say unto them: ‘When ye come into the land which I give unto you and shall reap the harvest thereof, then ye shall bring a sheaf of the firstfruits of your harvest unto the priest.11 And he shall wave the sheaf before the Lord to be accepted for you; on the morrow after the Sabbath the priest shall wave it.

12 And ye shall offer that day when ye wave the sheaf a he lamb without blemish of the first year for a burnt offering unto the Lord.

This Lamb wasn’t waved! Weird! Why wasn’t this Lamb waved if it were to represent Christ? These end-time CoG Communities have produced many insightful interpretations of the Scriptures, but have also had its share of nonsensical interpretations which have caused great delusions. Most of these Blind Guides didn’t even notice the Lamb there! It is nice to believe that Christ was waved before the Throne of God, but where are the evidence? Not a single one is given. 

Those who count Pentecost (meaning the churches of God, the Jews, and any Protestant group that still observes Whitsunday) are in unanimous agreement that it is a Sabbath during the Days of Unleavened Bread. This therefore narrows the choices to no more than 3 (three) Sabbaths: the first day of Unleavened Bread on the 15th, the last day of Unleavened Bread on the 21st, and the weekly Sabbath that always falls between those two holy days.

Remember that the count to Pentecost always begins the day after the weekly Sabbath that falls within the days of Unleavened Bread. The day that follows the weekly Sabbath within the days of Unleavened Bread will always be Wavesheaf day—the day the sheaf was waved. That is the rule arrived at from the information contained within Leviticus 23, and especially verses 15 and 16. (The Basics of Counting to Pentecost)

Whitsunday, a pagan holiday that takes place 7 weeks after Easter Sunday, is a fallout from the Samaritans who were and are actually Sun-worshippers. The Sadducees followed suit, contended that the seven weeks from the first barley-sheaf-offering (“‘omer”) to Pentecost should, according to Lev 23:15-16, be counted from “the day after Sabbath,” and, consequently, that Pentecost should always be celebrated on the first day of the week (Meg. Ta’an. i.; Men. 65a). Then at the tail end, Sunday has been used as the focal point by the CoG Communities to determine when to start and when to end the count toward Pentecost.

Again, the above testimony runs contrary to the Targum in Leviticus 23:11-13 And he shall uplift the sheaf before the Lord to be accepted for you. AFTER THE FIRST FESTAL DAY OF PASCHA (OR, THE DAY AFTER THE FEAST‑DAY OF PASCHA) on the day on which you elevate the sheaf, you shall make (the sacrifice of a lamb of the year, unblemished a burnt offering unto the Name of the Lord . . . 15 and number to you AFTER THE FIRST FEAST DAY OF PASCHA . .  . (The Targum)

The word “Pentecost” does not appear in the Old Testament because it is a Greek word. Pentecost means “fiftieth”—the 50th day—the one on which the count ends. In the Old Testament it is called the Feast of Weeks, or the Feast of Firstfruits.

Here is another interesting fact that needs to be considered. This is part of the general understanding of this. If one begins counting after the first day of Unleavened Bread, which will always be the 15th, then you would begin counting with the 16th. You would have a Sabbath there, and the next day would be the 16th. But if you do that, then Pentecost will always end up on Sivan 6. Once you do that you have effectively removed the reason for counting, because, just like all the other holy days, it will be on a fixed date every year. This is the way that the Pharisees during Jesus’ day counted and the way that modern Jews count. But as I said, following that practice effectively eliminates God’s command that one count. (The Basics of Counting to Pentecost)

Why do we count? We learn several lessons by counting. The foremost is that the count demonstrates our thrill for the impending occasion of receiving our spiritual blessings, celebrated on Shavuot. When the Israelites were in Egypt some 3400 years ago, they had assimilated many of the pagan ways of the Egyptians. 

A countdown is when we all have obstacles removed between our uncleanliness and our spiritual goal. When the days pass, our spiritual goal is becoming more achievable. Every year we are not counting down the days that pass. Rather, we are counting toward the end, climbing one step higher in our spiritual growth each day.

There are other Jewish groups that do not count the way the Pharisees did. There were the Essenes, who no longer exist, but we know the way that they counted. There were the Falashas. I do not know whether any of them still exist. They were Ethiopian Jews. Then there were the Karaites, who were never really an organized group. They were more or less independent. Those three groups all counted using the last day of Unleavened Bread. But if one does that, you always end up on Sivan 12, and that too effectively removes the reason for counting. (The Basics of Counting to Pentecost)

False; this isn’t true. Very sloppy research everywhere! Nehemia Gordon is a prominent Karaite. He wrote that both the Essenes and Sadducees always begin their count “on the morrow of a weekly Sabbath.”

35 Nehemia Gordon & Keith Johnson videos:Collaborations on Jewish aspects  of the Bible | bible, scripture study, gordon
Nehemia Gordon, a prominent Karaite

Writes Nehemia Gordon on his “The Truth About Shavuot” website (May 22, 2020):

“The Sadducees and Essenes agreed that the 50-day count to Shavuot had to always begin on the morrow of a weekly Sabbath. They only differed as to whether this referred to the Sunday during the Feast of Unleavened Bread or the Sunday following the Feast of Unleavened Bread.”

The Essene/Qumran has their own 364 day solar calendar totally at odds with the calendrics of the Sanhedrin. Their sacred year always began on the vernal (spring) equinox and is, by definition, Wednesday (because God Created the “lights in the firmament” for “signs and seasons” on the 4th Day), 1st day of the 1st month (Nisan or Abib). 

Consequently, the Essene Passover will always begin at 6 PM Tuesday, 13 days later (Nisan 14). The key point being Essene Passover always began “Tuesday” evening, 13 days after the vernal equinox. To outsiders, the Essenes would appear to observe the vernal equinox and (regardless of whatever the previous day was) declare that day to be Wednesday 1 Nisan of their calendar. 

The Essene’s calendar had a year of 364 days. The first day of the first month always begins at sunset on Tuesday evening following the vernal equinox. Their counting — counted from the first Sunday after the Feast of Unleavened Bread — the offering of the wave sheaf (Leviticus 23:11) always fell on Sunday the 26th of their first month. Consequently after 50 days set the day of Pentecost on Sivan 15 of their calendar. Also Pentecost on the 15th, is always a Sunday in their third month on their calendar. 

Although the Karaites observe the new moon separately to establish their calendar in Jerusalem they were pretty united under Nehemia Gordon until he gave up in 2016. Other than establishing their calendar by observation, they start their count from the weekly Sabbath, like the Sadducees and Samaritans. Says Nehemia Gordon, “Karaite Jews have accepted the Sadducee reckoning as the only one to be consistent with the plain meaning of the biblical text.”

The day Passover falls on determines the date one must begin to count from. Therefore the count must begin on the day following the weekly Sabbath which, like Passover, is constantly changing. That is the day in which the sheaf is waved and the count begins. Since the weekly Sabbath always falls on a Saturday, the count to Pentecost always begins with a Sunday.

It may interest you to know that this is the way the Sadducees in Jesus’ day counted. In Jesus’ day the Sadducees still retained control of the Temple, and they determined when Pentecost was to be kept. That is one of the reasons why you will find no disagreement between Jesus and the Sadducees regarding the celebration of Pentecost. They were in agreement. (The Basics of Counting to Pentecost)

The above is again false — all lies and bulls, all pure Speculations and Magics. First, Josephus states that “whatever they [the Jewish people] do about divine worship, prayers, and sacrifices, they perform them according to their [the Pharisees’] direction. Insomuch, that the cities give great attestations to them, on account of their entire virtuous conduct, both in the actions of their lives, and their discourses also,” (Antiquities 18:1.15); and that the Sadducees “addict themselves to the notions of the Pharisees: because the multitude would not otherwise bear them.” (Antiquities 18:1.17; translated by W. Whiston).

And second, the Samaritans are SUN worshippers — they turn their faces toward Mount Gerizim whenever they pray, but during Passover on top of Mount Garizim, where at twilight, they turn West to pray at the setting down of the SUN. They infiltrated the Sadducees during the early era of the Second Temple period, and like the CoG Communities today, they would lie through their teeth that their beliefs don’t have anything to do with Samaritan SUN worship. 

See the source image
The Samaritans (and their various spinoffs) are SUN worshippers

The significance of the firestorm to Jerusalem 70 AD and should not be understated. Because of sin, the God of Heaven destroyed Sodom and Gomorrah during Abraham’s time. John the Baptist had given a stern warning about another consuming fire recorded in Luke 3:16-17 John said unto those who heard him:

“I indeed baptize you with water; but One mightier than I cometh, the straps of whose shoes I am not worthy to unloose. He shall baptize you with the Holy Ghost and with FIRE. 17 His winnowing fan is in His hand, and He will thoroughly purge His floor and will gather the wheat into His garner; but the chaff He will burn with FIRE unquenchable.” Luke 3:16-17

The Blind couldn’t see the FIRE part. When we look back, one cannot avoid concluding that God deemed that the Sadducees and the Essenes were worthy of extinction during the 70 AD inferno like Sodom and Gomorrah. Everything about the Sadducees and the Essenes were destroyed (except perhaps the scrappy Dead Seas Scrolls). A large portion of the Shammai Pharisees also followed suit in the conflagration, but the Hillel branch limped off to Yavne and survived. If the 70 AD inferno were only a microcosm, how would the CoG Communities, who have similar beliefs as the Sadducees, escape John’s warning during the Last Days? And why is it so coincidental that the end-time Laodicean church was described as “wretched” and “blind” and “naked”?

I said I was going to give you absolute proof that the sheaf is to be waved on the day after the weekly Sabbath that falls within the days of Unleavened Bread. Believe it or not, it is in the New Testament. Let us go to John 20. (The Basics of Counting to Pentecost)

Only one-tenth of an ephah finally accepted

Although the New Testament could add further meaning, the people during Old Testament times should be able to understand how to count during their days, rather than waiting one and a half thousand years later. During Ezra’s time, the returning Jewish Exiles understood this ambiguity when their Aramaic interpretation confirms the Septuagint translation “on the morrow of the first day,” as the day “after the first day of Pascha.” So is Ritenbaugh admitting he couldn’t prove it from the Old Testament?

In the New Testament

The New Testament is built on the foundation of the Old Testament, and not the other way round. Whenever the concept of firstfruits (G536 aparchē) is used in the New Testament context it could mean principally as (1 and 2) produce of the land and (3) firstborn, or person of superior excellence.

Should Moses have any question or doubt he had full access to God who sits between the Cherubim in the inner Sanctuary to make an inquiry. Also the High Priests, should they have any doubt, they could inquire from the Urim and Thummim (Exodus 28:30, Numbers 27:21) if they want to seek clarification of anything? 

In ancient Israel the Urim and Thummim were entrusted by the LORD, first to Moses and through him to the high priest as the representative of the LORD and as the mediator between God and the nation whose decisions, through the Urim and Thummim, even kings were expected to obey.

Josephus maintained that the Urim and Thummim continued to be used until the Maccabees, if not then, perhaps during Ezra’s time (Ezra 2:63, Nehemiah 7:65). All those decisions made knowledge gained would form the foundation and collection of what eventually emerged as the Oral Law.

So exactly seventy-two (72) hours after He was put into the grave, He rose from the dead and came out of the grave. Seventy-two hours from the time He was put into the tomb on Wednesday as the sun was setting, the sun was setting on the weekly Sabbath—Saturday—when He walked out of that tomb. This brings us to Matthew 20:1 in the time element. On Sunday morning, Mary Magdalene showed up at the tomb. She found it empty. Christ had already been resurrected, probably somewhere close to ten hours by that time. We will pick up the story in verse 11.

Matthew 20:11-17 But Mary stood without at the sepulchre weeping: and as she wept, she stooped down and looked into the sepulchre. And seeing two angels in white sitting, the one at the head, and the other at the feet where the body of Jesus had lain. And they said unto her, Woman, why weepest thou? She said unto them, Because they have taken away my LORD, and I know not where they have laid him. [She thought He was still dead.] And when she had thus said, she turned herself back and saw Jesus standing, and knew not that it was Jesus. Jesus said unto her, Woman, why weepest thou? Whom seekest thou? She, supposing him to be the gardener said unto him, Sir, if you have borne him hence, tell me where you have laid him, and I will take him away. Jesus said unto her, Mary. [And she melted, because she recognized the voice.] She turned herself, and said unto him, Rabboni; which is to say, Master. Jesus said unto her, Touch me not; [It actually says, “Do not cling to Me.” She had already grabbed Him.] for I am not yet ascended to my Father: but go to my brethren, and say unto them, I ascend unto my Father, and your Father; and to my God, and your God.

Remember, the sheaf was raised up before God. Jesus is the Firstfruit of God’s spiritual harvest. You can see this in I Corinthians 15:20 where Paul calls Him that.

I Corinthians 15:20 But now is Christ risen from the dead, and become the firstfruits of them that slept.

And so Jesus, as the first of the Firstfruits, was the reality of the Wavesheaf. Everything else was a type and a symbol. The reality had to ascend to the Father, and He did. He just ascended to the Father and was accepted on our behalf by the Father. When did this occur? The reality occurred on Sunday morning—the day after the weekly Sabbath. That nails it down. (The Basics of Counting to Pentecost)

In Leviticus 23:12: And if the he lamb represents Christ, which He is, then the sheaf of firstfruits couldn’t be Christ. Hence the logical conclusion drawn from the Old Testament is that the sheaf as firstfruits should represent human beings. And in parables, Christ was the husbandman, the sower, a landowner, the true vine, the good shepherd, etc, but never was He portrayed as a firstfruits in the sense of a produce of the land. It is a heresy to infer that Christ was part of a harvest.

The Omer Offering | Holy temple, Third temple, Priest
The Grains sifted through thirteen Sieves, and only one-tenth Accepted

We can conclude from these observations is that Christ after He had fulfilled being a sacrifice for us as the Lamb at Passover, presents Himself as the High Priest, interceding for His younger brothers to the Father. But He was never the sheaf of firstfruits in the OT context. He was the Lamb and the Lamb wasn’t waved, only the sheaf of many grains did, known as the omer, was waved.

Second, the “wave sheaf” is also a mistranslation. It is “omer” in Hebrew, a finished product, not some freshly cut grains from the field. 

And this is from the Jewish Encyclopedia:

Manner of Waving the Omer.

After the grain had been gathered it was brought to the courtyard of the Temple, where it was first thrashed and then parched (dried and roasted over a fire). The grain was ground into coarse meal and then sifted through thirteen sieves until it became very clean, after which the tenth part was taken, the measure of the ‘omer, and given to the priest. The priest proceeded with the ‘omer as with any other meal-offering: he poured oil and frankincense over the meal, “waved” it, and then burned a handful of it on the altar; the remainder was eaten by the priests (Men. vi. 4). The “waving” was done in the following way: The offering was placed on the extended hands of the priest, who moved them backward and forward and then upward and downward. As soon as the ‘omer ceremony was completed the people of Jerusalem were permitted to eat of the newly harvested grain; people of towns far from Jerusalem might not do so until after noon, when it was certain that the ceremony at Jerusalem had been gathered (Men. vi. 7).

The other nine-tenth rejected!

The omer is an end-product made from the sheaf, a bundle of grains, MANY STOCK OF GRAINS. The grains (or the stock of barley) are all the same, it would be derogatory to infer that Christ is on the same level as other humans. Christ was and is always referred to as the Lamb. Even before Christ was born, He was already the Son of God, divine (Psalm 2:7 I will declare the decree: the Lord (Father) hath said unto me, Thou art my Son; this day have I begotten thee). Before each one of us humans were born we were dust. It is a heresy to think we are of the same level of the Son of God. Christ was YHVH (Psalm 110:1,5) before He was born.

In a brief summary, from the Old Testament: (1) Christ isn’t the firstfruits of Leviticus 23:10, only humans are; (2) The Lamb symbolizes Christ but He wasn’t waved, only the firstfruits were waved.

In Hebrew, the wave sheaf is h6016 `omer (Leviticus 23:10); and firstfruits are h7225 re’shiyth (Leviticus 23:17,20).

Exodus 23:19 The first H7225 of the firstfruits H1061 of thy land thou shalt bring into the house of the LORD thy God. — the firstfruits from, perhaps, the Old Testament times (Leviticus 23:10) to New Testament times, at Pentecost (Leviticus 23:17, 20; Acts 2).  Note, both were produce of the land. But Christ was the Lamb.

The New Testament is built on the foundation of the Old Testament. Whenever the concept of firstfruits (G536 aparchē) is used 8 times in the New Testament context it could mean principally as Strong indicates:

(1) & (2) firstfruits as produce of the land Rom 8:23; Rom 11:16; Rom 16:5; 1Co 16:15; Jas 1:18; Rev 14:4.

(3) firstborn, or person of superior excellence.

1 Corinthians 15:20 But now Christ is risen from the dead, and become the firstfruits G536 of those who slept. — only category (3) applies above.

1 Corinthians 15:23 but every man in his own order: Christ the firstfruits G536; afterward those who are Christ’s at His coming. — again, only category (3) applies above.

As Christ is the firstborn as in Acts 26:23 “the first G4413 protos who should rise from the dead,” and a person of superior excellence, the King James version and many related translations as “firstfruits” above are misleading: 

However other translations listed below give a more accurate concept of Christ being the first person to rise from the dead or the firstborn, the first to be born from the womb. 

1 Corinthians 15:20 

But now Christ has come back from the dead. He is the very first person of those who have died to come back to life. GOD’S WORD Translation (GW)

But the glorious fact is that Christ did rise from the dead: he has become the very first to rise of all who sleep the sleep of death. PHILLIPS

But the fact is that Christ did actually rise from the dead and has become the first of millions who will come back to life again someday. Living Bible (TLB)

But now Christ has come back from the dead. He is the very first person of those who have died to come back to life. Names of God Bible (NOG) 

But Christ has truly been raised from the dead—the first one and proof that those who sleep in death will also be raised. New Century Version (NCV)

But Christ really has been raised from the dead. He is the first of all those who will rise from the dead. New International Reader’s Version (NIRV)

But it is true! Christ has been raised from the dead! He was the first One to be raised from the dead and all those who are in graves will follow. New Life Version (NLV) 

1 Corinthians 15:23 

This will happen to each person in his own turn. Christ is the first, then at his coming, those who belong to him will be made alive. GOD’S WORD Translation (GW)

But the glorious fact is that Christ did rise from the dead: he has become the very first to rise of all who sleep the sleep of death. PHILLIPS

Each, however, in his own turn: Christ rose first; then when Christ comes back, all his people will become alive again. Living Bible (TLB)

This will happen to each person in his own turn. Christ is the first, then at his coming, those who belong to him will be made alive. Names of God Bible (NOG) 

But everyone will be raised to life in the right order. Christ was first to be raised. When Christ comes again, those who belong to him will be raised to life. New Century Version (NCV)

But here is the order of events. Christ is the first of those who rise from the dead. When he comes back, those who belong to him will be raised. New International Reader’s Version (NIRV)

This is the way it is: Christ was raised from the dead first. Then all those who belong to Christ will be raised from the dead when He comes again. New Life Version (NLV) 

But each one has his turn. Christ rose first. Then those who belong to Christ will rise when he comes again. Worldwide English (WE)

But Christ really has been raised from death. He was the first one to rise of all who have died.  Worldwide English (WE)

The evidence from the above is clear. If not, the three main questions to ponder are: 

See the source image

(1) If the wave sheaf in Leviticus 23:11 represents Christ, then what did this “he lamb” without blemish of the first year in verse 12 represents?

(2) And if this he lamb in verse 12 represents Christ, then why this “he lamb” wasn’t waved?

. . . and (3) if waving means going up to heaven and back, then why the 3000 on Pentecost (Acts 2) didn’t similarly go up to heaven as they were also waved (Lev 23:20), each should be warning the others “don’t touch me” along the way up and back from heaven on that day of Pentecost, wouldn’t they?

There is a saying which goes, “one swallow doesn’t make a summer.”

~~~~~

A Critique of Frank Nelte’s Pentecost 

•April 7, 2021 • Leave a Comment

A Critique of Frank Nelte’s Pentecost 

Frank W. Nelte, Ex-WCG Minister

— attended the Bricket Wood campus of the memorable Ambassador College in the 1960s and upon graduation in 1971 was hired by the Worldwide Church of God to pastor several congregations in South Africa until early 1994 when he was sacked.

When Should We Keep Pentecost? — (January 1998)

How to Count Pentecost

Wave Sheaf, Wave Sheaf Offering, Pentecost, Feast of Weeks, Feast of Firstfruits, Heptad, Feast of Heptads, Wave Sheaf, Omer

This is a Critique of Frank Nelte’s Pentecost, the Feast of Weeks, or the Feast of Firstfruits. The Counting to Pentecost is an extremely important subject and we’ll follow it in every point discussed. Besides the main issue of when to start counting is how restrictive is the term “Sabbath.” Is it restricted only to a weekly Sabbath or was it meant to be an annual Sabbath, the first day of Unleavened Bread, the 16th of Nisan.

Quoted are Frank Nelte Bible Study article “When Should We Keep Pentecost?” posted on his website, dated January 1998. They are in pink, indented and in block form so as to differentiate his from other comments. The Scriptures, in red, must be our primary focus and guide, and sometimes the Scriptures, which include the Septuagint and the Targum, say things very different from what he assumes! 

And so with that in mind, we’ll begin:

We need to recognize that the Jews have developed MANY customs which have no biblical basis at all.

Most people do not understand that Hebrew as a spoken language had basically DIED OUT long before the year 1800 A.D.! Two thousand years ago the Jews had already abandoned speaking Hebrew in favour of speaking Aramaic. Even Jesus Christ conducted His whole ministry in the Aramaic language. Christ’s final words, as He was dying on the stake, were in Aramaic. They were “Eli, Eli, lama sabachthani” (Matthew 27:46), or as recorded by Mark “Eloi, Eloi, lama sabachthani” (Mark 15:34). (When Should We Keep Pentecost?)

Obviously the above are false on many fronts. The writer shows his hatred for the Jews more than a cool headed willingness to find the truth. The Hebrew Gospel of Matthew by George Howard testifies that the original was written in Hebrew.

Another book “Understanding the Difficult Words of Jesus” by David Bivin and Roy Blizzard, has been devoted to understanding the structure of poetry, and literal translations of Hebrew idioms which involve the case for claiming that Jesus spoke and taught in Hebrew instead of Greek or Aramaic and that the synoptic gospels (Matthew, Mark and Luke) were originally written in Hebrew, and when translated caused formidable problems for translators, resulting in the text that makes little sense to English (or even Greek) readers. 

Second, many of Christ’s sayings that have in the past been difficult to understand were presented and analyzed in the light of their Hebrew origins. The authors explain that lack of knowledge of Hebrew literary forms, especially the structure of poetry, and literal translations of Hebrew idioms caused formidable problems for translators, resulting in text that makes little sense to English (or even in Greek) readers. So, according to the authors, Hebrew, is the language that needs to be understood to correctly interpret the teachings of Christ in the synoptic gospels. This approach would yield a clearer understanding of the sayings of Christ that are puzzling or confusing, thus making the gospels much more readable. 

Third, had Hebrew been forgotten and DIED OUT two thousand years ago, how could the Aleppo Codex being developed, which were formulated around the ninth or tenth century? If they have forgotten how to read Hebrew, how could they remember suddenly to incorporate the vowels and turn it into the Masoretic Text? So much lying, deceits and bullshit! 

Now if we want to be clear about the meanings GOD attached to specific Hebrew words, then the best way to establish this is to look at ALL the places where God has inspired those specific words to be used. When any word is used a large number of times, then in most occurrences the intended meaning will be quite plain and easy to discern from the context.

When a Hebrew Dictionary CLAIMS that a certain word had a secondary meaning in biblical times, which meaning is NOT supported by actual usage ANYWHERE in the whole Old Testament, then this claim must be questioned. Is the claim perhaps based on a preconceived false interpretation of some biblical teaching? Is the claim perhaps made in order to support a non-biblical “tradition of the elders”? WHY is this claim made when there is no biblical usage anywhere in the entire Old Testament to support this claim?

THE HEBREW WORD “SHABUWA”:

Of the 20 times this word is used in the Old Testament, in the KJV it is 19 times translated as “week/s” and one time as “SEVEN”. That one place is Ezekiel 45:21.

In the first [month], in the fourteenth day of the month, ye shall have the passover, a feast of SEVEN DAYS; unleavened bread shall be eaten. (Ezekiel 45:21)

An examination of the 9 occurrences in the above-quoted 8 verses should make it quite clear that THIS is indeed the Hebrew word for “week” and “weeks”. This word really has no other meanings! It is NEVER used in any way to IMPLY any other meaning! Moses, who wrote the first five books of the Old Testament, was obviously familiar with this word. (When Should We Keep Pentecost?)

This is very true, and you don’t wait for a few days till the weekly Sabbath to start along with Shabuwa (H7620). The important point is that it starts IMMEDIATELY.

The critical verse is in Deuteronomy 16:9 “Seven weeks H7620 shalt thou number unto thee: begin to number the seven weeks H7620 from such time as thou beginnest to put the sickle to the corn. 

Deuteronomy 16:9 Seven weeks [H7620 shabua] — Strong translates shabua as seven, period of seven (days or years), heptad, week:

A. period of seven days, a week — Feast of Weeks or Heptads
B. heptad, seven (of years)

In the Scriptures there are a total of nine times (out of 20) where Shabua H7620 is used to designate Pentecost. Here they are:

(1) Exodus 34:22 And thou shalt observe the Feast of Weeks, H7620 of the firstfruits of wheat harvest, and the feast of ingathering at the year’s end. Feast of Weeks (each a block of seven)

(2) Numbers 28:26 “‘Also on the day of the firstfruits, when ye bring a new meat offering unto the Lord, after your weeks H7620 be out, ye shall have a holy convocation. Ye shall do no servile work. after seven blocks of sevens

(3,4,5) Deuteronomy 16:9-10 “Seven weeks H7620 shalt thou number unto thee: begin to number the seven weeks H7620 from such time as thou beginnest to put the sickle to the corn. 10 And thou shalt keep the Feast of Weeks H7620 unto the Lord thy God with a tribute of a freewill offering of thine hand, which thou shalt give unto the Lord thy God according as the Lord thy God hath blessed thee. seven blocks; Feast of Weeks (each a block of seven)

(6) Deuteronomy 16:16 Three times a year shall all thy males appear before the Lord thy God in the place which He shall choose: in the Feast of Unleavened Bread, and in the Feast of Weeks, H7620 and in the Feast of Tabernacles. And they shall not appear before the Lord empty.Feast of Weeks (each a block of seven) 

(7) II Chronicles 8:13 according to a certain rate every day, offering according to the commandment of Moses on the Sabbaths and on the new moons and on the solemn feasts, three times in the year: on the Feast of Unleavened Bread and on the Feast of Weeks H7620 and on the Feast of Tabernacles. Feast of Weeks (each a block of seven) 

(8) Jeremiah 5:24 Neither say they in their heart, Let us now fear the LORD our God, that giveth rain, both the former and the latter, in his season: he reserved unto us the appointed weeks H7620 of the harvest. Feast of Weeks (each a block of seven) 

(9) Ezekiel 45:21 In the first month, in the fourteenth day of the month, ye shall have the passover, a feast of seven H7620 days; unleavened bread shall be eaten. the days of unleavened bread didn’t wait until the following weekly sabbath to start counting the seven days

All the above show that the Feast of Weeks could also be called the Feast of Heptads. However, the important point is that it starts IMMEDIATELY, not waiting even a day. This is shown best below:

Ezekiel 45:21 In the first month, in the fourteenth day of the month, ye shall have the passover, a Feast (a block of seven) H7620 days; unleavened bread shall be eaten. — seven days, the most obvious example where it occurs IMMEDIATELY and is not connected to the weekly sabbath.

And here we have a non-Feast of Weeks example:

Leviticus 12:5 But if she bears a daughter, then she shall be unclean two weeks H7620  as in her separation: and she shall continue in the blood of her purifying threescore and six days. — two weeks, this occurs IMMEDIATELY after birth and not waiting until the weekly sabbath to start counting the two weeks of uncleanliness.

The Feast of Unleavened Bread follows Passover immediately without waiting for even a day. 

THE HEBREW WORD “SHABBATH”

This word “shabbath” is used 108 times in the Old Testament. It is thus quite common. Another word, which has been formed from this word “shabbath”, is the word “shabbathown”, which is used 11 times in 10 different verses, all 11 occurrences being in the books of Exodus and Leviticus. This word “shabbathown” is translated (in the KJV) 8 times as “REST” and 3 times as “SABBATH”. It is an intensive form of the word for “rest” and that is precisely what it means … EMPHATIC REST!

And ye shall count unto you from the morrow AFTER THE SABBATH, from the day that ye brought the sheaf of the wave offering; SEVEN SABBATHS shall be complete: (Leviticus 23:15)

Even unto the morrow AFTER THE SEVENTH SABBATH shall ye number fifty days; and ye shall offer a new meat offering unto the LORD. (Leviticus 23:16) (When Should We Keep Pentecost?)

Strong designates the 108 times using sabbath H7676 to include (a) sabbath, (b) day of atonement, (c) sabbath year, (d) week, (e) produce (in sabbath year). Note that the use of “week” is being included as one of Biblical usage.

The ambiguity of the phrase “from the morrow after the Sabbath” has offered much confusion over the millennium. Unfortunately, the Masoretic Text doesn’t provide an answer. But fortunately the Septuagint, one that the NT writers used most often, helps in presenting the truth. It translates “on the morrow after the Sabbath” as “on the morrow of the first day.” 

Leviticus 23:9 And the Lord spoke to Moses, saying, 10 Speak to the children of Israel, and thou shalt say to them, When ye shall enter into the land which I give you, and reap the harvest of it, then shall ye bring a sheaf, the first-fruits of your harvest, to the priest; 11 and he shall lift up the sheaf before the Lord, to be accepted for you. On the morrow of the first day the priest shall lift it up. (Septuagint)

The first day is, of course, the first day of the Days of Unleavened Bread. And the morrow after the fifteenth is, of course, the sixteenth! Thus count from the sixteenth!

And secondly, this is backed up by the Targum which states it even clearer. To ignore any of these Scriptures as testimonies to the truth is to ignore to our demise!

Leviticus 23:11-12 And he shall uplift the sheaf before the Lord to be accepted for you. After the first festal day of Pascha (or, the day after the feast‑day of Pascha) on the day on which you elevate the sheaf . . . 15 And number to you after the first feast day of Pascha, from the day when you brought the sheaf for the elevation, seven weeks; complete they shall be. (Targum, translated by J. W. Etheridge)

Same thing, the day “after the feast-day of Pascha” is, again, the sixteenth! The evidence from both the Septuagint and Targum are overwhelming. At times they are superior to the Masoretic Text. Here is an example:

How do you solve the problem of Genesis 15 where it says 400 years and in Exodus 12 says 430 years? Is there an error? Also, how does this tie into the age of Isaac when he was offered as the burnt offering? So where do we begin?

Genesis 15:12 And when the sun was going down, a deep sleep fell upon Abram; and, lo, an horror of great darkness fell upon him. 13 And he said unto Abram, Know of a surety that thy seed shall be a stranger in a land that is not theirs, and shall serve them; and they shall afflict them four hundred years (Masoretic KJV)

Exodus 12:40 Now the sojourning of the children of Israel, who dwelt in Egypt, was four hundred and thirty years.(Masoretic KJV)

The Masoretic Text above says “in Egypt” but the Septuagint read “Egypt and Chanaan.” Chanaan is Canaan

From the Septuagint:

Genesis 15:12 And about sunset a trance fell upon Abram, and lo! a great gloomy terror falls upon him. 13 And it was said to Abram, Thou shalt surely know that thy seed shall be a sojourner in a land not their own, and they shall enslave them, and afflict them, and humble them four hundred years. (Septuagint)

Exodus 12:40 And the sojourning of the children of Israel, while they sojourned in the land of Egypt and the land of Chanaan, [was] four hundred and thirty years. (Septuagint)

From the Targum:

Genesis 15:12-13 And when the sun was nearing to set, a deep sleep was thrown upon Abram: and, behold, four kingdoms arose to enslave his children: Terror, which is Bavel; Darkness, which is Madai; Greatness, which is Javan; Decline, which is Pheras, which is to fall, and to have no uplifting, and from whence it is to be that the children of Israel will come up. And he said to Abram, Knowing, thou must know, that thy sons shall dwell in a land not their own, because thou hast not believed, and they will subjugate and afflict them four hundred years; and also that the people whom they shall serve I will judge with two hundred and fifty plagues, and afterwards they shall go forth into liberty with great riches. (Targum)

Exodus 12:40 And the days of the dwelling of the sons of Israel in Mizraim were thirty weeks of years, (thirty times seven years,) which is the sum of two hundred and ten years. But the number of four hundred and thirty years (had passed away since) the Lord spake to Abraham, in the hour that He spake with him on the fifteenth of Nisan, between the divided parts, until the day that they went out of Mizraim. And it was at the end of thirty years from the making of this covenant, that Izhak was born; and thence until they went out of Mizraim four hundred (years), on the selfsame day it was that all the hosts of the Lord went forth made free from the land of Mizraim. (Targum)

Abraham (75 years old when he left Ur for Caanan: Gen 12:4; was 100 when Isaac was born: Gen 21:5) If the Covenant was made 30 years before Isaac was born, then Abraham would be 70 years old, i.e. when he was still in Ur?

Isaac (60 years old when he had Jacob: Gen 25:26)

See the source image

Jacob (130 years old when he entered Egypt: Gen 47:9. When Jacob descended to Egypt at the age of 130, 190 years of the 400 years had already passed, thus leaving 210 years. This is the number of years that the Israelites lived in Egypt.

Levi (137 years old: Ex 6:16)
Kehath (133 years old: Ex 6:18)
Amram(137 years old: Ex 6:20)
Moses (80 years old when God called him: Ex 7:7; a fourth generation: Gen 15:16)

To elaborate the problem with the Masoretic text, presuming that Kehath was even only one day old when entering Egypt, he is recorded as living 133 years (Ex. 6:18). Kehath’s son is Amram who lives 137 years (Ex. 6:20) of which some presumably overlap with those of his father Kehath. Amram’s son is Moses who is 80 when standing before Pharaoh (Ex. 7:7) – presumably some of those years overlap with his father Amram’s years. Even without the issue of overlapping years, the total maximum number of years would only be 133 + 137 + 80 = 350 years. This would mean that even if Kehath entered Egypt on the first day of his life, had Amram on the last day of his life, and who, in turn, had Moses on the last day of his life, the longest period of time that the nation could have been in Egypt is 350 years.

Genesis 15:13 And he (God) said unto Abram, Know of a surety that thy seed shall be a stranger in a land that is not theirs, and shall serve them; and they shall afflict them four hundred years;

The count of the 400 years as recorded in Genesis 15:13 should start with the birth of Isaac. Isaac was 60 years old when he had Jacob (Gen. 25:26) and Jacob was 130 when standing before Pharaoh (Gen. 47:9). Therefore, when Jacob descended to Egypt at the age of 130, 190 years of the 400 years had already passed, thus leaving 210 years. This is the number of years that the Israelites lived in Egypt.

Therefore the Masoretic KJV of 430 years of “dwelling in Egypt” is a BLATANT ERROR. The Septuagint and the Targum gives an accurate account, but the Targum translates and elucidates with great insights. 

The Targum is like a mirror. When placed against the end-time CoG Communities, it reflects their nakedness. When the Jews returned from their exile in Babylon in the 6th century BC, most of them couldn’t speak Hebrew; they spoke Aramaic, but they still retained the Torah, which were read to them in Hebrew. Something had to be done so that the people would understand God and His Word. 

Starting with Ezra, the new communities found an answer. After hearing Ezra read a few verses of the Torah scroll in Hebrew, either he or other Levites translated it to Aramaic, hence it set the stage for the Aramaic version of the Bible, called a Targum, which simply means translation. Hence the Targum is an entrenched translation of the Hebrew Bible that was written or compiled in Judea from the Second Temple period until the early Middle Ages (late first millennium).

“The Levites … instructed the people in the Law while the people were standing there. They read from the Book of the Law of God, making it clear and giving the meaning so that the people understood what was being read.” (Nehemiah 8:7–8)

Nehemiah 8:7 NKJV and the Levites helped the people to understand the Law; and the people stood in their place. 8 So they read distinctly from the book, in the Law of God; and they gave the sense, and helped them to understand the reading.

So they read in the book of the lawand gave the sense — i.e., they read and translated the meaning of the Hebrew words, and expounded them in the common language. And caused them to understand the reading — So they gave them both a translation of the Hebrew words, into the Chaldee or Syriac, and an exposition of the things contained in them, and of the duty incumbent upon the people by virtue thereof; to declare and teach these things were a great part of the duties of both priests and Levites.

Adam Clark comments on Nehemiah 8:8: I beg leave to make a few observations: – So they read in the book in the law of God distinctly, and gave the sense, and caused them to understand the reading . . . but it appears that they had in general lost the knowledge of the ancient Hebrew to such a degree, that when the book of the law was read, they did not understand it: but certain Levites stood by, and gave the sense, i. e., translated into the Chaldee dialect. This was not only the origin of the Chaldee Targums, or translation of the law and prophets into that tongue but was also, in all probability, the origin of preaching from a text; for it appears that the people were not only ignorant of their ancient language, but also of the rites and ceremonies of their religion, having been so long in Babylon, where they were not permitted to observe them. This being the case, not only the language must be interpreted, but the meaning of the rites and ceremonies must also be explained . . . 

John Gill comments on the above “they first read it in Hebrew, and . . . not hereby how to read it, but chiefly to understand what was read, that they might clearly know their duty to God and men.”

Ezra and those with him expounded obscurer passages, and in doing so naturally translated into the vernacular Aramaic dialect. This simply explains the former: they expounded as they read. They gave the meaning though the scriptures on how Ezra and those with him would understand the meaning from the Torah. 

THEREFORE IF GOD INTENDED FOR US TO “COUNT” FROM THE DAY AFTER THE FIRST DAY OF UNLEAVENED BREAD:
THEN SOMETIMES we would have to count “1 week” as being:

– from a Monday to the following Sunday; or
– from a Wednesday to the following Tuesday; or
– from a Friday to the following Thursday; or
– from a Sunday to the following Saturday. (When Should We Keep Pentecost?)

This is correct. Pentecost is never called the Feast of Sabbaths, it’s the Feast of Weeks, or Feast of Heptads (blocks of seven days). The Feast of Weeks could start at any day of the week. The best illustration is Ezekiel 45:21 where the seven-day Feast of Unleavened Bread could start at any time of the week — it DOESN’T HAVE TO WAIT UNTIL THE WEEKLY SABBATH TO START!. 

How could God possibly tell us: “counting FROM A WEDNESDAY TO THE FOLLOWING TUESDAY, COUNT SEVEN FULL WEEKS, COMING TO THE SEVENTH TUESDAY, AND THEN GO TO THE MORROW AFTER THAT TUESDAY TO ARRIVE AT A WEDNESDAY PENTECOST”?? How could God possibly refer to a period of time from a Wednesday to the following Tuesday as “A SHABBATH”?? (When Should We Keep Pentecost?)

Look at Ezekiel 45:21 again: In the first month, in the fourteenth day of the month, ye shall have the passover, a Feast of Weeks (Haptads) H7620 days; unleavened bread shall be eaten. — the seven days of UB starts any day IMMEDIATELY after Passover, so it could be a Monday, a Wednesday, a Friday or a Sunday. By your double question marks above, it demonstrated the opposite of what you intended, that the “Sabbath” could be translated as “weeks” as Strong shows below:

A. period of seven days, a week — Feast of Weeks or Heptads; B. heptad, seven (of years)

Leviticus 23:15-16 seven sabbaths [h7676 shabbat] according to Strong, this shabbat could be translated as:

(a) sabbath
(b) day of atonement
(c) sabbath year
(d) WEEK
(e) produce (in sabbath year)

James Strong (1822 – 1894)

According to Strong, both shabua (H7620) and sabbath (H7676) could be translated as weeks. Has Frank Nelte had a higher level of Hebrew degree at the angelic but uncredited Ambassador College than Strong’s? Who were his Hebrew lecturers at the now fallen Ambassador College can we ask him? James Strong was both acting President and Professor of Biblical Literature at Troy University; Professor of Exegetical Theology at Drew Theological Seminary, and was honored with a degree of Doctor of Laws (LL.D.) by Wesleyan University in 1881. 

And Strong’s definition allows the JPS 1917 and many other translators to transcribe the seven Sabbaths as seven WEEKS:

Leviticus 23:15 And ye shall count unto you from the morrow after the day of rest (footnote: Sabbath), from the day that ye brought the sheaf of the waving; seven weeks shall there be complete; 16 even unto the morrow after the seventh week shall ye number fifty days; and ye shall present a new meal-offering unto the LORD. (JPS 1917)

Other versions that translated “seven weeks” in Leviticus 23:15 are:

The Companion Bible (Bullinger)
Common English Bible (CEB)
Complete Jewish Bible (CJB)
Contemporary English Version (CEV)
Christian Standard Bible (CSB)
Darby Translation (DARBY)
Easy-to-Read Version (ERV)
English Standard Version (ESV)
Expanded Bible (EXB)
GOD’S WORD Translation (GW)
Good News Translation (GNT)
Holman Christian Standard Bible (HCSB)
International Children’s Bible (ICB)
International Standard Version (ISV)
Lexham English Bible (LEB)
The Message (MSG)
Modern English Version (MEV)
Names of God Bible (NOG)
New American Bible (Revised Edition) (NABRE)
New Century Version (NCV)
New English Translation (NET Bible)
New International Version (NIV)
New Life Version (NLV)
New Living Translation (NLT)
Revised Standard Version (RSV)
The Voice (VOICE)
Wycliffe Bible (WYC)
The Septuagint (LXX
The Targum

Adam Clarke comments on “Ye shall count unto you – seven Sabbaths” – “That is, from the sixteenth of the first month to the sixth of the third month. These seven weeks, called here Sabbaths, were to be complete, i. e., the forty-nine days must be finished, and the next day, the fiftieth, is what, from the Septuagint, we call pentecost.”

DO JEWISH CUSTOMS AND AUTHORITIES STICK TO THE BIBLE?

If you are on the lookout for it, it is quite easy to find evidence that the Jews actually do not stick to what is revealed in the Bible at all. It is fairly easy to discover that for the Jews TRADITION is of far higher importance than what God actually instructed in the Old Testament. (When Should We Keep Pentecost?)

Some of their traditions are bad, but some are great. Only the wise know how to separate the good from the bad. The stupid renders all traditions as bad. Here is what Paul says:

“I profited in the Jews’ religion beyond many of my equals in mine own nation, being more exceedingly zealous for the traditions of my fathers” Galatians 1:14.

“Therefore, brethren, stand fast and hold to the traditions which ye have been taught, whether by word or our epistle” II Thessalonians 2:15.

Paul being a Pharisee, and son of a Pharisee’ and in all thirteen epistles are littered with Pharisaic precepts. He grew up and was “zealous for the traditions of my fathers” – namely, those of the Pharisees, bred up at the feet of Gamaliel. “Tradition (paradosis) embraces everything which is handed down orally or in writing from generation to generation,” says the Schaff’s Commentary. The Whedon’s commentary on Zealous — “The inspiring motive; zeal for the ancestral traditions; not merely the sacred books, but hereditary customs and rabbinical maxims, as afterwards embodied in the Talmud.”

Second, if traditions are always untrustworthy, then the Masoretic vowel points should also be considered untrustworthy. They are based on traditions and should be rejected, because how to read any single Hebrew word comes from oral tradition. Plain and Simple!

In the March 1992 edition of “Prophecy Flash” Mr Dankenbring has an article entitled “A Letter to the Chief Rabbi, London – on Passover and Pentecost”, and another article entitled “Reply from the Office of the Chief Rabbi”. This second article is interesting in that it clearly reveals the Jewish thinking. The last two paragraphs of that article are most revealing.

Firstly, the “Chief Rabbi” points out that

“… according to the Sadducees, PENTECOST WOULD ALWAYS FALL ON A SUNDAY”. (my emphasis)

THIS IS A STAGGERING ADMISSION!

During the time of Jesus Christ the Pharisees controlled the local synagogues, but THE SADDUCEES CONTROLLED THE TEMPLE AND THE TEMPLE WORSHIP! The priests, with very few exceptions, were Sadducees!

Therefore during the time of Christ Pentecost at the Temple in Jerusalem was always observed on a Sunday … and this information is given to us by the “Chief Rabbi” (Christ said to call no man ‘Rabbi’!) of London, England. Thus, when Christ observed the Day of Pentecost and when the disciples observed it at the Temple in Acts chapter 2, IT WAS ON A SUNDAY!

Church of God Photo Library - Letter 'N'

But continue reading this “reply from the office of ‘the chief rabbi'”. Notice the last paragraph of that article – it’s only six-and-a-half lines long. How did the Pharisees try to argue with the Sadducees? Notice! [The parenthetical statements are my comments.]

“The Pharisees … tried to do this from text [i.e. they tried by using THE OLD TESTAMENT SCRIPTURES!] WITHOUT relying on the oral traditions, [what “oral traditions”? – the ones Christ addressed in Matt 15:1-3 and Mark 7:8-9?] since their adversaries were not ready to accept all of the oral tradition [i.e. the Sadducees said: unless it’s in the Bible, we don’t believe it].”

But now notice this candid admission concerning pharisaical teachings:

“But the real reason they [i.e. the Pharisees] insisted on this interpretation [Pentecost on the 6th of Sivan] is based on two factors …”

WHAT ARE THOSE TWO FACTORS THAT DETERMINE PHARISAICAL BELIEFS?? God’s Word? the Bible? NO!! Continue with the quote:

“…1) The oral tradition which [they falsely claimed!] had come down from Moses’ time which they maintained and passed on; 2) Logic which dictated that …” (When Should We Keep Pentecost?)

Who was that “Chief Rabbi” of London who wrote “… according to the Sadducees, PENTECOST WOULD ALWAYS FALL ON A SUNDAY”.  Actually there is nothing wrong with what he wrote. The truth is that no sensible Orthodox Rabbi is that stupid to say that such is the truth. Keep your head cool: he only wrote that “according to the Sadducees, Pentecost would always fall on a Sunday.” The Rabbi didn’t say that’s what he believes nor that that is the truth. If the “Chief Rabbi” believes such is the truth, the only possibilities are that he is either a rabbi from (a) a Karaite Organisation, or (b) a Reform Movement. 

Both the Karaites and Reform Jews have Sadducaic leaning. And they, of course, claim that during the first century, the Sadducees had control over the Temple functions. But Josephus, the first century Jewish historian, wrote in his Antiquities of the Jews, informing us that the Pharisees were the dominant religious party in Judaea during the time of Christ, and that they controlled the worship services:

The common people followed the Pharisees. And although the Sadducees were occupying the upper stratum of the Jewish aristocracy, they were few and unable and unwilling to carry out their own beliefs in the Temple service, but to carry “the notions of the Pharisees”:

But the doctrine of the Sadducees is this: That souls die with the bodies; nor do they regard the observation of any thing besides what the law enjoins them; for they think it an instance of virtue to dispute with those teachers of philosophy whom they frequent: but this doctrine is received but by a few, yet by those still of the greatest dignity. But they are able to do almost nothing of themselves; for when they become magistrates, as they are unwillingly and by force sometimes obliged to be, they addicted themselves to the notions of the Pharisees, because the multitude would not otherwise bear them. (Ant 18,4)

Sadducees | Life-Giving Water
Sadducees – “Disappeared” during the AD 70 Inferno!

Also, the Unger’s Bible Dictionary tells us further political-religious amalgamation called the Sadducees:

“Their political supremacy was, however, of no long duration. Greatly as the spiritual power of the Pharisees had increased, the Sadducean aristocracy was able to keep at the helm in politics. The price at which the Sadducees had to secure themselves power at this later period was indeed a high one, for they were IN THEIR OFFICIAL ACTIONS TO ACCOMMODATE THEMSELVES TO PHARISAIC VIEWS. With the fall of the Jewish state the Sadducees altogether disappear from history. Their strong point was politics. When deprived of this their last hour had struck. While the Pharisaic party only gained more strength, only obtained more absolute rule over the Jewish people in consequence of the collapse of political affairs, the very ground on which they stood was cut away from the Sadducees” (“Sadducees,” pg 954).

And keeping your head cool again, using Oral Traditions could be true and valid. The Talmud tells the story of a Gentile who went to Hillel the Elder and said to him, “I want to convert, but I want to accept only the Written Torah, and not the Oral Torah. I don’t wish to accept the words of the Rabbis. So teach me only the Written Torah.”

But Hillel knew that the man wanted to do the right thing, but he didn’t understand the purpose of the Oral Torah. So Hillel began to teach him the Aleph Bet (Hebrew alphabet). The first day, Hillel taught him the first two letters, aleph and bet.

The next day, Hillel taught him the same two letters in reverse. He showed him the letter aleph, but called it “bet.” 

The man objected, “but yesterday you taught it the other way!”

A Critique of Frank Nelte's Passover (I) | The mystery of life blog

“Well, then, you need me, a Rabbi, to teach you the Aleph Bet? So you have to trust my knowledge of the tradition of the letters. What I tell you is the Oral Tradition. You can’t read the alphabet if no one tells you how they are pronounced. And you think you don’t need the Rabbis’ knowledge of Jewish Tradition in order to understand the words of the Torah? Those are much more difficult! Without an Oral Tradition you will never be able to learn the Torah.”

So it is clear that an Oral Tradition is needed, and that one exists. If you don’t agree, try to define: (a) what circumcision is, and (b) when is Sabbath — from the Bible alone and without tradition! and (c) how do you pronounce the 22 Hebrew alphabets when you don’t have the Oral Traditions? And how to identify and pronounce each of the vowels with the 22 alphabets?

But did you notice one other point in this statement by the “Chief Rabbi”? When the Pharisees tried to argue with the Sadducees based purely on the written Word of God, they couldn’t succeed. Did you notice this? What does this tell you?

It tells you that about 2000 years ago already the Sadducees, the keepers of the Temple Scriptures, the ones who were of the priestly line and who were responsible for all of the Temple services, DID NOT ACCEPT THAT “SHABBATH” MEANS “WEEKS”! And those learned Sadducees knew more about the Hebrew language than all of the “noted Biblical scholars and Bible dictionaries” of today put together! It makes clear that the Pharisees tried to attach the meaning of “weeks” to the word “shabbath” and that the Sadducees did not accept this as valid. (When Should We Keep Pentecost?)

Yes, the above were very true, but not all, especially this line: “When the Pharisees tried to argue with the Sadducees based purely on the written Word of God, they couldn’t succeed.” On almost every issue they debated frequently. And it was left for Christ to judge. John the Baptist prophesied about judgement time and the Messiah:

Luke 3:16 John answered, saying unto them all, “I indeed baptize you with water; but One mightier than I cometh, the straps of whose shoes I am not worthy to unloose. He shall baptize you with the Holy Ghost and with FIRE. 17 His winnowing fan is in His hand, and He will thoroughly purge His floor and will gather the wheat into His garner; but the chaff He will burn with FIRE unquenchable.”

Let’s get back to a basic parable where the tares and wheat were growing together:

Matthew 13:1 The same day, Jesus went out of the house and sat by the seaside. 2 And great multitudes were gathered together unto Him, so that He went into a boat and sat, and the whole multitude stood on the shore . . .
24 Another parable put He forth before them, saying, “The Kingdom of Heaven is likened unto a man who sowed good seed in his field; 25 but while men slept, his enemy came and sowed tares among the wheat, and went his way. 26 But when the blades had sprung up and brought forth fruit, then appeared the tares also.
27 So the servants of the householder came and said unto him, ‘Sir, didst not thou sow good seed in thy field? From whence then hath come the tares?’ 28 He said unto them, ‘An enemy hath done this.’ The servants said unto him, ‘Wilt thou then have us go and gather them up?’
29 But he said, ‘Nay, lest while ye gather up the tares, ye root up also the wheat with them. 30 Let both grow together until the harvest, and in the time of harvest I will say to the reapers, “Gather ye together first the tares, and bind them in bundles to burn them, but gather the wheat into my barn.”’”

As the Pharisees and Sadducees thrived together for a designated time only, and forty years later, it was decision time, judgement time — to put the tares into the fire. And who were those that met their fate during the fire and brimstones of the 70 AD inferno? The Sadducees and their allies — the Herodians and Boethusians. The Essenes (who practiced an anti-Sanhedrin calendar), all ended in the inferno. Every Blind Guide ignores the significance of the destruction of Judea in the 70 AD conflagration BECAUSE THEY ARE BLIND!

How did the Sadducees and Essenes just “DISAPPEARED” from this 70 AD INFERNO?

Shall a trumpet be blown in the city, and the people not be afraid? Shall there be evil in a city, and the LORD hath not done it?

~~~~~