The Irony of a Birthright

•April 13, 2026 • Leave a Comment

Abraham had been promised many blessings: his descendants would be as numerous as the stars in the sky (Genesis 15:5) and as the sand on the seashore (Genesis 22:17).

The Stars in the Sky imagery reflects the spiritual and heavenly dimension of the promise. Just as the stars guide travelers through the dark, Abraham’s descendants were to offer moral and spiritual guidance for all of humanity.

The Sand on the Seashore represents the physical and earthly reality of the promise. It suggests a vast, grounded presence: though each grain is small, together they are innumerable and indestructible, representing the endurance of a people who can be humble and yet unshakable in the face of any adversary.

Thus, while the Stars symbolize the lofty, spiritual heights of a people, the Sand symbolizes their gritty, earthly reality. To be “as the sand and stars” is to possess a collective strength that is both humble and indestructible, yet shining eternally so that all the families of the earth shall be blessed.

Further, more specific blessings were to follow: a line of kings and a multitude of nations

To Abraham

“And I will make of thee a great nation, and I will bless thee and make thy name great; and thou shalt be a blessing.
“And I will bless them that bless thee, and curse him that curseth thee; and in thee shall all families of the earth be blessed.”
Genesis 12:2-3

“And I will make thee exceeding fruitful, and I will make nations of thee, and kings shall come out of thee Genesis 17:6

“And the Lord said, “Shall I hide from Abraham that thing which I do,
seeing that Abraham shall surely become
a great and mighty nation, and all the nations of the earth shall be blessed in him? Genesis 18:17-18

To Isaac, God promised through Rebekah billions of descendants and control of gateways

“And they blessed Rebekah and said unto her, “Thou art our sister; be thou the mother of thousands of millions; and let thy seed possess the gate of those who hate them” Genesis 24:60

To Jacob, his posterity spreading to all four directions of the earth; a nation and company of nations

“And thy seed shall be as the dust of the earth, and thou shalt spread abroad to the west and to the east, and to the north and to the south; and in thee and in thy seed shall all the families of the earth be blessed” Genesis 28:14

“And God said unto him, ‘Thy name is Jacob; thy name shall not be called Jacob any more, but Israel shall be thy name;’ and He called his name Israel.
And God said unto him, ‘I am God Almighty. Be fruitful and multiply;
a nation and a company of nations shall be of thee, and kings shall come out of thy loins'” Genesis 35:10-11

Although the Birthright was conferred to Joseph, the Scepter had mysteriously eluded the final blessing given to Ephraim and Manasseh, “for Judah prevailed above his brethren,” and so it followed that the Scepter was given to the Tribe of Judah.

This was confirmed in 1 Chronicles 5:1-2

Now the . . . birthright was given unto the sons of Joseph . . . . 2 For Judah prevailed above his brethren, and from him came the chief ruler, but the birthright was Joseph’s.

Enhance lighting, sharpness, and color naturally
And kings shall come out of thee, Genesis 17:6; and this aligns with the British Royalty in Great Britain; and not in the modern state of Israel.

But the Blessings demand special study. They are principally broken down into three divisions (1) a Cluster of Kings (2) a Great Nation, and (3) a Company of Nations

Judah

Under inspiration, Jacob prophesied that his children would bow down to Judah:

8 “Judah, thou art he whom thy brethren shall praise; thy hand shall be on the neck of thine enemies; thy father’s children shall bow down before thee.

9 Judah is a lion’s whelp; from the prey, my son, thou art gone up. He stooped down, he couched as a lion, and as a grown lion; who shall rouse him up?

10 The scepter shall not depart from Judah, nor a lawgiver from between his feet until Shiloh come; and unto Him shall the gathering of the people be.” Genesis 49:8-10

A scepter is a symbol of kingship. Judah will hold the royal scepter, and his descendants will always rule. Nations of the world, including those of his brothers will bring him tributes and bow down before him.

The scenario is very mysterious as this is talking of Judah as a tribe, thus rendering them a tribe of kings, but there will be one special King, the Messiah, the Son of God.

“And He hath on His vesture and on His thigh a name written: King of Kings, And Lord of Lords” Revelation 19:16

The intriguing mystery is that the three times the word “lion” is mentioned as emblem conferred for the scepter or kingship of Judah, this lion symbol is taken up in the Royal Coat of Arms of the United Kingdom; a share of the same symbol in the crest of the modern state of Israel, which is of the tribe of Judah.

Increase overall brightness naturally
Lion Emblem of Jerusalem, the Capital of the modern state of Israel (Judah)

Great Britain

To Sarah, God promised:

“And I will bless her and give thee a son also by her. Yea, I will bless her, and she shall be a mother of nations; kings of people shall be of her” Genesis 17:16

Before Jacob, God promised:

And God said unto him, “I am God Almighty. Be fruitful and multiply; a nation (gō·y) and a company of nations (gō·yim) shall be of thee, and kings shall come out of thy loins” Genesis 35:11

The Birthright composes of many blessings: a great multitude of people, exceedingly fruitful, control of sea-gates, dew of the heavens, of the fatness of the earth, and plenty of grain and wine; and although dominated by the posterity of Joseph, it was also dispersed throughout the other sons of Jacob.

Enhance lighting, sharpness, and color naturally
A Lion and Three Lions in the Royal Coat of Arms of the United Kingdom
Manasseh: Royal Coat of Arms of Scotland has a Lion and two Unicorns

At the height of its power and influence early in the 20th century, Great Britain controlled an empire covered approximately one fourth of the world’s territory (in 1922 it incorporated 13 million square miles) and boasted of 54 territories and colonies—including Canada, India, Pakistan, Ceylon, Burma, Egypt, Nigeria, Ghana and vast swaths of Africa, the land of Palestine, islands in the Caribbean, Hong Kong, Singapore, Australia, New Zealand, the Pacific islands and others.

Great Britain at its Height

Joseph, his posterity spreading to all directions of the earth, but Great Britain never control the United States

Great Britain was the most expansive empire in the history of the world, holding sway over some 460 million people—a fifth of the world’s population at the time. Moreover, following the defeat of Napoleonic France in 1815, Great Britain enjoyed a century of almost unchallenged global dominance through its vincible as well as its invincible Royal Navy that rules the waves.

The British Empire also possessed or controlled several strategic sea gates—the Suez Canal, Gibraltar, the Cape of Good Hope, etc. Historians agree that Great Britain rose to become the world’s leading nation after breaking free from Spanish and French dominance.

Indeed, after defeating Napoleon in 1815 it became clear that Britain was the undisputed ruler of the western world. Supported by an unrivaled naval power, what followed was a century of peace—“Pax Britannica”—cut short only by the German militarism that triggered World War I in 1914-18, and again in World War II in 1941-45, and then its invincibility dropped out of any prominence.

The United States of America

Although the birthright blessing of national greatness were given to Manasseh, it was his younger brother Ephraim, and one that arrived later, identified and making an appearance as the thirteenth tribe, that will supplant Manasseh:

“I know, my son, I know, and he shall also be great; but his younger brother shall be greater than he, and his seed shall become a multitude of nations” Genesis 48:19

Great Seal of the United States – thirteen Stars, thirteen Arrows, thirteen Leaves and thirteen Olives – hence the Seal of being the thirteenth tribe
Enhance lighting, sharpness, and natural color balance
“I know, my son, I know, and he shall also be great; but his younger brother shall be greater than he, and his seed shall become a multitude of nations” Genesis 48:19

A new nation arriving last in the New World was to eclipse Great Britain. It would be Ephraim with seven fleets each with a co-ordinated strike force and numerous submarines beneath the waves roaming up and down the whole world, that, for decades, could threaten any rival into either submission or into oblivion.

Abraham Lincoln, the sixteenth American President, said in a January 27, 1838 address,

“We find ourselves in the peaceful possession, of the fairest portion of the earth, as regards extent of territory, fertility of soil, and salubrity of climate…We…found ourselves the legal inheritors of these fundamental blessings. We toiled not in the acquirement or the establishment of them.” Abraham Lincoln

But how long will America’s prosperity last? Is it indefinitely? Although Joseph’s modern descendants are seemingly on top of the world, are they destined for a fall? Are there cracks forming now? Can we know?

For further understanding who the modern tribes of Judah and Joseph are, the best book to have expounded this subject is  “Judah’s Sceptre and Joseph’s Birthright” by J.H. Allen (1847-1930).

~~~~~

“The sceptre shall not depart from Judah …” (Genesis 49:10); “but the birthright was Joseph’s” (1 Chronicles 5:2). Strictly speaking this birthright was not given to the Jews, nor to be inherited by all the other tribes of Israel! It was Joseph’s; the Jews has the law, the sceptre.

That is, only a part of the Israelites—the descendants of Joseph—was to inherit the birthright, a tremendous national promise!

When it was reported to Joseph that Jacob, his father, was ill, Joseph took with him his two sons, Manasseh and Ephraim, and hastened to the dying patriarch’s bedside.

And one told Jacob and said, “Behold, thy son Joseph cometh unto thee;” and Israel strengthened himself and sat upon the bed.

And Jacob said unto Joseph, “God Almighty appeared unto me at Luz in the land of Canaan, and blessed me

and said unto me, ‘Behold, I will make thee fruitful and multiply thee; and I will make of thee a multitude of people, and will give this land to thy seed after thee for an everlasting possession.’ (Genesis 48:2-4).

These promises are those of the birthright. These promises are of multiple seed—a multitude of people—and possession of the Promised Land.

Jacob, though blind so he could not see the lads before him, crossed his hands,

14 And Israel stretched out his right hand and laid it upon Ephraim’s head, who was the younger, and his left hand upon Manasseh’s head, guiding his hands wittingly; for Manasseh was the firstborn.

15 And he blessed Joseph and said, “God, before whom my fathers Abraham and Isaac walked, the God who fed me all my life long unto this day,

16 the Angel who redeemed me from all evil, bless the lads; and let my name be named on them, and the name of my fathers Abraham and Isaac; and let them grow into a multitude in the midst of the earth.” (Genesis 48:14-16).

Notice, Israel did not confer this blessing on just one, but on both—“Bless the lads,” he said. This blessing went upon them jointly. “Let my name be named on them” was part of this blessing. His name was to be Israel. Thus the name Israel was to be stamped on Ephraim and Manasseh!

That is, Ephraim and Manasseh together received the right to the name Israel. It was to become the national name of their descendants. And their descendants were not to be confused with Jews!

Together the descendants of these two lads, Ephraim and Manasseh, were to grow into the promised multitude — a great nation (gō·y) and company of nations (gō·yim). These national blessings are poured upon them jointly.

Jacob Crosses Hands

But at this juncture, Joseph noticed that Jacob’s right hand was not resting upon the head of the firstborn. He endeavored to remove it.

18 And Joseph said unto his father, “Not so, my father, for this is the firstborn. Put thy right hand upon his head.”

19 And his father refused and said, “I know it, my son, I know it. He also shall become a people, and he also shall be great; but truly his younger brother shall be greater than he, and his seed shall become a multitude of nations.”

20 And he blessed them that day, saying, “In thee shall Israel bless, saying, ‘God make thee as Ephraim and as Manasseh.’” And he set Ephraim before Manasseh (Genesis 48:18-20).

Here the promises are no longer collective, possessed jointly. Jacob now was prophesying as to the blessings of each, individually. Notice that, before dividing the promises, this prophetic blessing indicated that the descendants of these lads should remain together, and together grow into a great multitude, then become separated, Manasseh becoming a great nation (gō·y), and Ephraim a still greater company of nations (gō·yim).

“His glory is like the firstling of his bullock, and his horns are like the horns of unicorns. With them he shall push the people together to the ends of the earth; and they are the ten thousands of Ephraim, and they are the thousands of Manasseh” Deuteronomy 33:17

Most Churches of God communities (including J.H. Allen quoted above), consider Great Britain as Ephraim and the United States as Manasseh. They derive their conclusion from Genesis 35:11, a blessing of a Nation (gō·yim) and a Company of Nations (gō·yim) from a simplistic observation that the United States is one Nation and therefore is Manasseh; and that Great Britain, a company or commonwealth of nations, is Ephraim.

But the word, nations, is go·yim (from its root, goy, H1471), which, more often, would be translated nations, usually of heathen nations, a group of peoples, an assembly of states, or even a flight of locusts.

When perceived in English, the United States is instantly seen as a nation, but the United States could be perceived and rendered as a union of numerous states, that is, fifty states, fifty go·yim; a union of fifty states, a company of fifty go·yim; or by its enemies, even fifty swarms of locusts.

The original twelve tribes of Israel grew to became thirteen when Joseph was subdivided into the tribes of Ephraim and Manasseh. Since Ephraim was younger than Manasseh, Ephraim has essentially became “the thirteenth tribe.”

The number “13” has uniquely been associated with the founding of America. The United States of America was born as a union of thirteen separate colonies, with its flag exhibiting thirteen stripes and thirteen stars. The prominence of the number “13” in the founding of America indicates a divine hand influencing world events to appropriately place the number “13” on this Ephraimite tribe.

The thirteenth tribe arrived late, very late, long after the other twelve had found their seats and got themselves established and settled in their land.

Hence to conclude the United States as Manasseh is standing on shaky ground. It would be far prudent to search for other evidence. The Great Seal of the United States has thirteen Stars, thirteen Arrows, thirteen Letters in the phrase, “E PLURIBUS UNUM,” thirteen Stripes, thirteen Leaves and thirteen Olives; hence the Seal indicates their nation as of being the thirteenth tribe.

And the thirteenth tribe arrived late, very late, long after the other twelve had found their place and got themselves established and settled in their land. The United States gained its independence from Britain only in 1776 and, within fifty years, formulated the Manifest Destiny and the Monroe Doctrine, then established seven fleets that roamed around the oceans and becoming a formidable force in the whole world.

American foreign policy has long been a study in duality, mirrored by the Great Seal itself: the Olive Branch in the left talon offers the promise of the ‘City on a Hill,’ an invitation to join a world led by moral example. Yet, should that invitation be declined, the Arrows in the right talon—the ‘Big Stick’ of gunboat diplomacy—provide a swifter, more coercive alternative. This synergy of soft and hard power has become the engine that drives the American global order, the Pax Americana.

The younger United States is definitely spiritual Ephraim; and the older Manasseh is the United Kingdom, because the Divine hand preferred Ephraim over Manasseh.

~~~~~

And below are further insight concerning two Prophecies relating to Joseph’s birthright:

First, there’s the revelation that Joseph, a son of Jacob and Rachel, who was bestowed with the yoke of Jacob (Genesis 27:40-41) and a flame (Genesis 30:25 Jonathan) against Esau, the firstborn, who had forfeited his birthright.

Second, it was again Joseph who would be blessed with the birthright, bestowed by Jacob, which had been taken from Reuben, the firstborn, who had also forfeited his birthright (Genesis 49:3 Jonathan).

(1) And it came to pass, when Rachel had borne Joseph, that Jacob said unto Laban, “Send me away, that I may go unto mine own place and to my country. Genesis 30:25

The Targum of Jonathan reveals how the posterity of Joseph, not any other tribe, were to be a yoke (Genesis 27:40) and a flame (Genesis 49:3) unto the house of Esau, saying

“And it was, when Rachel had given birth to Joseph, that Jacob said through the Holy Spirit that the House of Joseph is destined to be like a flame to consume the House of Esau.

“He said: ‘From now on, I am not afraid of Esau and his legions.’ And he said to Laban: ‘Send me away, that I may go to my own place and to my own land.’” Genesis 30:25 Jonathan

And now onto History to mingle with Prophecies:

The Spanish Armada, with 130 ships and 30,000 men on board, set sail from Spain in July 1588, intending to overthrow the Protestant Queen Elizabeth I and restore Catholic rule over England; but, with a devastating Divine Wind, were destroyed by the British Navy under Commander Sir Francis Drake

For an in-depth Study of who the house of Esau is, see Obadiah

(2) “Reuben, thou art my firstborn, my might, and the beginning of my strength, the excellency of dignity, and the excellency of power. Genesis 49:3

— Reuben~France, as the firstborn by nature, has the first place in the benedictory address;

— the Targum reveals explicitly how Reuben lost his birthright

“Reuben, you are my firstborn, the head of my strength, the beginning of my service, and the start of the city of my thoughts.

“It was fitting for you to have the Birthright, the High Priesthood, and the Kingdom.

“But because you sinned, my son, the Birthright was given to Joseph, the Kingdom to Judah, and the Priesthood to Levi.” Genesis 49:3 Jonathan

— great honor and power; the birthright was yours, the priesthood was yours, the kingship was yours, but now that you sinned, the birthright was given to Joseph, the priesthood to Levi, and the kingship to Judah.

In the Battle of Waterloo, June 1815; the French Imperial Army under the Command of Napoleon was defeated by British Arthur Duke of Wellington

Question: the priesthood bestored upon the Levites, to operate in God’s Temple; the scepter and kingship belong to Judah, to rule and uphold God’s laws, statutes and ordinances; the birthright bestored upon Joseph, but what is the posterity of Joseph supposed to do? Just eat, sleep and indulge in gluttony? Or be self-glorifying, narcissistic and jingoistic?

— Joseph’s descendants were to be a great nation and a company of nations (Gen 48:19); they are to be as numerous the stars of heaven and the sands of the seashore, and they shall control the gates of its enemies (Gen 22:17). But what are their collective duties as his co-heirs have to do? Should they resign themselves to the stupor of mindless gluttony, or pivot to the frantic histrionics of naked nationalism?

— perhaps some elements of Manifest Destiny and Monroe Doctrine could indicate a clue

(a) Manifest Destiny, the city on a hill mimics the stars in heaven; the idea of American exceptionalism; to let the nations see the great light (Matthew 5:14), the stars of heaven that were promised to Abraham, to light the paths for the Gentiles, so they could similarly see the great way of life from God, his laws, statues and ordinances.

“I, the Lord, have called Thee in righteousness, and will hold Thine hand, and will keep Thee, and give Thee for a covenant of the people, for a light to the Gentiles” Isaiah 42:6; or ‘a light to the nations’ (go-yim);

“And He said: ‘It is a light thing that Thou shouldest be My servant to raise up the tribes of Jacob and to restore the preserved of Israel. I will also give Thee for a light to the Gentiles (go-yim), that Thou mayest be My salvation unto the end of the earth’” Isaiah 49:6.

(b) Monroe Doctrine, a Big Stick approach needed for those nations stubbornly and persistently refused to obey God; context shows this will be fully enforced during the Millennium; some nations like “Gog and Magog” would still be similarly stiff-necked.

“And if the family of Egypt go not up and come not, upon whom there is no rain, there shall be the plague (leprosy during biblical times, but could be Covid-19 or one of its more potent variants; or a new disease you have never heard before) wherewith the Lord will smite the nations who come not up to keep the Feast of Tabernacles” Zechariah 14:18.

The strategy works in two parts. It starts with the “City on a Hill” approach—an olive branch meant to inspire and lead by example. If that doesn’t work, the “Big Stick” steps in, using the Arrow method of gunboat diplomacy to keep order. It’s this push and pull between the beacon and the blade that influences how nations act around the world.

American strategy is binary. It begins with an Olive Branch—the ‘City on a Hill’ designed to inspire and lead. When inspiration fails, the Arrow ‘Big Stick’ approach takes over, utilizing the gunboat diplomacy to enforce global objective.

But the nations of Joseph, Ephraim and Manasseh, the United States and the United Kingdom, are filthy and toxic; they’re hypocritical and a disgrace before the nations, and they profaned the name of God wherever they go.

For example, under Queen Victoria reign (1837 to 1901) instead of being a light, the British fought and imposed opium trade upon Qing China (First Opium War 1839-1842 and Second Opium War 1856-1860), subjecting a quarter of all men in China to cruety and savagery.

In 1839, a letter, from Lin Zexu, a Qing Dynasty official, pleading for the abolition of the opium trade, was sent to Queen Victoria but were ignored, pretending as if she knew nothing.

As monarch, Queen Victoria was Supreme Governor of the Church of England and she was also aligned with the Church of Scotland. As such her missionaries all around the world preaching goodness and love in the name of God would be perceived as deceitful shepherd who “profane My holy name.”

With fortunes amassed to enlarge the country’s coffers for over a hundred years, a plethora of palaces and castles were built to lace throughout the United Kingdom, with grand rooms filled with lush furnishings and decor, built for the Royals, the House of Lords, and other previleged of the opague City of London.

Most prominent among the wealth amassed, an imposing statue of Queen Victoria, flanked by guardian angels, was erected to welcome all adoring but unsuspecting friends and visitors from all over the world to pay homage to the Great Royals in Buckingham Palace.

Under Queen Victoria reign, the First Opium War 1839-1842 and Second Opium War 1856-1860 were fought and fortune gained; in the pretext of Pax Britannica
Wth so much wealth and so many palaces and estates amassed, will they succumb to the numbing rot of gluttony and embracing the hysterical glory of jingoism?

They are not sanctified or purified yet; they definitely still need to be sanctified . . .

They might hide their crimes or diminish those parts of history as if they don’t matter, but the Lord sees everything

“I have seen a horrible thing in the house of Israel; there is the whoredom of Ephraim, Israel is defiled” Hosea 6:10

And He had set a day of judgment to those people that matter

“The crown of pride, the drunkards of Ephraim, shall be trodden under feet” Isaiah 28:3
“You only have I known… therefore I will punish you” Amos 3:2

Perhaps the two-pronged mysterious prophecies about how such sanctification and purification could occur are explained in more detail in the book of Ezekiel

(1) Ezekiel 4 – 390/40 Years Timeline
(2) The Flaming Sword and Fire from the South!

Until they are sanctified, until they are purified, the City on the Hill doesn’t shine, and won’t shine; and their gunboats are firing to no effect. Watch Iran—American goals are stuck in a quagmire, caught in a snare, and its policies are divisive, offensive and have driven away even its closest allies.

~~~

And lastly, this is just the first in a series on the identities of Ephraim and Manasseh, for more, see (1) The Irony of a Birthright (2) Ephraim preferred over Manasseh (3) Ephraim as the Thirteenth Tribe (4) Who is this lying Ephraim? (5) The Ox with horns of a Unicorn

Iran TV: The Decline of the American Empire

•June 8, 2026 • Leave a Comment

An Empire is at its nadir, at the lowest point of its power, the bottom of the bottom, while Iran is portrayed as rising, so say Iranian News on TV

“Trump’s hollow threats mask America’s descent as Iran stamps its authority.”

Presstv.ir • June 4, 2026

Do you know who has officially declared the decline of the American empire? No, it’s not a Russian newspaper, not a Chinese one, not from Iran or Cuba; it is the New York Times itself.

Nothing lasts forever. Shifting this into political and imperial terms, of the various empires that have wanted to control, and indeed did control the rest of humanity, nothing lasts forever. Sooner or later, they fall.

Do they fall because of internal factors or external factors? Do they fall due to economic and military situations, or also because of spiritual issues or matters of values? Will this be the case for the United States? Recently, The New York Times has officially declared the decline and fall of the American empire.

Officially, the United States is an empire in decline, according to The New York Times, and the turning point was precisely the attack on Iran.

The American newspaper explains that Trump’s war was more than just a bad idea; it became a before and after moment in the decline of the United States.

The military operation was a disaster that showed that the US armed forces are ineffective and that they don’t have the power to impose Washington’s will.

The publication reports that military spending has been extremely high. The United States fired nearly half of its stealth missile reserve, and in turn launched over 1000 Tomahawks, equivalent to 10 times more than it buys in a single year.

Trump wounded his own nation and proved that US power is far less than the world assumed, and if it uses a nuclear weapon, the country will bring upon itself eternal shame, claims the New York Times, and all of this, partly, because Trump fell into Netanyahu’s trap.

It’s tempting to wonder at what point in the process of imperial decline the United States currently finds itself. Without a doubt, it shares elements with the British Empire a century ago, deindustrialization and an excess of commitments.

The unprovoked and unlawful attack on Iran is another factor in the decline of the United States as an empire, according to the New York Times. How do you view this situation?

Well, I think that first of all, what we’re experiencing, and there’s no doubt that this specific war with Iran will mark a before and after in world history, in general terms, is the transition of the United States and North America from a global hegemonic power to a hegemonic power in the Western Hemisphere of the world.

Understand the West now specifically as a geographic concept, from the Greenwich Meridian to the left (west); we see a Trump, the United States of America, that hasn’t even been able to lead its most faithful friends around the world, namely the Asia Pacific countries that are most friendly with the United States, nor its major European allies.

So we also see that the United States has left its trusted countries in the region adrift, namely the petro monarchies. Therefore, everything would indicate that from this episode onward we would be precisely in this transition of a United States and North America with global hegemony after winning three world wars to a United States that will be confined to a specific geographic space.

I also want to really emphasize the discrediting that Donald Trump suffered as leader of the United States of North America by contradicting himself so many times and having a totally childish attitude when communicating, trying in a clownish way to push the idea that they won a war against Iran, when clearly that wasn’t the case.

That’s on one hand. Then, on the other hand, we also have to highlight Iran’s ability to defend itself in asymmetrical terms.

And finally, a very important issue, something I’ve mentioned on several occasions, which is the fact that everything seems to indicate that the date of the soccer World Cup would serve as a kind of chronological limit for US military activities in West Asia.

I think this should always have been taken into account, and clearly we’re getting closer to the Western Soccer World Cup, and we see the United States being a bit quieter in this regard. That doesn’t mean things will stay this way permanently, but for now, as we approach the soccer World Cup, hostilities are gradually ceasing.

It truly would have been insane for the United States of North America itself to take on an event so important for the entire world, not just for us Argentineans who like the Soccer World Cup, but for the world in general, while having a war against one of the regional powers, namely the Islamic Republic of Iran, and I believe that’s one of the most important points; we need to start understanding Iran as a regional power, without a doubt.

Leandro Bracamonte, Iranologist

The New York Times says that to definitely and officially place the US as an empire in decline, attacking Iran was a very serious mistake. That’s what this newspaper is projecting, a newspaper that can be accused of many things, but certainly not of not being part of the US establishment.

The Islamic Revolution Guards Corps (IRGC) says it has successfully hit a US Air Force F-35 stealth fighter jet in central Iran’s airspace.

How do you see this issue?

As for a mistake, I don’t see it that way. It’s already the consequence of many phases, four phases. We’re talking about categorizing the decline of the United States as a society, as a government, as a country.

Let’s start with the first phase, let’s call it a golden age, which was its beginning as a nation, as a society built on the foundation of Protestantism that promoted Bible reading, literacy, and skilled labor. In other words, it brought about a huge, huge advance. Let’s say that’s where the road was mapped out, the road was laid, the foundations were set, the fundamentals were put in place.

Then comes what is known as the zombie state, or zombie religion, that is, the structures remained, but the people were left with the inertia of moral values; respect, love, helping others, community.

Why? Because those were values learned from those who started that early form of Christianity back in their time, but there was no religion anymore. There was no longer a personal relationship with God, just moral values, and in fact, according to some authors, this lasted until the post-war period.

That was its boom, its peak, but from there we enter what is called the zero state.

In the zero state, we see the absence of values, the absence of respect, the absence of love, the absence of collectivism, no helping the neighbors, no loving the neighbors, and we enter into individualism.

So then, instead of having a kind of open arms attitude toward everyone else, supporting and helping, it became a situation of individualism, and it permeates all of society. That’s what’s known as the zero state, the absence of values.

After that comes nihilism. What is nihilism? It’s the reaction to the zero state. It’s the worship of emptiness.

There’s no respect anymore, no values anymore, nothing, but I’m comfortable. I love that state. It’s something that helps me, and that’s where we enter into the topic of destruction.

That’s where we enter into the topic of war. That’s where we enter into wanting to destroy others.

And here I would add that between the zero state and nihilism lies the phase of Procrustes.

What is Procrustes? Procrustes comes from Greek mythology, a figure used to describe an idiot.

In ancient Greece, there were the idiots, people who only worked for themselves. They didn’t get involved in political life or social life, they simply lived their private lives from the doors of their home inward.

In fact, there is a definition of idiot that says one who thinks only for himself. That’s how idiot is defined.

Now, where does this align with the mythology of Procrustes?

Procrustes was a giant who had an inn, a little hotel, and he had beds. But what did this Procrustes do? He put short people in large beds and tall people in small beds. For what purpose? The short ones he would chop up and stretch to fit them into the bed. The tall ones, he would chop up and shrink them.

And that is the attitude of an idiot. My point of view must prevail and must count. What I say must be done.

Is Trump an idiot? Exactly, he’s an idiot because he wants to impose his values, or his anti-values, his anti-values, obviously, because from his point of view it’s the right thing to do.

So, between what is called the zero state, which is the absence of values, and nihilism, which is the worship of what is no longer there, of emptiness, of the void, of meaninglessness.

So we are in the stage of Procrustes, which says what I say goes. I either stretch you or I shrink you. And we enter the second phase, which is nihilism, where war comes. That’s when the ax blow comes, and I’m going to impose war, and I’m going to impose my tariffs, and I’m going to impose my taxes, and I don’t care what you say. That’s the idiot at its fullest expression. We are already at that stage.

That’s why this war isn’t going to stop anymore. It’s the war of idiots. The idiots are the ones in the Pentagon; the idiots are the ones who are there. Now, this is the phase of the West, of Western Christianity, of society.

But, speaking, for example, of Russia, China, other countries, they are at the base in what is called the Zombie Stage.

Why? The Zombie state, and I’m not the one saying this, even though it sounds a bit like a Santos movie, is a definition from a demographic historian, Manuel Todd. And he considers himself a zombie atheist. He’s someone who grew up with values, even though he doesn’t profess any religion. He’s an atheist, but values that proclaimed him, that promoted him.

He says that Russia and China are in that state. They still have values, maybe they don’t have a true communion with God as such, but they have their inherited values that come from their ancestors, from their grandfather, from their father, etc.

So he says, but since the United States is already in the Procrustes stage and is already swinging the ax blows, because it wants to fit everything into its own way of being. Either I cut you and shrink you, or I cut you and stretch you. That’s why we are already in this situation.

Pastor Javier Soria Herrera, Political Analyst

The factors of the decline of the American empire, as set out by the New York Times, are internal, external, and how do you see the situation?

Well, there’s a broad issue to address and work through. I think that to complement what Pastor is saying, I’d like to propose a reading. There is a very, very good author, a Frenchman from the last century, who wrote his first book in 1921, his name is Rene Guynen.

This French author has two very interesting theses. One of them is the crisis of the modern world. Within this thesis, actually, it’s a short book, and he didn’t define himself as a philosopher or a thinker. Quite the opposite, he broadly criticizes the concepts we have rooted in Western culture as philosophy.

In the book, ‘The Crisis of the Modern World’, he comments on how what we understand today as the West has the particular anomaly of being an anti-civilization.

 In other words, what Pastor was commenting on very well, this issue of the tendency toward individualism, breaking with the collective conception of humanity, is one of the most important reasons why the United States, in some way as the absolute representative of Western civilization as we understand it, is heading toward a quagmire with no way out regarding an existential issue that runs much deeper.

Facing this, we have what Donald Trump’s leadership was. First of all, who is he? He’s a person who enriched himself through prostitution, and noticed something that happened just a few days ago. This issue that the new right communicators always tried to present Donald Trump as a kind of Christian leader, and now Donald Trump has just decreed a national Shabbat for the United States of North America.

Surely, Pastor can explain that better than I can.

Even though Christianity was born in an environment strictly rooted in the Hebrew tradition, Judaism and Christianity as a religious phenomenology after Jesus Christ, this is important to understand, Rabbinic Judaism came after Jesus Christ.

They are contradictory traditions.

So, notice what kind of situation we’re talking about. Facing this, we also have the not minor detail of the Islamic Republic of Iran, a very important detail that many people overlook, the martyrdom of Ayatollah Sayyed Ali Khamenei.

It’s extremely important to understand this, because for Iranians and for all Shiites around the world, it is the realization of the epitome of an essential archetype within the tradition of Shiite Islam, sanctity through martyrdom, that Ayatollah Khamenei achieved this, and at the hands of whom, above all, is truly a validation of the entire 30 plus years of preaching of Ayatollah Khamenei as leader of the Islamic Republic of Iran.

When many believed it was a death blow against the system of the Islamic Republic of Iran, quite the opposite; it is the eternal validation of the preaching of both Imam Khomeini, the founder of the Islamic Republic of Iran, and Ayatollah Khamenei.

Leandro Bracamonte, Iranologist

We see the decline in the last two presidents. Of course, we are clearly not going to praise Barack Obama at all, but it seemed like there was a renaissance of many things, full of energy, yet in the end he destroyed several countries in West Asia while he was president.

But then suddenly comes a decrepit figure like President Biden, who greeted ghosts and did weird things, and who was preparing an attack on Iran if he had been re-elected, according to one of his main advisors recently and officially, and then along comes Trump, with no respect, even for basic decency.

This may be taken as an unmistakable cycle in the decline of the American empire on a global level. What do you think?

No, in fact, during Barack Obama’s administration, one of his advisors, I can’t remember his name, coined a word, the blob.

What is the blob? It’s a parasite, or rather; it’s a single-celled organism that has no brain. The only thing it does is eat. It expands and eats, that’s all it does, eat. But even though it has no brain or nervous system, it has intelligence, because you can put it in a maze and it will find the shortest path to the food.

Well, that term was coined by one of Barack Obama’s advisors, applying it to the political class, to the senators, to all that bureaucracy.

They’re saying you guys have no brain, you just exist to eat, so it’s understood that this blob, that situation is like a kind of, in fact, the definition is a stain, a thing, a stain, but it starts, and then it grows, so from there it began.

Then came the next administration, Biden, then the next one, and that blob has already spread. It has started back there, and that’s where this guy baptized it. He says that’s how we are.

So, this is a voracious thing of disrespect, of lack of intellectuality. It’s an homage to individualism, as I was saying earlier, to idiocy, and they’re happy about it. They’re in love with it. It’s truly incredible.

Let me quickly recount the four phases I mentioned.

First, what was built? Well, that’s the first phase. Second, what was inherited, because it was inherited. … Then third, what was lost, the absence, and since it’s already lost, well, then I snatch it from you.

I take it away from you, and we are already entering that phase. Now I’m going to snatch it from you, because I no longer have it. I already lost it, I mismanaged it, I ruined it, my values, moral and material, etc. etc.

Now I’m taking it from you, since I’m going to snatch it from you. Well, then I’m going to make war on you, because we need it. It’s that voracious thing that keeps growing, that single-celled organism without a brain that expands and does nothing but eat. It’s a kind of imperial vampirism.

Pastor Javier Soria Herrera, Political Analyst

And what role does Israel play in all of this?

Right now, Israel is jumping for joy. I mean, it’s obvious it didn’t have the capacity to confront Iran militarily. It just didn’t have it, and it’s simple logic.

Israel is a tiny entity. Anywhere Iran fires, it’s going to hit, because everything is contained, so it doesn’t have the capacity to fight. Obviously, that’s why it wanted to bring the United States in.

So, in the end, if the Persian Gulf is destroyed, if the Arab nations are destroyed, if the United States itself falls, it’s jumping for joy.

Even the rabbis themselves, the Orthodox rabbis over there, they say we are against the West, and for them the West is Christianity, and for them Christian West is backed by the head that is called the United States. They say it has to fall, and it will fall.

Because from their point of view, their famous Messiah has to come and we’re their Messiah. Why? Because for that Messiah to emerge, war has to come, and the United States has to fall.

Pastor Javier Soria Herrera, Political Analyst

Well, it seems like they’re making it fall on purpose. Oh, yes, because it’s a controlled demolition of the United States to enforce their plans.

They have already grabbed onto their idiot. But speaking of Trump, it’s not just him, it’s the system, it’s the society.

He is simply a pawn. I mean, it’s the system, it’s the complete absence of values, respect, morality, good customs.

Pastor Javier Soria Herrera, Political Analyst

“The crown of pride, the drunkards of Ephraim, shall be trodden under feet” Isaiah 28:3
“You only have I known… therefore I will punish you” Amos 3:2
“Ephraim shall be desolate in the day of rebuke… ” Hosea 5:9
“And I will cast you out of My sight… even the whole seed of Ephraim” Jeremiah 7:15

A Critique of Fred Coulter’s Pentecost 

•June 7, 2026 • Leave a Comment

A Critique of Fred Coulter’s Pentecost 

Count to  Pentecost — From the Morrow After Which Sabbath by Fred R Coulter

Christian Biblical Church of God
P.O. Box 1442
Hollister, CA 95024-1442

Fred R Coulter, a graduate of the defunk Ambassador College

Pentecost, Feast of Weeks, Feast of Firstfruits, Wave Sheaf, Omer, Passover

Wave sheaf – is this the Omer to be offered? For English speakers, this surely is.

This is a critique of Fred Coulter’s Pentecost, also known as the Feast of Weeks or the Feast of Firstfruits, Shavuot.

The Counting to Pentecost is an extremely interesting subject and we’ll follow it in every key issue discussed. Included are some issues on the Passover, are also critiqued, which is part of an earlier Fred Coulter’s Passover series (A Study Index of Fred Coulter’s Passover).

Quoted are Fred’s work from a PDF version from his website. They are indented, in PINK, and in block form so as to differentiate his from other comments. The Scriptures, in RED, must be our primary focus and guide, and sometimes the Scriptures, which include the Septuagint and the Targum, say things very different from what we think! 

And so with that in mind, we’ll begin:

Chapter One

In The Holy Bible In Its Original Order, these verses have been properly translated so that it is clear and the wave sheaf offering day itself was, in fact, the 1st day of the 50-day count to Pentecost. It reads: “Speak to the children of Israel and say to them, ‘When you have come into the land which I give to you, and shall reap the harvest of it, then you shall bring the premier sheaf of the firstfruits of your harvest to the priest. And he shall wave the sheaf before the LORD to be accepted for you. On the next day after the Sabbath the priest shall wave it…. And you shall count to you beginning with the next day after the Sabbath, beginning with the day that you brought the sheaf of the wave offering; seven Sabbaths shall be complete; even unto the day after the seventh Sabbath you shall number fifty days. And you shall proclaim on the same day that it may be a holy convocation’ ” (Lev. 23:10-11, 15-16). (Count To Pentecost From the Morrow After Which Sabbath by Fred R. Coulter, pg 1)

Fred Coulter would be using his translation, The Holy Bible In Its Original Order, or the “Faithful” Version, but unsure of his Hebrew proficiency I’ll compare his translation with KJV, KJ21, the Masoretic version, the Septuagint, or the Targum.

The Pharisaic Method of Counting to Pentecost

When the Pharisaic Jews reinterpreted God’s commands for the wave sheaf offering, they began the count to Pentecost from the day after the annual Sabbath of Nisan 15, which may fall on any day of the week, instead of counting from the first day of the week—the day after the weekly Sabbath—during the Feast of Unleavened Bread. This change was apparently made to solve the problem caused by the elimination of Nisan 14 as the Passover day. Since the Pharisaic Jews had ceased to observe Nisan 14 as part of the spring festival season, they could not use that day in determining the correct day for the wave sheaf offering. Thus, when Nisan 14 fell on a weekly Sabbath, the only weekly Sabbath they could use [to count] was the following weekly Sabbath which fell on Nisan 21, the annual holy day which ends the Feast of Unleavened Bread. But if the wave sheaf were offered “on the day after” the last day of the Feast of Unleavened Bread, the Wave Sheaf Day would fall on the first day of the week outside the Feast of Unleavened Bread. The Wave Sheaf Day must always fall within the seven days of the Feast of Unleavened Bread. It is contrary to Scripture to place the Wave Sheaf Day outside of the Feast of Unleavened Bread. (Pg 4)

Fred Coulter’s quick jump into the word “reinterpreted” is not just being misguided for himself but misleading to those who follow him. Where is his proof? He has already established his conclusion before he has even started. What really happened is that wherever the Scriptures in the Torah appear contrary, they need to be read and interpreted taking all related Scriptures as a whole. The existence of an oral law was deduced from the character of the written law as well as of the other books of the Torah and the Prophets.

Many of the Mosaic laws are worded very briefly, and some are almost unintelligible without certain presuppositions which were assumed to be generally held, like circumcision (where and how to cut); and a few other examples that seem to contradict one another, for example, on the Sabbath day “let no man go out of his place” Exodus 16:29 and Leviticus 23:3, where ye are to have “an holy convocation.”

If the written Torah is regarded as a complete code, it must be assumed that on certain points some of the laws supplement the others, so that the written law might be interpreted in a way that makes sense as a whole. It makes no sense to attend Sabbath and yet not allowed to leave ones home. So a Sabbath boundary was established and defined roughly as a distance of about 2000 cubits (about 1km) as measured from the edge of a settlement to all directions as one could venture out of his/her home, known as a Biblical mile.

Second, the Pharisaic Jews had never ceased to observe Nisan 14 as part of the spring festival season. This is a blatant lie. In fact the Pharisees used the spring festival, the “morrow after the sabbath” which is the day the wave sheaf offering were made, that we start to count toward Shavuot, or the Feast of Weeks. That is, all the annual feast days are related. The weekly Sabbath runs on its own and has no relation to the annual Holy Days, but the Sadducees had made them seem so.

Third, Fred Coulter has got confused with his own writings. The second half of the above quote (starting with “Thus” to the end) is a problem about counting toward Pentecost “when Nisan 14” fell the weekly Sabbath. When the high day falls on the weekly Sabbath it becomes a problem, because then which weekly Sabbath is to start the count, since there are two weekly Sabbaths that qualify. The problem is that different CoGs have different interpretations. This problem is only confined within those who use the Sadducaic interpretation. But for the Pharisees and Rabbinics, when the weekly Sabbath fell during the month, it has no bearing in determining which day to start counting Pentecost.

To solve this problem, the Pharisaic Jews decided to reinterpret the meaning of “the morrow after the [weekly 7th day] Sabbath.” They transferred the meaning of the word ha shabbat—“the Sabbath” in Leviticus 23:11—from the weekly Sabbath to the first holy day of the Feast of Unleavened Bread, Nisan 15. It is true that Nisan 15 is an annual Sabbath, shabbat, but ha shabbat which always refers to the weekly Sabbath. According to this Jewish reinterpretation, the day after Nisan 15 is Nisan 16, which to them became “the morrow after the Sabbath.” As a result, the Pharisaic Jews always begin their count to Pentecost with Nisan 16—regardless of the day of the week on which it falls. (Pg 4-5)

 Abraham Geiger (1810 – 1874)

Again, the Pharisees didn’t “reinterpreted” God’s commands for the wave sheaf offering in any of their writings as Fred Coulter alleges. The Samaritans were the ones to reinterpret the Scriptures, though it was first started by King Jeroboam of the Northern Kingdom, spearheaded by those with the Birthrights — Ephraim and Manasseh. The Rabbinics have their Scepter, their Oral Law which were written into the Scriptures, the Vowels.

Fred’s assertions are gathered mostly from the Reform Judaism or Liberal Judaism writers who were keened to avoid the “bondage of Judaism.” Started by Abraham Geiger (1810 – 1874) in Germany, they succumb to the Samaritan narratives in how the Torah should be interpreted. These Reformers believe in “a process of constant evolution” and “rejects any fixed, permanent set of beliefs, laws or practices” in the age of emancipation. They stated that the old mechanisms of religious interpretation were obsolete and sought a more coherent ideological framework to justify innovations in the liturgy and religious practice.

The Septuagint, one that the NT writers most often used, translates “the day after the sabbath” as “on the morrow of the first day.” Is this “first day” the weekly sabbath? Obviously not. It is the first day of the Days of Unleavened Bread. If we follow the Saddusaic reasoning, then the counting of the omer would begin on Monday, the day after “the first day” i.e. Sunday. 

The Hebrew translators of the Septuagint knew that the omer counting began after the first Day of Unleavened Bread on the 16th of Nisan. Most New Testament writers had relied much on the Septuagint when quoting the Old Testament, and is a great testimony to clarify “the morrow after the sabbath” to mean the first Days of Unleavened Bread. Hence the count is always on the 16th of Nisan.

Besides the Masoretic Text and the Septuagint, another source of our Scriptures is the Targum. And note the Targum portion in Leviticus 23:9-16 is even more clear:

And the Lord spake with Mosheh, saying: 10 Speak with the sons of Israel, and say to them: When you have entered into the land which I give you, and you reap the harvest, you shall bring the sheaf of the first fruits of your harvest unto the priest; 11-13 And he shall uplift the sheaf before the Lord to be accepted for you. AFTER THE FIRST FESTAL DAY OF PASCHA (OR, THE DAY AFTER THE FEAST‑DAY OF PASCHA) on the day on which you elevate the sheaf, you shall make (the sacrifice of a lamb of the year, unblemished a burnt offering unto the Name of the Lord . . . 

AND NUMBER TO YOU AFTER THE FIRST FEAST DAY OF PASCHA, from the day when you brought the sheaf for the elevation, seven weeks; complete they shall be. 16 Until the day after the seventh week you shall number fifty days, and shall offer a mincha of the new bread unto the Name of the Lord. (Leviticus 23:10-16, Jonathan)

The Targum, a translation and interpretation started by Ezra for the returning Jewish exiles, makes it absolutely explicit. The Aramaic interpretation confirms the Septuagint translation “on the morrow of the first day” as “on the morrow after the first day,” which is the sixteenth. Have anyone wonder why the end-time church is described as “wretched” and “blind” and “naked”? 

In ancient times, not all Jews followed the Pharisaical method of counting to Pentecost. The Jewish sects known as the Essenes and the Sadducees used different methods. The Essenes were an ascetic sect that combined Judaism with pagan sun worship and lived in monastic religious communities. Because of this strange mixture of sun worship and Torah law, they always counted Pentecost improperly. They reckoned the last holy day of the Feast of Unleavened Bread, Nisan 21, as the Sabbath for beginning the count. As a result, the first day of their count was always Nisan 22—the day after the last day of the Feast of Unleavened Bread. Because they began their count on Nisan 22, their Pentecost always fell on the fixed date of Sivan 13. (Pg 5-6)

The Essenes were indeed sun-worshippers. This Qumran community has their own 364 day solar (and no regards to the moon) calendar which were totally at odds with the calendrics of the Sanhedrin. Their sacred year always began on the vernal (spring) equinox and is, by definition, Wednesday (because, they believed, God Created the “lights in the firmament” for “signs and seasons” on the 4th Day), and hence the 1st day of the 1st month (Nisan or Abib).

For more details about the Essenes, see Sects and Cults (Essenes)

Consequently, the Essene Passover will always begin Tuesday, on Nisan 14 at 6 PM. The key point being Essene Passover always began “Tuesday” evening, 13 days after the vernal equinox. Basically, the Essenes would mark the vernal equinox and, no matter what day came before, declare it as Wednesday, 1 Nisan—their New Year.

Interpreting their calendar from the Book of Jubilees 6:1-38, their 12 months were either 30 (for 8 months) or 31 days (for 4 months). Meaning, they didn’t follow the phases of the moon. Essenes also celebrated each Equinox and Solstice on the first day of those months (the 1st, 4th, 7th and 10th months).

The Essenes calendar had a year of 364 days. The first day of the first month always begins at sunset on Tuesday evening following the vernal equinox. Their counting — counted from the first Sunday after the Feast of Unleavened Bread — the offering of the wave sheaf (Leviticus 23:11) always fell on Sunday the 26th of their first month. Consequently after 50 days the day of Pentecost is set on Sivan 15 (not 13th as Fred quoted above, a show of his shabby understanding and research), and is always on a Sunday in their third month. 

While the Pharisees and the Essenes based their counts on the holy days, which were annual Sabbaths, the Sadducees followed the biblical injunction to begin to count to Pentecost “beginning with the next day after the weekly Sabbath. The priests and the high priests who were in charge of the temple during Jesus’ physical life were Sadducees. They did not set a fixed date for Pentecost because they based their count on the weekly cycle, as God had commanded. When a weekly Sabbath fell on any of the first six days of Unleavened Bread, they began counting to Pentecost from the day after that weekly Sabbath—the first day of the week. But a problem arose in years when the weekly Sabbath fell on the last day of Unleavened Bread. In the following chapter, we will examine this problem and learn why “the day after the Sabbath” is always the first day of the week during the Feast of Unleavened Bread. (Pg 6)

Typical of all those who studied and graduated from Ambassador College, they made their conclusion first, then they worked backward. In his excitement, Fred Coulter jumped the gun, putting the cart before the horse! Correction, “the Sadducees followed the Samaritans (not biblical) injunction to begin to count to Pentecost “beginning with the next day after the weekly Sabbath.”

Josephus, the first century Jewish historian, was himself a priest and a Pharisee. In his Antiquities of the Jews, he informs us that the Pharisees were the dominant religious party in Judaea during the time of Christ, and that they controlled the worship services. 

Now, for the Pharisees, they live meanly, and despise delicacies in diet; and they follow the conduct of reason; and what that prescribes to them as good for them they do; and they think they ought earnestly to strive to observe reason’s dictates for practice. They also pay a respect to such as are in years . . .  on account of which doctrines they are able greatly to persuade the body of the people; and whatsoever they do about Divine worship, prayers, and sacrifices, they perform them according to their direction (Antiquities 18,1,3).

The common people followed the Pharisees. And although the Sadducees were occupying the upper stratum of the Jewish aristocracy, they were few and unable and unwilling to carry out their own beliefs in the Temple service, but to carry out “the notions of the Pharisees:”

But the doctrine of the Sadducees is this: That souls die with the bodies; nor do they regard the observation of any thing besides what the law enjoins them; for they think it an instance of virtue to dispute with those teachers of philosophy whom they frequent: but this doctrine is received but by a few, yet by those still of the greatest dignity. But they are able to do almost nothing of themselves; for when they become magistrates, as they are unwillingly and by force sometimes obliged to be, they addicted themselves to the notions of the Pharisees, because the multitude would not otherwise bear them. (Antiquities 18,1,4)

The Unger’s Bible Dictionary tells us further political-religious amalgamation called the Sadducees:

“Their political supremacy was, however, of no long duration. Greatly as the spiritual power of the Pharisees had increased, the Sadducean aristocracy was able to keep at the helm in politics. The price at which the Sadducees had to secure themselves power at this later period was indeed a high one, for they were IN THEIR OFFICIAL ACTIONS TO ACCOMMODATE THEMSELVES TO PHARISAIC VIEWS. With the fall of the Jewish state the Sadducees altogether disappear from history. Their strong point was politics. When deprived of this their last hour had struck. While the Pharisaic party only gained more strength, only obtained more absolute rule over the Jewish people in consequence of the collapse of political affairs, the very ground on which they stood was cut away from the Sadducees” (“Sadducees” page 1506).

The Talmud records such an instance, when a Sadducee attempted to circumvent a procedural ruling of the Pharisees concerning the high priest entering the Holy of Holies and offering incense. The Talmud shows that the Pharisees came to require that a sitting high priest who was a Sadducee give an OATH that he would perform the ceremony according to Pharisaical teaching. 

         Says the Talmud:

“There was an incident involving a certain Sadducee who was appointed as High Priest, who prepared the incense outside and then brought it into the Holy of Holies. Upon his emergence he was overjoyed that he had succeeded. The father of that Sadducee met him and said to him: My son, although we are Sadducees and you performed the service in accordance with our opinion, we fear the Pharisees and do not actually implement that procedure in practice. The son said to his father: All my days I have been troubled over this verse: “For I will appear in the cloud above the Ark cover” (Leviticus 16:2). The Sadducees interpreted this verse to mean that God will appear above the Ark cover, i.e., will enter the Holy of Holies, only after the incense cloud is already there. I said: When will the opportunity become available to me, and I will fulfill it according to the Sadducee interpretation? Now that the opportunity has become available to me, will I not fulfill it?”

“The Sages said: Not even a few days passed until he died and was laid out in the garbage dump, and worms were coming out of his nose in punishment for his actions. And some say that he was struck as soon as he emerged from the Holy of Holies,. . . A type of sound was heard in the Temple courtyard, as an angel came and struck him in the face. And his fellow priests came in to remove him from there and they found the likeness of a footprint of a calf between his shoulders. That is the mark left by an angel striking, as it is stated with regard to angels: “And their feet were straight feet, and the sole of their feet was like the sole of a calf’s foot” (Ezekiel 1:7), (Talmud, Yoma I9b).

High priests, showing the ephod and linen robes - Stock Image - C042/7458 -  Science Photo Library

Although the High Priests were often from the Sadducees, Josephus had testified they were under the authority and supervision of the Pharisees and were rigorously taught and trained and required to perform every act of worship according to the dictates of the Pharisees. The people feared that if the High Priest offended the Most High in any way, while in the Holy of Holies, he might never come out alive again. Therefore a rope was tied to his ankle, so that just in case something went wrong, and he stayed in the Holy of Holies much too long, they could pull him out with the rope! 

And finally, the Sadducees were all dead from the AD 70 inferno: John the Baptist warned in Matthew 3:11 “I indeed baptize you with water unto repentance, but He that cometh after me is mightier than I, whose shoes I am not worthy to bear. He shall baptize you with the Holy Spirit and with FIRE.” 

If the AD 70 inferno is a microcosm for the CoG Communities of the Great Tribulation to come, what would stop these resurfaced “Sadducees” from disappearing into another end-time inferno?

Shall a trumpet be blown in the city, and the people not be afraid? Shall there be evil in a city, and the LORD hath not done it? Amos 3:6

Chapter Two

Like the Jewish sects of old, Christians today, hold differing interpretations of God’s instructions for counting to Pentecost. While most follow the scriptural injunction to count beginning the next day after the weekly Sabbath, sometimes there is disagreement as to WHICH weekly Sabbath is the correct Sabbath. (From the Morrow After Which Sabbath by Fred R. Coulter, pg 7)

This is very true, which weekly Sabbath, one is as good as the other. In singling out one, we read all the human reasoning above, but there is not a single scripture to back up any statement. This is only a doctrine of man. The real problem is that there are over 50 weekly sabbaths during the year, why choose one instead of another? 

This conflict of opinion is greatest in years when the Passover day—Nisan 14—falls on the weekly Sabbath. When this occurs, the first holy day of the Feast of Unleavened Bread— Nisan 15—falls on Sunday, the first day of the week. When the first day of the Feast of Unleavened Bread falls on Sunday, the seventh day of the feast falls on the next weekly Sabbath. In this sequence of days, the only weekly Sabbath during the Feast of Unleavened Bread is the last day of the feast—which would cause “the day after the Sabbath” to fall outside the feast. Therefore, the critical connection that God established between the Wave Sheaf Day and the Feast of Unleavened Bread is severed. Yet some Christians follow this practice because they believe that the Wave Sheaf Day must always follow the weekly Sabbath that falls during the 7 day Feast of Unleavened Bread. (Pg 7)

The above quote “between the Wave Sheaf Day and the Feast of Unleavened Bread is severed’ is partially correct. It should be, “between the Wave Sheaf Day and the Passover is severed,” because the acceptance of the firstfruits of humans by the Father could only arrive after the partaking of the Sacrifice of the Blood of the Lamb.

Again, this is a typical doctrine of man, and what they do year after year becomes a tradition, not a single Scripture is quoted to back up any statement. Outside of the written word of God, men wonder with all sorts of new ideas. Beginning with Jeroboam, they started with changing the feast days, with two different places of worship, Dan and Bethel, but proclaimed the same old maxim: “Behold, these are your gods, O Israel, who brought you up out of the land of Egypt.”

When we understand the full meaning of the wave sheaf offering, all confusion concerning the determination of the Wave Sheaf Day is eliminated. The offering of the wave sheaf in Old Testament times on the first day of the week during the Feast of Unleavened Bread foreshadowed the acceptance of Jesus Christ by God the Father as the First of the firstfruits after His resurrection from the dead. Thus, in order to understand the ultimate fulfillment of the wave sheaf offering, we must go to the New Testament. (Pg 7)

Although the New Testament could add further meaning, the people during Old Testament times should be able to understand how to count during their days, rather than waiting one and a half thousand years later. During Ezra’s time, the returning Jewish exiles understood this ambiguity when their Aramaic interpretation confirms the Septuagint translation “on the morrow of the first day,” as the day “after the first day of Pascha.” Why are the end-time churches so presumptuous to think they are so much better than Ezra when these end-timers are described as “wretched” “blind” and “naked”?

When we accept this biblical truth, we are acknowledging the true Wave Sheaf, Jesus Christ, Who ascended to God the Father and was accepted on that day. No other day can commemorate His fulfillment of the offering of the wave sheaf. Some Christians have not understood this truth because they were taught that the Wave Sheaf Day must follow the weekly Sabbath which falls during the Feast of Unleavened Bread. (Pg 9)

Most in the CoG Communities believe that the wave sheaf represents Christ. In fact, they accepted this as truth and then awkwardly worked backward. Any Scriptures that contradict them are either ignored or discarded. First Christ is always represented by the Lamb. If the wave sheaf represents Christ, who represent the priest? In the most critical Scripture, the lamb is mentioned alongside with the ‘sheaf’ in Leviticus 23 but most have chosen to ignore its presence:

Leviticus 23:11 And he shall wave the sheaf before the Lord to be accepted for you; on the morrow after the Sabbath the priest shall wave it. 12 And ye shall offer that day when ye wave the sheaf A HE LAMB without blemish of the first year for a burnt offering unto the Lord. Leviticus 23:11-12

Second, there are numerous problems to identify Christ as the “wave sheaf” above. If the wave sheaf represents Christ, then what did the “he lamb” represent in Leviticus 23:12?

And if this he lamb represents Christ, then why was this he lamb wasn’t waved?

. . . and if waving means going up to heaven and back, then why the 3000 on Pentecost (Acts 2) didn’t similarly go up to heaven as they were also waved (Leviticus 23:20), each should be warning the others “don’t touch me” along the way up and back from heaven on that day of Pentecost, wouldn’t they?

William Tyndale Valued The Bible—Excerpt | JW.ORG Videos
William Tyndale (1494 – 1536)

Lastly if that he-Lamb were to represent Christ, then the wave sheaf must be representing something else, the human saints. The “wave sheaf” is made of MANY grains from a BUNDLE of barley grains. This could only represent human beings, rather than Christ, and that humans need to go through numerous trials and testings, to be acceptable before God. The high priest represents Christ, who does the wavings and mediates for us.

Finally, if there is anything from Christ that is acceptable to the Father, it is not grain, nor firstfruits, but his blood, symbolized by the shedding of blood and presented on the Mercy Seat in the Holy of Holies on the Day of Atonement.

Also, as good an intention William Tyndale may have, “wave sheaf” as translated into our English Language gives a misconception, so is “firstfruits” plural. It is “omer” in Hebrew, a finished product (grains that had been thrashed, dried and roasted, and only a tenth part taken), now a tenth of this is called the omer and given the the priest, who laced it with oil and frankincense, becoming a baked cake, before waving it before the altar, not some freshly cut grains from the field, which is misleading. A leading figure in the Protestant Reformation, Tyndale had his translations heavily influenced by the works of Erasmus of Rotterdam and Martin Luther i.e. anti-Jewish and biased toward Catholic and Protestant dogma. His work was later plagiarised for subsequent English translations, including the Great Bible, the Bishops’ Bible and in 1611, by the 47 scholars who produced the King James Bible.

This is from the Jewish Encyclopedia

Omer: Manner of Waving the Omer

After the grain had been gathered it was brought to the courtyard of the Temple, where, it was first thrashed and then parched (dried and roasted over a fire). The grain was ground into coarse meal and then sifted through thirteen sieves until it became very clean, after which the tenth part was taken, the measure of the ‘omer, and given to the priest. The priest proceeded with the ‘omer as with any other meal-offering: he poured oil and frankincense over the meal, “waved” it, and then burned a handful of it on the altar; the remainder was eaten by the priests. The “waving” was done in the following way: The offering was placed on the extended hands of the priest, who moved them backward and forward and then upward and downward. As soon as the ‘omer ceremony was completed the people of Jerusalem were permitted to eat of the newly harvested grain; people of towns far from Jerusalem might not do so until after noon, when it was certain that the ceremony at Jerusalem had been gathered.

Sieving the Omer by the priests on the eastern side of the Temple courtyard
An omer is a unit of weight, approximately 3.5 to 4 pounds (1.5 to 1.8 kilos)

Earlier, the “wave sheaf” as firstfruits, must be reaped by three persons, each with his own sickle and basket, until each had his basket full. They then brought them to the courtyard of the Temple to be thrashed and parched and then to go through ALL of the thirteen sieves until it became very clean, and only one tenth the measure of the ‘omer’ were selected. 

Being thrashed and parched symbolized trials and challenges, and only humans were expected to endure numerous tests along the way. Only ten percent of an ephah (about 40 litres or 9 gallons) or about 1.5 to 1.8 kilo in weight, were chosen while the other ninety percent were rejected, but could be redeemed and eaten even by laymen; these ninety percent, so to speak, fell by the wayside. 

Thus the “wave sheaf” analogy doesn’t fit the role of the Messiah where ninety percent were rejected. Leviticus 27:32: “a tenth shall be holy unto the Lord.” Our Messiah has a far higher role; He was the sacrificial lamb, unblemished. His death at 3PM at Calgary was accepted immediately when thunder and earthquake displayed God’s eminence, and “the sun was darkened” Luke 23:44–45

“And behold, the veil of the temple was rent in two from the top to the bottom, and the earth quaked and the rocks rent.
And the graves were opened; and many bodies of the saints who slept arose”
 Matthew 27:51–52

In Summary, the Fourteenth marks the shedding of blood by the Lamb, the Fifteenth is the eating or partaking of the Sacrifice of the Lamb, leading to the Sixteenth, which, after trials and testings, begins the presentation of humans by a resurrected Lamb to the Father. Note that all these Critical Events are linked. And the Fiftieth is when the fullness of Pentecost has arrived.

And let’s continue with our Critique:

The New Testament reveals the fulfillment of the things pertaining to Jesus Christ which were prophesied in the Old Testament. When we understand the New Testament fulfillment of the wave sheaf offering by Jesus Christ, we can understand why God commanded that the first of the firstfruits, the premier sheaf, must be waved and accepted during the Feast of Unleavened Bread. (Pg 8) 

Here, as in Leviticus 23:11-12, the “firstfruits” or “wave sheaf” (omer) and the Lamb are shown to be TWO DIFFERENT entities. The “firstfruits” went through thirteen sieves to make it into a omer, these could be best explained as the elects were drawn from the thirteen tribes of Israel. These are the firstfruits; these are144,000 of Revelation 7

And I heard the number of them that were sealed: there were sealed a hundred and fortyfour thousand of all the tribes of the children of Israel. Revelation 7:4

The firstfruits are further explained and confirmed in Revelation 14

And I looked, and, lo, a Lamb stood on the mount Sion, and with him hundred forty and four thousand, having his Father’s name written in their foreheads. . . 4 These are they which were not defiled with women; for they are virgins. These are they which follow the Lamb whithersoever he goeth. These were redeemed from among men, being the firstfruits (G536 aparchē) unto God and to the Lamb. Revelation 14:1-4

Chapter Three

The account of the original Passover in the book of Exodus makes it clear that the Passover was both killed and eaten on the 14th day of the month. . . The lambs were roasted and eaten that same night, and any remains were burned before the morning of the 14th day. (From the Morrow After Which Sabbath, pg 11)

Passover is a sacrifice, an event, not a day. The Scriptures references of Passover as the sacrificial lamb are being made as follows:

(a) “to kill the Passover” — Exodus 12:21, II Chronicles 35:6;
(b) “to sacrifice the Passover” — Deuteronomy 16:2;
(c) “to roast the Passover” — II Chronicles 35:13;
(d) “to eat the Passover” — Exodus 12:43.

Passover isn’t a day; it’s a sacrifice. Passover occurred on a day, but it is not the day itself. You could kill a Lamb, but you couldn’t kill a day, neither could you sacrifice a day; neither could you roast nor eat a day! Coulter’s quote above is contrary to what the Targum says, which translates and explains the ordinances of the Passover from the Hebrew in Exodus 12:8 into the vernacular, in a very simple language that the people could understand: “And you shall eat the flesh on that night, the fifteenth of Nisan . . . Exodus 12:8 Jonathan

Ezra with the Exiles: “So they read in the book, in the law of God, distinctly, and gave the sense and caused them to understand the reading.”

In another way of saying: When the Exiles returned to Jerusalem, the Law was read by Ezra, verse by verse, and each verse was followed by a recitation by the Levites in the Aramaic language. 

So they read in the book, in the law of God, distinctly, and gave the sense and caused them to understand the reading” Nehemiah 8:8

John Gill comments on the above “they first read it in Hebrew, and then translated it into Chaldee, that the people might better understand it, being just come out of Babylon . . . not hereby how to read it, but chiefly to understand what was read, that they might clearly know their duty to God and men.”

The action of Ezra narrated in Nehemiah 8:8 implied not only the reading of the Law, but also the interpretation of its language — it is a translation from Hebrew to Aramaic, and that, further, this practice was long followed in all the synagogues among the returning Exiles in Judea. And they understand that the flesh eaten on that Passover night, was on the fifteenth of Nisan.

The account of the original Passover in the book of Exodus makes it clear that the Passover was both killed and eaten on the 14th day of the month. God commanded the children of Israel to kill the Passover lambs on the 14th at ben ha arbayim, or “between the two evenings” (Ex. 12:6). Other passages make it absolutely clear that this Hebrew term refers to the beginning of the 14th—after ba erev, or the sunset of the 13th. (Pg 11)

MAGIC! According to Fred Coulter, ben ha arbayim comes AFTER ba erev. If his sleepy theory is correct, then two lambs would be needed to be killed for the Passover, one for ben ha arbayim (Exodus 12:6) and the other to satisfy ba erev (Deuteronomy 16:6). One lamb definitely couldn’t fulfil two sacrifices, one after the other.

Fred Coulter’s analysis can only add confusion to more confusion. His definitions for ba·erev and ben ha arbayim are both sleights of hand! Suddenly from nowhere, you see two pigeons, out of the hands of Simon Magus. His non-thinking and sleepy faithfuls would always admire his skills with veneration and mesmerization!

For the rest of chapter 3 (pages 11-17; and again from chapter 4, pages 18-20), Fred went on to explain Matthew 26:17; Mark 14:12; Luke 22:17.

Matthew 26:17 Now the first day (G4413 protos) of the Feast of Unleavened Bread the disciples came to Jesus, saying unto him, Where wilt thou that we prepare for thee to eat the Passover?

The natural reading of this verse seems to suggest the disciples asked Jesus where to keep the Passover when Passover was already over. But G4413 protos could be translated as ‘a time before’ as in John 1:15 John bare witness of him, and cried, saying, This was he of whom I spake, He that cometh after me is preferred before me: for he was before G4413 me.

Thus Matthew 26:17 could be better translated as “Now before the Days of Unleavened Bread have arrived, the disciples came to Jesus, asking, Where shall we prepare for thee to eat the Passover?”  — the intention to eat the Passover was there, but the actual eating was yet to happen.   

Mark 14:12 And the first (G4413 protos) day (G2250 hemera) of Unleavened Bread, when they killed the Passover, his disciples said unto him, Where wilt thou that we go and prepare that thou mayest eat the Passover?

Same translation problem here. G2250 hemera could be translated as ‘a period of time or days’ as in Matthew 2:1 Now when Jesus was born in Bethlehem of Judaea in the days G2250 of Herod the king, behold, there came wise men from the east to Jerusalem.

So Mark 14:12 could well be translated “Now before the Days of Unleavened Bread, when they killed the Passover, his disciples said unto him, Where wilt thou that we go and prepare that thou mayest eat the Passover?” — the unleavened bread period was the time they killed the lamb. Yes the context of this question indicates that the time asked could be a couple of days before the fourteenth when they killed the lamb. And yes, the Passover was a composite festival in the NT (as well as the Old), also called Days of Unleavened Bread when the lamb was to be killed.

Same thing with Luke 22:7-8 “Then came (G2064 erchomai) the day (G2250 hemera) of Unleavened Bread when the Passover lambs had to be sacrificed. Jesus said to Peter and John, “Go and prepare the Passover meal for us to eat.”

G2064 erchomai could be translated “to come” or “to go” as in Matthew 2:2, 8. In Matthew 14:29 And he said, Come. G2064 And when Peter was come down out of the ship, he walked on the water, to go G2064 to Jesus.

Thus Luke 22:7-8 could be translated, “As the Days of Unleavened Bread were approaching when the Passover lambs had to be sacrificed, Jesus said to Peter and John, “Go and prepare the Passover meal for us to eat.”” — again, the intention to eat the Passover was there, but the actual eating had yet to happen.  

Chapter Four

When we examine all three Gospel records of Jesus’ instructions to His disciples, it is obvious that Jesus kept the domestic Passover on the 14th—“the first day of the unleaveneds.” (Count To Pentecost From the Morrow After Which Sabbath pg 19)

See the source image
Foot washing during Passover

If Jesus and His disciples had kept a “domestic Passover” they would have stayed back in Galilee, in their own homes as in the original Exodus. A “domestic Passover” would have to be kept in their houses “as commanded by God in Exodus 12.” So why did Jesus continue going to Jerusalem for those ordinances?

Notice what Fred Coulter had written in chapter 6 of his book, The Christian Passover:

If the children of Israel had gathered at one place before the Passover, as Josephus pictures, they would not have been in their houses but would have been camping in tents. And if they were in tents, how could they purify their houses with the blood of the lambs? Did they run back to their houses with bowls of blood and sprinkle the blood on the two side posts and lintel, and then frantically return to their tents in Rameses? This ridiculous scenario shows the gross internal contradiction in Josephus’ account. (The Christian Passover Pg 61)

Ridiculous, alright as Fred Coulter makes a scene that if the Israelites have to keep the Passover in their houses, they would have to run back from Rameses to Goshen to keep their Passover in their houses. Fast forward to Jesus and His disciples, they would also need to run back from Jerusalem to their houses in Galilee with bowls of blood and sprinkle the blood on the two side posts and lintel to keep it in their Galilean houses. Did they? Is this not ridiculous? Just substitute “Josephus” to “Fred Coulter” above. Blind Guides and WHAT FOLLY, that’s how he concludes about himself:

WHAT FOLLY! What foolishness to accept a traditional belief that directly conflicts with the truth of God’s Word, and to use interpretations of Scripture that promote the false ideas of men! No wonder God says that He entraps the intelligent in the foolishness of their own human wisdom. (ibid pg 61)

Moreover, in Deuteronomy 16:16 it commands “three times in a year shall all thy males appear before the LORD thy God in the place which he shall choose; in the feast of unleavened bread, and in the feast of weeks, and in the feast of tabernacles.” And God had chosen Jerusalem, a Temple-centered place where He had chosen to place His name there.

Again in Chapter 6 of his book, The Christian Passover:

The children of Israel kept the Passover in their houses, just as the Bible records for us. The inspired record in Exodus 12 makes it clear that the children of Israel were not dwelling in tents at Rameses when they kept the Passover. The Hebrew word bayith, which is translated “house” or “houses” in Exodus 12, does not refer to a tent or a temporary dwelling. (ibid pg 62)

There is no question that the children of Israel were in their houses “bayith” when they observed the original Passover in Rameses, but in the New Testament, Jesus and His disciples didn’t keep any Passover back in Galilee. Fred Coulter may have good intentions but he has foolishly made his savor a sinless life unattainable! And if they have to keep it in Jerusalem in houses, tents, or inns it would be a fake domestic Passover. Because Jesus and His disciples lived in Galilee in their houses – “bayith.”

The Gospel accounts do not specify whether the disciples’ preparations included the killing of the Passover lamb. However, since everything was “furnished and ready,” there can be little doubt that the master of the house had already killed the lamb and it was already being roasted by the time Peter and John arrived. In that case, they would have begun setting out the other foods for the meal, making sure that the unleavened bread and wine were ready. They completed whatever was necessary to prepare the Passover meal. Luke records, “Then they went and found everything exactly as He had said to them; and they prepared the Passover” (Luke 22:13). (Count To Pentecost From the Morrow After Which Sabbath pg 20)

The above are all pure speculation. Magic. The master of the house must have killed the lamb early, and that would be before the fourteenth, not at even on the fourteenth as commanded, and to sin on behalf of Jesus and His disciples. Ridiculous Bulls!

One of the requirements of partaking Passover is for members of a group of about ten to kill as well as roast the lamb to be eaten. Why would the master of the house roast and had the lamb ready for Jesus and His disciples? He and his family don’t have to kill his lamb for his own family? 

But Fred Coulter had unknowingly given himself a warning:

The apostle Peter warned the believers to be on guard against false teachers: “As he has also in all his [Paul’s] epistles, speaking in them concerning these things; in which are some things that are difficult to understand, which the ignorant and unstable are twisting and distorting, as they also twist and distort the rest of the Scriptures, to their own destruction. (The Christian Passover pg 13)

How true it is, that Fred Coulter could be seeing his own destruction, like the AD 70 inferno!

Sound doctrine should be firmly based on Scriptures. Here he is basing his doctrines on pure speculation —  everything is done so that Fred Coulter could deceive his dumb sheep?

Until the destruction of the temple in 70 AD the domestic 14th Passover was apparently the predominant practice. However, after the destruction of the Temple, the Jews observed only a 15th Passover; and thus, only viewed the 14th of Nisan as a preparation day for their traditional Seder meal on the 15th—the first day of the Feast of Unleavened Bread. By replacing the 14th Passover with a traditional Seder meal at the beginning of the 15th, the Jews have changed the original eight-day festival to their own eight day observance ending on the 22nd day of the 1st month. These eight days of are now known to Jews as “the Passover,” rather than as the Feast of Unleavened Bread. (Pg 20-21)

The significance of the destruction of the Temple in 70 AD should not be understated. Because of sin, the Heavenly Overseer of this Universe had destroyed Sodom and Gomorrah during Abraham’s time. The God of this Universe had also destroyed Solomon’s Temple in 587 BC. John the Baptist had given a stern warning about another consuming fire recorded in Luke 3:16-17 John said unto them:

The Fall of Jerusalem in 70 CE: A Story of Roman Revenge

“I indeed baptize you with water; but One mightier than I cometh, the straps of whose shoes I am not worthy to unloose. He shall baptize you with the Holy Ghost and with FIRE (pyr G4442). His winnowing fan is in His hand, and He will thoroughly purge His floor and will gather the wheat into His garner; but the chaff He will burn with FIRE (pyr G4442) unquenchable.”

When we look back, one cannot avoid concluding that God had given judgement that the Sadducees and the Boethusians were deemed worthy of extinction during the AD 70 inferno like Sodom and Gomorrah. Everything about the Sadducees and the Boethusians were destroyed. A large portion of the Shammai Pharisees also followed suit, only some in the Hillel branch survived.

“Shall a trumpet be blown in the city, and the people not be afraid? Shall there be evil in a city, and the LORD hath not done it?” Amos 3:6

If the AD 70 inferno were only a microcosm, a foretaste, how would the CoG Communities, who have similar deceptive beliefs as the Sadducees and Boethusians, escape John’s warning during the Last Days? And why is it so coincidental that the end-time Laodicean church was described as wretched, blind and naked? How could these “virgins” escape a coming FIRE?

“Say thou unto them, ‘Thus saith the LORD God: This burden concerneth the prince in Jerusalem and all the house of Israel that are among them.’ Say, ‘I am your sign: as I have done, so shall it be done unto them. They shall go into exile as captives.’
“And they shall know that I am the LORD, when I shall scatter them among the nations and disperse them in the countries. But I will
leave a few men of them from the Sword, from the Famine and from the Pestilence, that they may declare all their abominations among the nations whever they go; and they shall know that I am the LORD.” Ezekiel 12:10-11, 15-16

~~~ CRITIQUE OF FRED COULTER PENTECOST ~~~

This is Part 4 of a five-part series on Wave Sheaf Offering, Pentecost or Shavuot

(1) A Critique of Frank Nelte’s Pentecost 
(2) A Critique of Wade Cox’s Wave Sheaf Offering
(3) A Critique of UCG’s Pentecost 
(4) A Critique of Fred Coulter’s Pentecost 
(5) A Critique of John Ritenbaugh’s Pentecost

Ivanka & Jared’s Billionaire Bunker?

•June 6, 2026 • Leave a Comment

Ivanka & Jared’s $1.4B private Mediterranean island project: Luxury resort or billionaire bolt-hole?

Billionaire Bunkers; but the Sword ensures their Princes are slain, which “entereth into their secret chambers” Ezekiel 21:14, thus saith the LORD.

PravdaNews • June 4, 2026

Entitled nepotism grifters Trump’s daughter and son-in-law are marketing their new project on the remote, military bunker-strewn Sazan island off Albania as a luxury “eco-resort. “

But not everyone is buying into the glossy pitch.

This 1,400-hectare crumbling Mediterranean one-time Cold War military base is riddled with 3,600 abandoned bunkers and tunnels

The decaying fortifications are to be woven into the project together with Qatar’s billionaire entrepreneurs the Al-Khayyat brothers and ultra-luxury hotel brand Aman Resorts

The island is strategically located between the Strait of Otranto chokepoint and the entrance to the Bay of Vlorë – the only maritime gateway between the Adriatic Sea and the Ionian Sea/Mediterranean

It offers an entrance to Albania’s only major deep-water bay that is suitable for large naval vessels and commercial shipping

The base was used successively by Italian, Soviet, and Albanian forces throughout the 20th Century

Albania declassified it for civilian development only in December 2024

The island comes with exactly the kind of features that have fueled speculation that the global elite are building luxury escape pods for themselves amid fears of WWIII- scale fallout from the AI tech they themselves created and profit from.

OpenAI CEO Sam Altman, Palantir’s Peter Thiel, and Meta’s Mark Zuckerberg — have all simultaneously invested in high-end doomsday bunkers.

In an interesting twist, Kushner says he stumbled on the Albanian jackpot through his pal Nat Rothschild of the notorious Epstein‑linked elite puppet‑master clan.

While vacationing aboard Rothschild’s yacht, the pair met Albania’s prime minister, helping smooth the way for the project.

The Albanians aren’t thrilled over the project.

Thousands protested in Tirana under slogans like “Albania is not for sale,” anti-corruption prosecutors have opened probes into land deals and zoning changes linked to the project, and environmental groups oppose the construction putting protected wetlands and marine ecosystems at risk.

Ivanka and Jared are forging ahead with the scheme sitting atop the sprawling bunker network. On a private island. Coincidence? Or prep for worst-case scenario?

“Thou therefore, son of man, prophesy, and smite thine hands together; and let the Sword be doubled the third time, the Sword of the slain. It is the Sword of the great men that are slain, which entereth into their secret chambers” Ezekiel 21:14

A Critique of UCG’s Pentecost 

•June 5, 2026 • Leave a Comment

A Critique of UCG’s Pentecost 

United Church of God, a splinter of the now-defunct Worldwide Church of God

Pentecost and Its Observance — A Doctrinal Study Paper (20 pages)
Approved by the Council of Elders September 1997

President — Victor Kubik
Chairman — Len Martin

P.O. Box 541027
Cincinnati, OH 45254-1027

Wave sheaf – is this the Omer to be offered? For English speakers, this certainly is.

How to Count Pentecost, Feast of Weeks (Exodus 34:22), Feast of Firstfruits (Numbers 28:26), Festival of Fifty Days, Feast of Heptads, Festival of Seven Heptads, Wave Sheaf, Omer, “the firstfruits of thy labors which thou hast sown in the field (Exodus 23:16).”

This is a Critique of UCG’s Pentecost, the Feast of Weeks, or the Feast of Firstfruits. The counting to Pentecost is an extremely interesting subject and we’ll follow it in every key issue discussed. Besides the main issue of when to start counting towards Pentecost is the issue of what the firstfruits mean. What or who do they represent? Are they humans or is it Christ?

Quoted are UCG’s “Pentecost and Its Observance” doctrinal paper, a Study Paper,1997, posted on its website. They are indented, in PINK, and in block form so as to differentiate UCG’s from other narratives or my comments. The Scriptures, in RED, must be our primary focus and guide, and sometimes the Scriptures, which include the Septuagint and the Targum, say things very different from what we think! 

And so with that in mind, we’ll begin:

The expression refers to the fact that Pentecost was the fiftieth day in a specific counting commanded in the Old Testament. The festival is one of the seven annual Holy Days listed in Leviticus 23. 

And you shall proclaim on the same day that it is a holy convocation to you. You shall do no customary work on it. It shall be a statute forever in all your dwellings throughout your generations (Leviticus 23:21).

This same Festival is referred to as “the Feast of Harvest, the firstfruits of your labor” (Exodus 23:16), (Pentecost and Its Observance pg 2)

That’s right! The “Feast of Harvest” is “the firstfruits of your labor” or the firstfruits of thy labors which thou hast sown in the field. Question. If this “firstfruits” represents Christ, what labor did we humans contribute to His resurrection? It is NOTHING!

Human beings contribute virtually nothing to the redemption of humanity. God the Father plans and carries out the redemption with His Son “before the foundation of the world,” Ephesians 1:3-4. Hence the teaching that Christ is the firstfruits “of thy labors” as the “Wave Sheaf” offering doesn’t have any merit.

In studying the observance of Pentecost, it is important to understand the historical context. It was in 1974 that the Worldwide Church of God began observing Pentecost on Sunday (the 50th day after the Sunday during the Days of Unleavened Bread). Mr. Armstrong’s position was that the issue should not be complicated with a number of technicalities. There was no attempt to ignore these technicalities and the subsequent study paper addressed most of them. To arrive at the correct biblical position in this matter, we need to study the relevant passages of scripture. After all, our position must rest on scripture and not necessarily on what has been practiced historically.

Leviticus 23

In dealing with Leviticus 23, we must address the term “Sabbath” and what it means in this context. There are three references to the word Sabbath (or Sabbaths) in verses 15-16.

And you shall count for yourselves from the day after the Sabbath, from the day that you brought the sheaf of the wave offering: seven Sabbaths shall be completed. Count fifty days to the day after the seventh Sabbath; then you shall offer a new grain offering to the LORD.

The English word “Sabbath” or its plural “Sabbaths” is translated from the Hebrew shabbath or its plural form shabbathoth. Although there are some translations that use the word “weeks,” this is not the most common translation. In fact, in the King James Version (KJV) the word shabbath (or its plural shabbathoth) is only translated Sabbath and is never translated weeks. There is another word in Hebrew which is translated weeks. This can be found in Deuteronomy 16:9  and also in Exodus 34:22. The word used in these verses for weeks is shabuoth. The singular form of this word is shabua. In the King James Version, and the New King James Version this Hebrew word is never translated as Sabbath. In twenty occurrences in the KJV, this word is translated as “week” (or weeks) nineteen times and on one occasion it is translated “seven.” The Englishman’s Hebrew-Chaldee Concordance of the Old Testament makes this point quite clearly. The word shabbath can be found 108 times and in every instance it is translated Sabbath or Sabbaths and never weeks. According to this same source, the Hebrew word shabuoth is never translated as Sabbath, but is in every instance but one translated as weeks. (Pentecost and Its Observance pg 8-9)

It is interesting to note that the writer intends to arrive at the correct biblical position in this matter by seeking the relevant Scriptures, but the evidence is that this stated intent is only lip service. After all, UCG’s position has always been centered on what had been practiced historically, whose doctrines follow exactly of the now-defunct Worldwide Church of God.

Members of UCG’s Council of Elders are all known to be former members of the Worldwide Church of God.

The King James Version say:

“‘And ye shall count unto you from the morrow after the sabbath, H7676 from the day that ye brought the sheaf of the wave offering; seven sabbaths H7676 shall be complete:16 Even unto the morrow after the seventh sabbath H7676 shall ye number fifty days; and ye shall offer a new meat offering unto the LORD” Leviticus 23:15-16 KJ21

Leviticus 23:15-16 seven sabbaths [H7676 shabbat] according to Strong, this shabbat could be translated as:

(a) sabbath
(b) day of atonement
(c) sabbath year
(d) WEEK
(e) produce (in sabbath year)

According to Strong’s Concordance, this shabbat could be translated as a weekly sabbath or an annual sabbath like the Day of Atonement. It is also the same word for the seventh year where the land needs a rest. But the most important point in Strong’s Concordance is that it could also mean week, or a block of seven days.

The JPS 1917 and the New JPS 1988 translate Leviticus 23:15-16 as follows:

Leviticus 23:15 And ye shall count unto you from the morrow after the day of rest (footnote: Sabbath), from the day that ye brought the sheaf of the waving; seven weeks shall there be complete; 16 even unto the morrow after the seventh week shall ye number fifty days; and ye shall present a new meal-offering unto the LORD. (JPS 1917)

Leviticus 23:15 And from the day on which you bring the sheaf of elevation offeringthe day after the sabbathyou shall count off seven weeks. They must be complete; 16 you must count until the day after the seventh weekfifty days; then you shall bring an offering of new grain to the LORD. (New JPS 1988)

Note: the word sabbath [H7676 shabbat] could be translated as week or weeks. To restrict the word to only the weekly sabbath is misguided. The above extract is as if Moses had written the Original Scriptures in the English James King Version. The King James translation is generally good, but at times, could be ridiculous, as translated in Numbers 25:4 

KJV: And the Lord said unto Moses, Take all the heads of the people, and hang them up before the Lord against the sun, that the fierce anger of the Lord may be turned away from Israel. Numbers 25:4 KJ — this includes all men, women and children; all are to be hung! Genocide!

Compared to:

Amplified Bible: The Lord said to Moses, “Take all the leaders of the people [who have committed sin with the Moabites], and execute them in broad daylight before the Lord, so that the fierce anger of the Lord may turn away from Israel.”

Septuagint: And the Lord said to Moses, Take all the princes of the people, and make them examples of judgment for the Lord in the face of the sun, and the anger of the Lord shall be turned away from Israel;

The Targum: And the Lord said to Mosheh, Take all the chiefs of the people, and appoint them for judges, and let them give judgment to put to death the people who have gone astray after Peor, and hang them before the Word of the Lord upon the wood over against the morning sun, and at the departure of the sun take them down and bury them and turn away the strong anger of the Lord from Israel.

Look at the official UCG logo and it tells a story. The church has the mistaken notion that the center of this Universe, or the center of God’s interest is the British Isles, or London, instead of Jerusalem, whereas God’s main interest is centered in His Temple in Zion, Jerusalem. Here are the evidence:

II Kings 21:4 . . . the Lord said, “In Jerusalem will I put My name.”
II Kings 21:7 . . . the Lord said to David and to Solomon his son, “In this house and in
Jerusalem, which I have chosen out of all tribes of Israel, will I put My name for ever.
II Chronicles 6:6 . . . but I have chosen
Jerusalem, that My name might be there.
II Chronicles 33:4 . . . the Lord had said, “In
Jerusalem shall My name be for ever.”
Ezra 7:19 The vessels also that are given thee for the service of the house of thy God, those deliver thou before the God of
Jerusalem.
Ezra 8:30 So the priests and the Levites took the weight of the silver and the gold and the vessels, to bring them to
Jerusalem unto the house of our God.
Psalm 116:19 in the courts of the Lord’s house, in the midst of thee, O
Jerusalem. Praise ye the Lord!
Psalm 125:2 As the mountains are round about
Jerusalem, so the Lord is round about His people from henceforth, even for ever.
Psalm 135:21 Blessed be the Lord out of Zion, who dwelleth in
Jerusalem! Praise ye the Lord!
Psalm 147:12 Praise the Lord, O
Jerusalem! Praise thy God, O Zion!
Isaiah 2:3 And many people shall go and say, “Come ye, and let us go up to the mountain of the Lord, to the house of the God of Jacob; and He will teach us of His ways, and we will walk in His paths.” For out of Zion shall go forth the law, and the word of the Lord from
Jerusalem.
Isaiah 28:14 Therefore hear the word of the Lord, ye scornful men, that rule this people which is in
Jerusalem.
Jeremiah 3:17 At that time they shall call
Jerusalem the Throne of the Lord, and all the nations shall be gathered unto it, to the name of the Lord, to Jerusalem.
Ezekiel 5:5 “Thus saith the Lord God: This is
Jerusalem. I have set it in the midst of the nations and countries that are round about her.
Micah 4:2 And many nations shall come and say, “Come, and let us go up to the mountain of the Lord, and to the house of the God of Jacob. And He will teach us of His ways, and we will walk in His paths.” For the law shall go forth from Zion, and the word of the Lord from
Jerusalem.
Zechariah 8:3 “Thus saith the Lord: ‘I am returned unto Zion, and will dwell in the midst of
Jerusalem; and Jerusalem shall be called a city of truth, and the mountain of the Lord of hosts, the Holy Mountain.’
Zechariah 14:8 And it shall be in that day, that living waters shall go out from
Jerusalem, half of them toward the eastern sea and half of them toward the hinder sea; in summer and in winter shall it be.

UCG’s Self-Absorbing Hubris Logo

The focus of UCG is not in Jerusalem, but on the British Isles. It may seem innocuous and insignificant, but God says He is a jealous God. Their focus are on themselves, their elitist Anglo-Saxonisn — an indication of where members of the Council of Elders came from — their minds unfocused on the themes of God, but focusing on their self-absorbing hubris, narcissism and jingoism.

“History Doesn’t Repeat Itself, But It Rhymes.” 

“Ephraim compasseth me about lies, and the house of Israel with deceit” Hosea 11:12

The house of Judah operates with hypocrisy but the house of Ephraim operates with lies and deceits!  The Scriptures say so!

And here are more examples:

In an August 2002 speech that kicked off the Bush White House administration’s campaign for war against Iraq, Cheney asserted, “Simply stated, there’s no doubt that Saddam Hussein now has weapons of mass destruction. There is no doubt he is amassing them to use against our friends, against our allies, and against us.”

In October 2002, Defense Secretary Donald Rumsfeld claimed he had “bullet-proof” evidence that Saddam was tied to Osama bin Laden. And a National Intelligence Estimate said Iraq had “continued its weapons of mass destruction program.”

“However, there is no doubt at all that the development of weapons of mass destruction by Saddam Hussein poses a severe threat not just to the region, but to the wider world.” – Tony Blair, House of Commons, 10 April 2002.

Prime Minister Tony Blair defended himself in 2005: “I have never told a lie. No. I don’t intend to go telling lies to people. I did not lie over Iraq.”

But these are only following their first lie by King Jeroboam, an Ephraimite:

“It is too much for you to go up to Jerusalem,” says King Jeroboam. “Behold thy gods, O Israel, which brought thee up out of the land of Egypt!” I King 12:28

So he (King Jeroboam) offered upon the altar which he had made in Bethel the fifteenth day of the eighth month, even in the month which he had devised of his own heart, and ordained a feast unto the children of Israel; and he offered upon the altar and burned incense I King 12:33

Jeroboam was of the house of Ephraim; he was not supposed to offer sacrifices, which were reserved only for the Aaronic Priesthood of the house of Judah. Further let’s take a closer look into this prophecy regarding the House of Manasseh rallying with the House of Ephraim against Judah:

“Manasseh, Ephraim; and Ephraim, Manasseh; and they together shall be against Judah. For all this His anger is not turned away, but His hand is stretched out still” Isaiah 9:21

Manasseh and Ephraim are united against Judah; their quarrels, contentions, and wars among themselves, whereby they fight, devoured, and consumed each other, though they were brethren; which explains and confirms what is before said, of no man sparing his brother, and everyone eating the flesh of his own arm. 

Cliffords Tower, York, England Free Stock Photo - Public Domain Pictures
Massacre and mass suicide of Jews in Clifford’s Tower 1189-1190

In 1190 THE MASSACRE OF THE JEWS at Clifford’s Tower the British expelled all Jews from his kingdom and only some four hundred years were they allowed to return in the 17th century.

Furthermore, the pogroms of 1189 and 1190 are just the tip of an iceberg. Here in Wikipedia it documents more than two hundred years (1066–1290) of persecutions.

The Targum bore testimony the words in Isaiah 9:21:

“Those of the house of Manasseh, with those of the house of Ephraim, and they of the house of Ephraim, with those of the house of Manasseh, shall be joined together as one, to come against them of the house of Judah. For all this they do not turn away from their sins, that His anger might turn away from them; but still they hold fast their rebellion, and yet His stroke is ready to take vengeance on them”  Isaiah 9:20 Jonathan

Gill…“for all this they do not return from their sins, that he may turn away his anger from them, but still retain their sins; and yet his stroke will be to take vengeance on them.”

The anger of God will soon hit Ephraim and Manasseh. Blind and deceitful Guides! Ephraim compasseth the world with lies! Such parallels are astonishing! Why have they ignored the warning of the Prophets, Isaiah, Jeremiah, Ezekiel, and especially Ezra? Even other English versions have translated “seven weeks” correctly in Leviticus 23:15,16. Blind Guides! Why have UCG blushed off these other translations? These all translated shabbath [H7676 shabbat] as “week” (or weeks):

The Companion Bible (Bullinger)
Common English Bible (CEB)
Complete Jewish Bible (CJB)
Contemporary English Version (CEV)
Christian Standard Bible (CSB)
Darby Translation (DARBY)
Easy-to-Read Version (ERV)
English Standard Version (ESV)
Expanded Bible (EXB)
GOD’S WORD Translation (GW)
Good News Translation (GNT)
Holman Christian Standard Bible (HCSB)
International Children’s Bible (ICB)
International Standard Version (ISV)
Lexham English Bible (LEB)
The Message (MSG)
Modern English Version (MEV)
Names of God Bible (NOG)
New American Bible (Revised Edition) (NABRE)
New Century Version (NCV)
New English Translation (NET Bible)
New International Version (NIV)
New Life Version (NLV)
New Living Translation (NLT)
Revised Standard Version (RSV)
The Voice (VOICE)
Wycliffe Bible (WYC)

Also, if Leviticus 23:11,15-16 are restricted to a weekly Sabbath, there is no proof as to which one, since there are over 50 weekly sabbaths during the year. Another problem arises when the fourteenth of Nisan falls on a weekly Sabbath. And so there are different interpretations among the different CoG Communities adding confusion to confusion. Why choose one instead of another especially where there is no solid evidence to be found?

Further in Deuteronomy 16:9 it says:

Seven weeks shalt thou number unto thee: begin to number the seven weeks from such time as thou beginnest to put the sickle to the corn” Deuteronomy 16:9

Putting the Scriptures in Leviticus 23 and Deuteronomy 16 together, they may appear to say different things. Surely they don’t, but how do we reconcile them? 

First we must realize that the books of Genesis, Exodus, Leviticus and Numbers were mainly the words of God to His subjects — from Adam to Abraham, on to Moses — but in the book of Deuteronomy it was Moses speaking to the Israelites. Deuteronomy 1:1 says “These are the words which Moses spoke unto all Israel on this side of the Jordan . . . 3 And it came to pass in the fortieth year . . .  that Moses spoke unto the children of Israel according unto all that the Lord had given him.”

In a language meant to be more easily understood, Moses uses the word šāḇûa [H7620] in Deuteronomy:

Deuteronomy 16:9 Seven weeksH7620 shalt thou number unto thee: begin to number the seven weeksH7620 from such time as thou beginnest to put the sickle to the corn.

Deuteronomy 16:9 Seven weeks [H7620 shabua] Strong translates shabua as seven, period of seven (days or years), heptad, week

A. period of seven days, a week
Feast of Weeks
B. heptad, seven (of years)

UCG points out that shabua is never translated as a sabbath. That is true, but UCG fails to explain that shabua is generally described as a block of seven days, or heptad. So what is a block of sevens?  It is a group or series of seven — it could be days or years.

Ambassador Bible College Class of 2021 with faculty members – a training school for the manifestion of Anglo-Saxonism (Manas′seh E′phraim, and E′phraim Manas′seh, and together they are united against Judah, Isaiah 9:21)

In all, the Bible has used “šāḇûa H7620twenty times. We should study each of them in detail. Here are all their uses, all 20 of them, in 17 verses:

Gen 29:27 Fulfil her week, H7620 and we will give thee this also for the service which thou shalt serve with me yet seven other years. — this is a block of seven years

Gen 29:28 And Jacob did so, and fulfilled her week: H7620 and he gave him Rachel his daughter to wife also. — again, this is a block of seven years

Exo 34:22 And thou shalt observe the feast of weeks, H7620 of the firstfruits of wheat harvest, and the feast of ingathering at the year’s end. — This is the Feast of Weeks, which could also be called the Feast of Firstfruits, the firstfruits of thy labors which thou hast sown in the field

Lev 12:5 But if she bear a maid child, then she shall be unclean for two weeks, H7620 as in her separation: and she shall continue in the blood of her purifying threescore and six days. — this is a block of two weeks

Num 28:26 Also in the day of the firstfruits, when ye bring a new meat offering unto the LORD, after your weeks H7620 be out, ye shall have an holy convocation; ye shall do no servile work — this is the Feast of Firstfruits, which could also be called the Feast of Firstfruits, the firstfruits of thy labors which thou hast sown in the field

Deu 16:9 Seven weeks H7620 shalt thou number unto thee: begin to number the seven weeks H7620 from such time as thou beginnest to put the sickle to the corn. — this is the Feast of Weeks, and is NEVER called the Feast of Sabbaths. The difference is that the count starts immediately; no need to wait until the weekly Sabbath has arrived

Deu 16:10 And thou shalt keep the feast of weeks H7620 unto the LORD thy God with a tribute of a freewill offering of thine hand, which thou shalt give unto the LORD thy God, according as the LORD thy God hath blessed thee: — this is the Feast of Weeks, NEVER the Feast of Sabbaths

Deu 16:16 Three times a year shall all thy males appear before the LORD thy God in the place which he shall choose; in the feast of unleavened bread, and in the feast of weeks, H7620 and in the feast of tabernacles: and they shall not appear before the LORD empty: — again, this is the Feast of Weeks or the Feast of Firstfruits, the firstfruits of thy labors which thou hast sown in the field

II Ch 8:13 Even after a certain rate every day, offering according to the commandment of Moses, on the sabbaths, and on the new moons, and on the solemn feasts, three times in the year, even in the feast of unleavened bread, and in the feast of weeks, H7620 and in the feast of tabernacles. — this is the Feast of Weeks or the Feast of Heptads

Jer 5:24 Neither say they in their heart, Let us now fear the LORD our God, that giveth rain, both the former and the latter, in his season: he reserveth unto us the appointed weeks H7620 of the harvest. — this is a block of weeks

Eze 45:21 In the first month, in the fourteenth day of the month, ye shall have the passover, a feast of seven H7620 days; unleavened bread shall be eaten. — a block of seven days: this is the most obvious illustration that shabua is NOT connected to the weekly sabbath. It starts IMMEDIATELY after Passover! And NO NEED to wait until the weekly Sabbath to start! The blind couldn’t see this because they are blind

Dan 9:24 Seventy weeks H7620 are determined upon thy people and upon thy holy city, to finish the transgression, and to make an end of sins, and to make reconciliation for iniquity, and to bring in everlasting righteousness, and to seal up the vision and prophecy, and to anoint the most Holy. — a block of seventy weeks

Dan 9:25 Know therefore and understand, that from the going forth of the commandment to restore and to build Jerusalem unto the Messiah the Prince shall be seven weeks, H7620 and threescore and two weeks: H7620 the street shall be built again, and the wall, even in troublous times. — a block of sixty-nine weeks

Dan 9:26 And after threescore and two weeks H7620 shall Messiah be cut off, but not for himself: and the people of the prince that shall come shall destroy the city and the sanctuary; and the end thereof shall be with a flood, and unto the end of the war desolations are determined. — a one week block; the seventieth week

Dan 9:27 And he shall confirm the covenant with many for one week: H7620 and in the midst of the week H7620 he shall cause the sacrifice and the oblation to cease, and for the overspreading of abominations he shall make it desolate, even until the consummation, and that determined shall be poured upon the desolate. — a one week block; the seventieth week

Dan 10:2 In those days I Daniel was mourning three full weeks. H7620 — a block of three weeks

Dan 10:3 I ate no pleasant bread, neither came flesh nor wine in my mouth, neither did I anoint myself at all, till three whole weeks H7620 were fulfilled. — a block of three weeks

All their uses show heptad is a block of seven — days or years — but NEVER is it used as a weekly Sabbath, nor does it have to align with the weekly Sabbath. It is a BLOCK of seven, and it can start on any day. 

The term was first used in Genesis 29:27-28 when Jacob had to serve seven years marriage to Leah, and another seven to marry Rachael. The seven years period began immediately when Jacob and Laban concluded their agreement.

When Moses wrote or spoke in Deuteronomy 16, he uses this word shabua that was different from that expressed in Leviticus, to clarify that the start of the count to Pentecost need not start at the beginning of a week, but that it can start “on the morrow after the Sabbath,” and that Sabbath is an annual Sabbath, the First Day of Unleavened Bread, followed by seven blocks of days. 

As the wordings in Deuteronomy 16 show, Moses would clarify seemingly unclear issues in Leviticus 23, or to elucidate complex subjects. And when Ezra returned from Exile, he, too, used expressions which appeared different from what God or Moses used. We can see those expressions in the Targum.

The Targum makes it extremely clear:

And number to you after the first feast day of Pascha, from the day when you brought the sheaf for the elevation, seven weeks; complete they shall be. Leviticus 23:15 Jonathan

The reference is from the day “after the first feast day of Pascha.” Since Passover also means Unleavened Bread, this is the day after the first Day of Unleavened Bread. And this is confirmed in Septuagint 23:11 and he shall lift up the sheaf before the Lord, to be accepted for you. On the morrow of the first day the priest shall lift it up. “The first day,” of course, refers to the first Day of Unleavened Bread; and to the morrow after is the sixteenth of Nisan. 

The Targum is an important source of our Scriptures. Blind Guides! Why would we ignore such an important witness? Naked Preachers! 

Let’s go and check into what the Targum is and what it says:

The Targum known in Hebrew: תרגום, plural: the targumim play an important role in translating many of our modern editions. The range of its origin was from 530 BC to 500 AD. When the Israelites returned from their exile in Babylon in the 6th century BC, most of them could no longer speak Hebrew; they spoke Aramaic. Nevertheless, the Scriptures have always been read in Hebrew even if no one in the greater community could speak it.

Something had to be done so that the people would understand God and His Word. The sages, starting with Ezra, found an answer. After hearing a priest read a few verses of the Torah scroll in Hebrew, they then heard a translation in Aramaic called a Targum, which simply means translation. Hence the Targum is an Aramaic translation of the Hebrew Bible (Tanakh) that was written or compiled in Judea or in Babylonia from the Second Temple period until the early Middle Ages (late first millennium). 

One might think that God would have given the Levites privileged land as their inheritance to match their privileged position, but God actually gave them no land inheritance at all. Instead, they received agricultural and monetary tithes from the people as their inheritance. In this capacity, the Levites and priests had the opportunity to minister to the people through the instruction of the Torah. 

Back in Jerusalem, for instance, after returning from Babylonian exile, Ezra, a Levite and high priest, read and translated the Torah in Hebrew into the common Aramaic language, and he, or other Levites, explained the Torah so the people could understand. 

“The Levites … instructed the people in the Law while the people were standing there. They read from the Book of the Law of God, making it clear and giving the meaning so that the people understood what was being read” (Nehemiah 8:7–8).

Another way of saying: The Law was read by Ezra, verse by verse, and each verse was followed by a recitation by the Levites of the Aramaic version. Hence, we have to assume that the action of Ezra narrated in Nehemiah 8:8 implied not only the reading of the Law, but also the interpretation of its language — its translation in fact from Hebrew to Aramaic, and that, further, this practice was long followed in all the synagogues among the returning Exiles in Judea.

The Targum is like a mirror: when placed against the end-time CoG Communities, it reflects their nakedness. And the Targum stated clearly that the counting is the morrow after the first festal day of Pascha. Leviticus 23:11-13 And he shall uplift the sheaf before the Lord to be accepted for you. AFTER THE FIRST FESTAL DAY OF PASCHA (OR, THE DAY AFTER THE FEAST‑DAY OF PASCHA) on the day on which you elevate the sheaf, you shall make the sacrifice of a lamb of the year, unblemished a burnt offering unto the Name of the Lord . . . 15 AND NUMBER TO YOU AFTER THE FIRST FEAST DAY OF PASCHA, from the day when you brought the sheaf for the elevation, seven weeks; complete they shall be. Leviticus 23:11-13,15 Jonathan

A Partial Week?

Are the weeks (shabuoth) referenced in Deuteronomy 16 truly full weeks, each ending with a Sabbath? Can there be partial weeks in this count? A partial week will result when a day other than the first day of the week is used as day one. If the count were intended to start on any other day of the week, say, a Wednesday, seven weekly cycles would be completed on a Tuesday. In this case we would have a partial week, Wednesday to Sabbath, six complete weeks from Sunday to Sabbath, and another partial week from Sunday to Tuesday. Notice how this would look if you began your count on a Wednesday:

Wednesday to Sabbath = one partial week, 4 days 6 full weeks (Sunday to Sabbath) = 42 days Sunday to Tuesday = one partial week, 3 days Total of 49 days, followed by the 50th day on Wednesday (morrow after the 49th day)

We could also count seven Sabbaths, and not have 49 days. In the hypothetical example above we count the seven Sabbaths, and then we still have to count the remaining days of Sunday through Tuesday to complete the seven weekly cycles. It should be noted here that the NRSV (New Revised Standard Version), Moffat, NIV, and the JPS (Jewish Publication Society) all translate Leviticus 23:15 “seven Sabbaths shall be complete” as “seven weeks” or “seven full weeks.” The King James Version and the New King James Version are both faithful to the original Hebrew text where the word shabbath is used. If weeks were the intended meaning in these verses, then a different Hebrew word should have been used– shabuoth.

It is certainly true that seven full weeks could be satisfied by seven weekly cycles, independent of when the weekly cycle started. Thus, it would be permissible to have two fragments of a week and six complete weeks (from the first day through the seventh day or Sabbath) according to this explanation. But is this what is intended by the scriptures?

An argument could be made here that God starts the week on the first day and ends it on the seventh day, the creation week being an example (Genesis 1). This argument, however is not necessary in the determination of how to count to the day of Pentecost. It is to be noted here that Deuteronomy was written after Leviticus. The instructions from Leviticus have to be taken into account, as Deuteronomy supplements Leviticus. There is no contradiction between the two. (Pentecost pg 12-13)

This is correct, that the “seven full weeks could be satisfied by seven weekly cycles, independent of when the weekly cycle started.” Pentecost is NEVER called the Feast of Sabbaths, it’s the Feast of Weeks, or Feast of Heptads (blocks of sevens). The Feast of Weeks could start at any day of the week. The best illustration is Ezekiel 45:21 where it testifies the seven-day Feast of Unleavened Bread could start at any time of the week.

Look at Ezekiel 45:21 again:

In the first month, in the fourteenth day of the month, ye shall have the passover, a Feast of Haptads (a block of seven) H7620 days; unleavened bread shall be eaten. Ezekiel 45:21

Note carefully, the seven days Feast of Unleavened Bread starts IMMEDIATELY after Passover, establishing a Link, so it could be a Monday, a Wednesday, or any day after Passover, but the most important characteristic is that it starts IMMEDIATELY to begin the block of seven weeks! There is no waiting even for a single day. That’s why Pentecost is called the Feast of Weeks but never the Feast of Sabbaths.

To break the Link to Pentecost from the Sacrifice of the Lamb strips the holy day of its true meaning. The notion of delaying the count to wait for arbitrary Sunday—a peculiar heresy the Samaritans brought with them from Babylon—completely breaks the Link back the the Sacrifice of the Lamb. Nor wonder, Jesus rebuked the Samaritans,  “You worship what you do not know; we worship what we know, for salvation is from the Jews” John 4:22

The Pharisees and Sadducees were both sects of the Jews in the first century. The two groups had numerous differences, one of them being the method of counting Pentecost. It is acknowledged that during the first century C.E. and up until the destruction of the Temple in 70 C.E., the Sadducees controlled worship at the temple. . . . 

It is only after the destruction of the Temple that the Pharisees gain control and the Sadducees, for the most part, disappear:

Except under Salome Alexandra the Pharisees have the role of a minority up to A.D. 70. Their great period comes only with the fall of the hierocracy. When the capture of Jerusalem shatters the Sadducean ideal, Pharisaism provides the direction needed for reconstruction. Politically independent, it nurtures community life in the synagogue. The failure of the Zealots clears the way for more moderate leaders such as Jochanan ben Zakkai. Jabneh with its chakamim [sages], which plays no part in the revolt, forms a center for reorganization. (Pentecost pg 16)

On first appearance, the Sadducees seemed to have control over the worship at the temple, but it wasn’t the case. Josephus, an eye witness living during the first century, wrote in his Antiquities of the Jews, saying that the Pharisees were the dominant religious party during the time of Christ, and that they controlled the worship services. 

Now, for the Pharisees, they live meanly, and despise delicacies in diet; and they follow the conduct of reason; and what that prescribes to them as good for them they do; and they think they ought earnestly to strive to observe reason’s dictates for practice. They also pay a respect to such as are in years . . .  on account of which doctrines they are able greatly to persuade the body of the people; and whatsoever they do about Divine worship, prayers, and sacrifices, they perform them according to their direction (Antiquities 18,1,3)

The bulk of the common people followed the Pharisees. And although the Sadducees were occupying the upper stratum of the Jewish aristocracy, they were few in numbers, hence they were unable and unwilling to carry out their own beliefs in the Temple service, “because the multitude would not otherwise bear them” but to carry “the notions [directions] of the Pharisees”:

Image result for josephus pics

But the doctrine of the Sadducees is this: That souls die with the bodies; nor do they regard the observation of any thing besides what the law enjoins them; for they think it an instance of virtue to dispute with those teachers of philosophy whom they frequent: but this doctrine is received but by a few, yet by those still of the greatest dignity. But they are able to do almost nothing of themselves; for when they become magistrates, as they are unwillingly and by force sometimes obliged to be, they addict themselves to the notions of the Pharisees, because the multitude would not otherwise bear them (Antiquities 18,1,4)

The Unger’s Bible Dictionary tells us further political-religious amalgamation called the Sadducees:

“Their political supremacy was, however, of no long duration. Greatly as the spiritual power of the Pharisees had increased, the Sadducean aristocracy was able to keep at the helm in politics. The price at which the Sadducees had to secure themselves power at this later period was indeed a high one, for they were IN THEIR OFFICIAL ACTIONS TO ACCOMMODATE THEMSELVES TO PHARISAIC VIEWS. With the fall of the Jewish state the Sadducees altogether disappear from history (“Sadducees” page 1506)

The strength of the Sadducees was mainly in politics around Jerusalem and living luxurious lives. “What servant would work all day without obtaining his due reward in the evening?” they asked themselves, and so they broke away from the Law and lived in great luxury, using silver and gold vessels at banquets; and they established schools which declared the enjoyment of this life to be the goal of man, at the same time pitying the Pharisees for their bitter privation in this world with no hope of another world to compensate them. These schools were called, after their founders, Sadducees after their apparent founder, Zadok; and Boethusians, after Boethus the high priest was brought over by King Herod the Great from Alexandria.

In the book Faith in the Future, we find a chapter which discusses this subject in some detail. The chapter is entitled “Shavuot/Pentecost, Israel’s Wedding” and the book was written by Jonathan Sacks, who is currently Chief Rabbi of the United Hebrew Congregations of the British Commonwealth:

In Judaism, mysteries have a habit of becoming controversies, none more so than in the case of Shavuot, otherwise known as Pentecost or the Feast of Weeks. Shavuot generated one of the great arguments in Jewish history. . . The argument became acute in the days of the second Temple when Jews were divided into several groups, most notably the Sadducees and Pharisees. We know all too little about this period, but we can say this. Of the two groups, the Sadducees were the more affluent and influential. They were closely connected to the Temple hierarchy and to the political elite. They were as near as Jewry came to a governing class. . . The Torah had specified that the counting of seven weeks should begin on the “day after the Sabbath.” The Sadducees took this literally. The counting should begin on Sunday, so that Shavuot would always fall on Sunday seven weeks later. The Pharisees invoked tradition and argued instead that in this case “sabbath” meant “festival,” specifically the first day of Pesach.” 

From the above quotes, it may be deduced that the Pharisees were unable to convince the Sadducees that the Feast of Weeks always falls on a fixed date of Sivan 6. The two groups were clearly divided over this issue. (Pentecost pg 17)

As before, the United Hebrew Congregations, part of the Reform Judaism, follows the Sadducees in an age of emancipation in trying to link Shavuot on Sunday, so they could break its connection to the Sacrifice of the Pascha Lamb at Passover.

In determining which day to start Counting, the standard of Christ’s acceptance before the Father rests not upon agricultural symbols like grains as a produce of the Land, but exclusively upon the Blood of a Lamb or Goat; typified by the blood offering on the Day of Atonement, wherein blood was presented upon the Mercy Seat within the Holy of Holies;

To break the linkage of the “Wave Sheaf” offering to the Sacrifice of the Lamb is to trivialize its significance. This they did by waiting for some obscure Sunday to begin the Count, a strange concept the Samaritans brought with them from Babylon! Breaking the Link to the Blood offered by the Sacrifice is pure wickedness! Nor wonder, Jesus rebuked the Samaritans, “Ye worship ye know not what; we know what we worship, for salvation is of the Jews” John 4:22;

Okay that is old archic English; below are more straight forward English

“You Samaritans worship what you do not know. We worship what we do know, because salvation is from the Jews” John 4:22 CSBA

You Samaritans worship what you do not know. We Jews worship what we know, because salvation is from the Jews” John 4:22 DLNT

When it comes to Temple services Josephus testifies that the Sadducees submitted themselves to the notions of the Pharisees, because the multitude would not otherwise tolerate them. But why, you may ask. There was a Talmudic report of a Sadducean high priest, R Abbahu, who suffered badly by following the Sadducaic interpretation.

It was reported that coming out of the Holy of Holies on the Day of Atonement, he was hit from behind between his shoulders. He fell forward and hit the floor on his face. It was believed that an angel had kicked him, producing a type of sound that was even heard in the Temple courtyard, whose sole of a foot had the mark of a calf-hoof, (Ezekiel 1:7). 

A mark of a calf’s hoof appeared right at the center of Abbahu’s forehead and his nose started to discharge worms. And he died a terrible death a few days later. (Talmud, Yoma I9b)

This testimony of God’s judgement recorded in the Talmud and the Scriptures would have struck fear and trepidation and permeated the Land of Israel for numerous generations to come, about where the LORD’s position is and how His laws should be interpreted, but another major event would come to be ignored.

The significance of the destruction of the Temple in 70 AD had also been ignored. It came forty years after John the Baptist had given a stern warning about another consuming fire recorded by Luke. The number 40 generally symbolizes a period of testing, trial or probation. During Moses’ life he lived forty years in Egypt and forty years in the desert before God selected him to lead his people out of slavery.

Because of their perversion, God destroyed Sodom and Gomorrah during Abraham’s time. The Blind have ignored John the Baptist’s warning about another consuming fire recorded in Luke. John said unto them:

“I indeed baptize you with water; but One mightier than I cometh, the straps of whose shoes I am not worthy to unloose. He shall baptize you with the Holy Ghost and with FIRE. His winnowing fan is in His hand, and He will thoroughly purge His floor and will gather the wheat into His garner; but the chaff He will burn with FIRE unquenchableLuke 3:16-17

The word “FIRE” is highlighted above, with a hope that the Blind could see finally. When we look back, one cannot avoid concluding that God had deemed that the Sadducees and the Boethusians were worthy of extinction during the 70 AD INFIRNO. Everything about the Sadducees and the Boethusians were destroyed — they “disappeared.” A large portion of the Shammai Pharisees also followed suit; onlya portion of the Hillel branch of Pharisees limped off to Yavne and survived. 

Now, just as the victims of Sodom and Gomorrah have revived today, so were those of the Sadducees and Boethusians! They, too, have revived as a “Reform Movement.”

So says the United Hebrew Congregations on its website:

We are a Reform congregation with a traditional mind-set and a progressive heart. As a congregation affiliated with the Union for Reform Judaism, we strive to attain the high ideals of the movement. We make informed, meaningful choices from Jewish tradition to guide our observance, take an open-minded approach to Jewish religious belief and practice, and provide a home where members can cultivate, explore, and expand their spirituality.

The origins of Reform Judaism started in 19th-century Germany, where its early principles were formulated by Rabbi Abraham Geiger (1810-1874). Since the 1970s, the Movement adopted a policy of inclusiveness and acceptance, inviting as many as possible to partake in its communities, rather than “strict theoretical clarity,” and away from the “Bondage of Judaism.”

Abraham Geiger (1810-1874)

Reform Judaism initially developed as lay Jews simply lost interest in the strict observances required of Orthodoxy, with many seeking shorter services, more frequent sermons, and organ music, modeled after Protestant churches. Thus Reform Judaism’s own mandate is “a process of constant evolution” and it “rejects any fixed, permanent set of beliefs, laws or practices.” In an attempt to alter the appearance and ritual of Judaism and to mimic German Protestantism, they stated that the old mechanisms of religious interpretation were obsolete and a new one had to be found. 

Hence Geiger sought a more coherent ideological framework to justify innovations in the liturgy and religious practice. Discrimination and persecution against Jews were rampant for the next hundred years in Germany. Works were hard to come by and such new interpretation made sense in a community struggling to survive. 

One characteristic of their progressive revelation was the institution of a “Second Sabbath” on Sunday, modeled on the Second Passover, as most people desecrated the day of rest. “If you cannot keep the Sabbath on its appointed time, you keep it on the next available day,” and so the Sabbath was shifted from Saturday to Sunday. “God would accept it,” they justify themselves and encourage each other.

America was opening up to immigrants and in a new Land of the Free, the five-day workweek soon made the Sunday Sabbath redundant. But nevertheless, the Movement had already had its momentum and today the Reform Movement’s largest center is in North America. 

Reform Judaism encourages adherents to seek their own means of engaging a new Judaism, enhancing “individualism.” Tolerance for LGBT and ordination of LGBT rabbis were also pioneered by the Movement. It started slowly then gathered speed. Intercourse between consenting adults was declared as legitimate by the Central Conference of American Rabbis in 1977, and openly gay clergy were admitted by the end of the 1980s. Same-sex marriage were sanctioned by the end of the following decade. In 2015 the Union for Reform Judaism (URJ) adopted a Resolution on the Rights of Transgender and Gender Non-Conforming People, urging clergy and synagogue attendants to actively promote tolerance and inclusion of such individuals.

If the 70 AD inferno was only a microcosm, a foretaste, how would the Reform Movement and its CoG Communities, who have similar deceptive beliefs as the original Sadducees and Boethusians, escape John’s warning during the Last Days? Isn’t this a return to the days of Sodom and Gomorrah? And also to share its fate? And why is it so coincidental that the end-time lackadaisical churches described as “wretched” and “blind” and “naked”? It’s an unpleasant descripture, but that’s what the Scriptures say.

How did the Sadducees just “disappeared” in 70 AD? Or is it a Judgment?

These Blind Guides may have grand aspirations but they are misguided! The Targum ireflects their nakedness. When placed against the end-time CoG Communities, it reflects their wretchedness. Woe unto the shepherds of Israel (the shepherds of the United States, Britain and related countries), says the Lord, for they feed themselves but not the sheep!

Although Ezekiel’s message was to both the “house of Israel” and the “house of Judah” its main message after chapter 24 was to the “house of Israel.” Captivities were the end results historically for both kingdoms, but today, the main focus in Ezekiel chapter 34 is on the Northern Kingdom with dire warning, especially its shepherds: 

Ezekiel 34:1 And the word of the Lord came unto me, saying,2 “Son of man, prophesy against the shepherds of Israel, prophesy and say unto them, ‘Thus saith the Lord God unto the shepherds: Woe to the shepherds of Israel that feed themselves! Should not the shepherds feed the flocks? 3 Ye eat the fat, and ye clothe yourselves with the wool, ye kill the ones that are fed; but ye feed not the flock. 4 The diseased have ye not strengthened, neither have ye healed that which was sick, neither have ye bound up that which was broken, neither have ye brought again that which was driven away, neither have ye sought that which was lost; but with force and with cruelty have ye ruled them. 5 And they were scattered because there is no shepherd, and they became meat to all the beasts of the field when they were scattered. 6 My sheep wandered through all the mountains and upon every high hill; yea, My flock was scattered upon all the face of the earth, and none did search or seek after them.

Adam Clarke: The prophet is commanded to declare the dreadful judgments of God against the covetous shepherds of Israel, who feed themselves, and not their flocks; . . . the using these tithes and offerings, not to enable them the better to fulfill the work of the ministry, but to pamper their own bodies, and support them in an idle voluptuous life . . . and maintain their own luxury and idolatrous prodigality . . . The fat sheep point out the rich to whom these pastors often disguised the truth, by a cruel condescension and complaisance . . . And the consequence was, grievous wolves, false and worldly interested teachers, seized on and made a prey of them.

“Say thou unto them, ‘Thus saith the LORD God: This burden concerneth the prince in Jerusalem and all the house of Israel that are among them.’ Say, ‘I am your sign: as I have done, so shall it be done unto them. They shall go into exile as captives.
“And they shall know that I am the LORD, when I shall scatter them among the nations and disperse them in the countries. But I will leave a few men of them from the Sword, from the Famine and from the Pestilence, 
that they may declare all their abominations among the nations whever they go; and they shall know that I am the LORD.” Ezekiel 12:10-11, 15-16

~~~~~

This is Part 3 of a five-part series on Wave Sheaf Offering, Pentecost or Shavuot

(1) A Critique of Frank Nelte’s Pentecost 
(2) A Critique of Wade Cox’s Wave Sheaf Offering
(3) A Critique of UCG’s Pentecost 
(4) A Critique of Fred Coulter’s Pentecost
(5) A Critique of John Ritenbaugh’s Pentecost

Pentecost has Two Concepts

•June 4, 2026 • Leave a Comment

Suspecting that ‘Pentecost’ is of 2 parts, I ask a Rabbi for confirmation.

Is it correct to say that Pentecost (Shavuot) has 2 concepts

(1) Fifty days after Passover until Sivan 6; that is 7 weeks plus one day; and

(2) on Sivan 6 itself, only one day

And a Rabbi replies,

Yes, that is a very accurate and insightful way to break down the dual nature of Pentecost (Shavuot). You are highlighting the structural tension that exists between the process of the holiday and the arrival of the holiday.

Historically and textually, Shavuot is unique because it is defined by both of these concepts simultaneously. Here is a breakdown of why your classification is correct:

Concept 1: The Linear Countdown (Process & Anticipation)

This concept is all about the journey. Unlike other biblical festivals that simply occur on a fixed calendar date (like Passover on Nisan 14), Shavuot is the only festival in the Torah that must be earned through an active, daily countdown.

  • The Command: Leviticus 23:15–16 commands the counting of seven complete weeks—49 days—plus one day, totaling 50 days.
  • The Spiritual/Agricultural Idea: This 50-day period binds Passover and Shavuot together as a single, unbroken unit. Passover is the physical liberation from Egypt, but the countdown shows that freedom is incomplete without the destination. Agriculturally, it tracks the exhausting, daily progression from the barley harvest to the wheat harvest.

Concept 2: Sivan 6 Itself (The Destination & The Event)

This concept focuses strictly on the arrival at the destination—the single, monumental day of the festival itself.

  • The Fixed Date: In the standard, calculated calendar used today, the 50th day always lands precisely on the 6th of Sivan. On this specific day, the counting stops, and a sacred assembly is held.
  • The Historical Event: While the 50-day count represents the journey through the wilderness, Sivan 6 represents the ultimate purpose of that journey: the arrival at Mount Sinai and the giving of the Torah (the Law). It is celebrated as a standalone, high holy day of rest, reflection, and the offering of the two loaves of leavened bread at the Temple.

Summary

Your breakdown is excellent because it captures both the mathematical framework and the theological meaning of the holiday:

ConceptNatureFocusTheme
(1) The 50 Days / 7 WeeksActive & LinearThe Journey & TransitionPhysical Liberation to Spiritual Readiness
(2) Sivan 6 (One Day)Static & FixedThe Destination & CovenantThe Revelation of God’s Word at Sinai

Without the 50-day countdown, Shavuot loses its context as the conclusion of Passover; without Sivan 6 itself, the countdown has no climax. They are two sides of the exact same coin.

~~~~~~

I would rate the above answer as excellent. It captures the premise in the New Testament, where the setting is described in Acts 2, just before the holy spirits were given, as “when the day of Pentecost was fully come” Acts 2. Most people fail to understand this.

~~~~~

Thrashed and Parched, then Sieving the ‘Wave Sheaf’ through 13 sieves
Olive Oil and Frankincese are added
Resulting in an Omer to be waved before the Lord

A Critique of Wade Cox’s Wave Sheaf Offering

•June 3, 2026 • Leave a Comment

A Critique of Wade Cox’s Wave Sheaf Offering 

Christian Churches of God
PO Box 369,
Woden ACT 2606,
Australia

Wade Cox, severely wounded fighting senselessly in Vietnam; as the War was built on a lie, Cox was complicit to those deceptions, fighting foolishly to Disable himself.

The Wave Sheaf OfferingNo. 106b (2014-05-18; 2020-04-11)

How to Count Pentecost — Feast of Harvest (Exodus 23:16), Feast of Weeks (Exodus 34:22), Feast of Firstfruits (Numbers 28:26), Festival of Fifty Days, Heptad, Feast of Heptads, Festival of Seven Heptads, Wave Sheaf, Omer

Wave sheaf—could this be the Omer? For English speakers, this certainly is.

This is a Critique of Wade Cox’s  Wave Sheaf Offering, Pentecost, the Feast of Weeks, or the Feast of Firstfruits. Counting to Pentecost is a very important topic, and we’ll be following it closely in every key point mentioned. Aside from the question of how to count, the main issue is understanding exactly what the Wave Sheaf Offering is. Are they the firstfruits, and what do the firstfruits mean if they are. Are they representing Christ or are they representing humans?

Quoted are Wade Cox’s transcript “Wave Sheaf Offering” posted on his website. They are indented, in PINK, and in block form so as to differentiate his from other comments. The Scriptures, in RED, must be our primary focus and guide, and sometimes the Scriptures, which include the Septuagint and the Targum, say things very different from what we think!

And so with that in mind, we’ll begin:

The Wave-Sheaf Offering needs to be kept in order to understand the full implications of Christ’s sacrifice and the power that he was given in terms of his resurrection from the dead. The Wave-Sheaf Offering is an ancient requirement of Israel within the Torah. The ordinance is found in Leviticus 23:9-14, and also in Exodus 29:24-25 and other texts. It is poorly understood by scholars and ignored by many (e.g. it is absent as a category in Schürer’s index in The History of the Jewish People in the Age of Jesus Christ). It is often thought of as being “done away,” as a part of the sacrificial aspects of the law. So why is it to be kept now? It is a day that commences the count to Pentecost. Whilst we don’t physically wave the sheaf of grain, we celebrate the acceptance of Christ before the Throne of God. In the same way we no longer sacrifice the animals at the Temple but we celebrate the actual days on which they were made. The days themselves represent aspects of the Plan of God fulfilled in Christ and the elect. The Wave Sheaf in like manner represents part of the Plan and part of the Story. (The Wave Sheaf Offering No. 106b)

Right from the start, Wade Cox has already made his conclusion before he has even started, that Christ’s sacrifice and his resurrection was the Wave-Sheaf Offering. And together with the CoG Communities, they started by establishing that the “Wave-Sheaf Offering” is the physical waving of the sheaf of grain, signifying “the acceptance of Christ before the Throne of God.” In fact, they accepted this as truth and then awkwardly worked backward.

At least it is “poorly understood by scholars” rather than been misconceived. Most importantly, Christ is always represented by the Lamb. If the wave sheaf represents Christ, then who represents the priest? In the most critical Scripture, the lamb is mentioned alongside with the ‘sheaf’ in Leviticus 23 but most have chosen to ignore its presence.

Once this link is established, these scholars work backward awkwardly. Any text or Scriptures that contradict this theme, they ignore or refute them.

First, let’s understand what the “wave sheaf” is. The original word is omer which is rendered “wave sheaf” in English translations, which gives a wrong impression.

The “wave sheaf” as firstfruits, must be reaped by three persons, each with his own sickle and basket, until each had his basket full. They then brought them to the courtyard of the Temple to be thrashed and parched and then to go through ALL of the thirteen sieves until it became very clean, and only one tenth the measure of the ‘omer’ were selected.

Second, the barley grain was cut by three people appointed by the Sanhedrin at the end of the “Sabbath.” The heads of the grain were then separated from the stalks and the removed grain was thrashed, parched with fire and ground into flour in the courtyard of the Temple that night. 

The resultant flour were then sieved through thirteenth sieves until it was pure and of very fine texture. Only ten percent of an ephah were chosen while the other ninety percent were rejected, but eaten by the priests.

From this, now known as the omer, oil and frankincense were added, which is a weight of about 1.6 kg (the same weight the children of Israel were allowed to collect for their morning manna Exodus 16:16), was taken and then offered the next morning at about 9 AM, the time of the morning sacrifice in the Temple as a special annual offering waved before God. Mishnah Menachot 10:3-4

Christ’s acceptance before the Father isn’t based on agricultural symbols like grains or firstfruits, but solely on the blood of a lamb or goat, as shown in the blood offering on the Day of Atonement, when blood was presented on the Mercy Seat inside the Holy of Holies.

The Wave-Sheaf Offering seems to have been waved at 9 a.m. on the Sunday morning within the Feast of the Passover. The general wave offering was brought by the worshipper and made in conjunction with the priest (Ex. 29:24-25). We know that the Samaritans and the Sadducees kept a Sunday Wave Sheaf and a Sunday Pentecost. That is an important factor in history. The Jews do not keep the Wave Sheaf because they keep a Sivan 6 Pentecost, which came from the traditions of the Pharisees in rabbinical Judaism after the Temple was destroyed. We know that the Samaritans keep the 14th and 15th and the concept of the Wave Sheaf, and count the Omer from Sunday within the Feast. So the Temple period structure and right throughout, including the Samaritans, always kept Pentecost on a Sunday. The early Church kept Pentecost on a Sunday. Only the Jews kept a Sivan 6, and only after the Temple was destroyed.(The Wave Sheaf Offering No. 106b)

The Samaritans, whom the Sadducees followed in most of their doctrines, were sun worshippers. They would face Mount Gerizim whenever they prayed, but during Passover on top of Mount Gerizim, at twilight, they would turn west to pray as the sun set. During the early era of the Second Temple period, these Samaritans infiltrated the Sadducees, and they would hide their beliefs have anything to do with Sun-worship.

It all started with the Samaritans . .

When figuring out the timing of the Wave Sheaf Offering, breaking its connection to the Sacrifice of the Lamb diminishes its significance. There’s no need to wait for some obscure Sunday to start the count—a peculiar idea the Samaritans picked up from Babylon. Making the Link as if of no importance is pure wickedness! Nor wonder, Jesus rebuked the Samaritans, “Ye worship ye know not what; we know what we worship, for salvation is of the Jews” John 4:22;

Okay that is old archaic English; below are more straight forward English

You Samaritans worship what you do not know. We worship what we do know, because salvation is from the Jews. John 4:22 CSBA

You Samaritans worship what you do not know. We Jews worship what we know, because salvation is from the Jews. John 4:22 DLNT

The Fourteenth marks the shedding of blood by the Lamb, the Fifteenth is the eating or partaking of the Sacrifice of the Lamb, leading to the Sixteenth, which, after trials and testings, begins the presentation of humans by a resurrected Lamb to the Father.

The Omer, composed originally of MANY individual grains, offered together, is the wave offering. If the omer represents Christ, why was it composed of many stalks of grains? It should be of one grain. Further, if the omer represents Christ, why the “he lamb” in Leviticus 23:12, which definitely have a greater claim to represent Christ, wasn’t waved:

Leviticus 23:9 And the Lord spoke unto Moses, saying,

10 “Speak unto the children of Israel and say unto them: ‘When ye come into the land which I give unto you and shall reap the harvest thereof, then ye shall bring a sheaf of the firstfruits of your harvest unto the priest.11 And he shall wave the sheaf before the Lord to be accepted for you; on the morrow after the Sabbath H7676 the priest shall wave it.

12 And ye shall offer that day when ye wave the sheaf a he lamb without blemish of the first year for a burnt offering unto the Lord.

This Lamb wasn’t waved! If waving represents acceptance by God in heaven, why this Lamb wasn’t waved?

Leviticus 23:19 Then ye shall sacrifice one kid of the goats for a sin offering, and two lambs of the first year for a sacrifice of peace offerings. 20 And the priest shall wave them with the bread of the firstfruits for a wave offering before the Lord with the two lambs; they shall be holy to the Lord for the priest.

Weird! If on the day of Pentecost, waving represents acceptance by God in heaven, why weren’t the “one kid of the goats” and “two lambs of the first year” waved? They should be waved along “with the bread of firstfruits” and gone into heaven and be similarly accepted by God in Heaven?

These end-time CoG Communities have produced many insightful interpretations of the Scriptures, but they are Blind Guides! In the first instance, they didn’t even notice the Lamb there! It is nice to believe that Christ was waved before the Throne of God, but where are the evidence? Not a single one is given. 

Christ’s sacrifice was accepted long ago, on the day the Paschal Lamb was slain. He died at 3 PM on the fourteenth of Nisan as “the sun was darkened” Luke 23:44–45

“And behold, the veil of the temple was rent in two from the top to the bottom, and the earth quaked and the rocks rent.
And the graves were opened; and many bodies of the saints who slept arose”
Matthew 27:51–52

When the fullness of Pentecost arrived, fifty days later, is an ordinance linked back to the Feast of the Passover, and controls both the timing of Pentecost and the presentation of the new harvests (Lev 23:9-14). To put it in its modern perspective, we should look at the significance and Sacrifice of Christ’s death, as the earth quaked and the heaven shook off its light; and the graves were opened and the saints leaped off.

In Summary, the Fourteenth marks the shedding of blood by the Lamb, the Fifteenth is the eating or partaking of the Sacrifice of the Lamb, leading to the Sixteenth, which, after trials and testings, begins the presentation of humans by a resurrected Lamb to the Father. And the Fiftieth is when the fullness of Pentecost has arrived.

The sign of Jonah had to be completed in all of its phases. The only sign that was given to Christ’s ministry was the sign of Jonah. Christ said that the function of three days and three nights in the belly of the whale or great fish of Jonah was the same as his ministry, and he would be three days and three nights in the belly of the Earth (as the great fish). The sign of Jonah is much more than three days and three nights in the belly of the fish. The sign of Jonah was related to the ministry to Nineveh, where there were three days consisting of one day’s journey into Nineveh  and two days preaching to Nineveh, and 40 days for repentance. Nineveh repented. Judah was given approximately three years under John the Baptist and the Messiah, and then 40 years to repent. Nineveh repented but Judah did not repent. (The Wave Sheaf Offering No. 106b)

And how did each sect met their judgement during the 70 AD Brimstones?

What a great observation! Yes, the city of Nineveh, upon repentence, was spared from destruction, but those in Jerusalem and the surrounding areas were burned like in Sodom and Gomorrah. Most, too, were destroyed, while others limped away and survived. Interesting. Who were those who escaped from the fire and brimstones of Sodom and Gomorroh? None, except three.

Let’s get back to a basic parable, a parable where the tares and wheat were growing together:

Matthew 13:24 Another parable put He (Jesus) forth before them, saying, “The Kingdom of Heaven is likened unto a man who sowed good seed in his field; 25 but while men slept, his enemy came and sowed tares among the wheat, and went his way. 26 But when the blades had sprung up and brought forth fruit, then appeared the tares also.

27 So the servants of the householder came and said unto him, ‘Sir, didst not thou sow good seed in thy field? From whence then hath come the tares?’ 28 He said unto them, ‘An enemy hath done this.’ The servants said unto him, ‘Wilt thou then have us go and gather them up?’

29 But he said, ‘Nay, lest while ye gather up the tares, ye root up also the wheat with them. 30 Let both grow together until the harvest, and in the time of harvest I will say to the reapers, “Gather ye together first the tares, and bind them in bundles to burn them, but gather the wheat into my barn.”

So as the wheat and tares grew together, the Pharisees and Sadducees thrived together. And forty years later, it was decision time — to put the tares into the fire. And who were those that met their fate during the fire and brimstones of the 70 AD inferno? Everyone seems to understate the significance of the destruction of Judea in 70 AD. Nobody equates it to sin as it was in Sodom and Gomorrah’s “a little taste of God’s judgment.” John the Baptist had given a stern warning about another consuming fire recorded in Luke 3:16. John warns with a prophetic taint:

Image result for jerusalem on fire ad 70

“I indeed baptize you with water; but One mightier than I cometh, the straps of whose shoes I am not worthy to unloose. He shall baptize you with the Holy Ghost and with FIRE. 17 His winnowing fan is in His hand, and He will thoroughly purge His floor and will gather the wheat into His garner; but the chaff He will burn with FIRE unquenchable.” Luke 3:16-17

Who died in the AD 70 inferno some 40 years after these warnings were given? Those burnt into ashes like Sodom and Gomorroh were the Sadducees and their allies — the Herodians and Boethusians. The Essenes (who practiced an anti-Sanhedrin calendar), also ended in the inferno. The Blind put no significance to John’s warning because they are blind. And why is it so coincidental that the end-time Laodicean church has been described as NAKED, WRETCHED and BLIND? If the AD 70 inferno were only a microcosm, how would the CoG Communities, who have similar misguided beliefs as the Sadducees and Boethusians, escape John’s warning during the Last Days?

Let’s take another look at the excerpt from Cox that was quoted earlier:

The Wave-Sheaf Offering seems to have been waved at 9 a.m. on the Sunday morning within the Feast of the Passover. The general wave offering was brought by the worshipper and made in conjunction with the priest (Ex. 29:24-25). We know that the Samaritans and the Sadducees kept a Sunday Wave Sheaf and a Sunday Pentecost. That is an important factor in history. The Jews do not keep the Wave Sheaf because they keep a Sivan 6 Pentecost, which came from the traditions of the Pharisees in rabbinical Judaism after the Temple was destroyed. We know that the Samaritans keep the 14th and 15th and the concept of the Wave Sheaf, and count the Omer from Sunday within the Feast. So the Temple period structure and right throughout, including the Samaritans, always kept Pentecost on a Sunday. The early Church kept Pentecost on a Sunday. Only the Jews kept a Sivan 6, and only after the Temple was destroyed. (The Wave Sheaf Offering No. 106b)

Reading the above, the smell of bird shits all over the place. In this paragraph alone, the word “Sunday” is mentioned six times. Today, it’s no coincidence as the CoG Communities cuddle with the Samaritan Sun-worship. When Daniel prayed his knee bent and he turned his face toward Jerusalem (Daniel 6:10).

But for the Samaritans, they turn their faces toward Mount Garizim whenever they pray, except during Passover on top of Mount Garizim, where, exactly at sunset, they turn West to pray at the setting down of the sun.

The Samaritans would deny they are sun worshippers, nor idol worshippers, but evidence show otherwise. Even while these people were pretending to worship the LORD, and made unto themselves from the lowest of them priests of the high places, they were in fact, serving their idols, their graven images, TO THIS DAY (and even in the 2020s), their children and grandchildren continue to do as their fathers did (II Kings 17:29-41). 

“So these nations feared the Lord, and also served their graven images, both their children and their children’s children: as did their fathers, so do they unto this day,” (II Kings 17:41)

It all started with the Samaritans . .

Hayyim Schauss points out that these Samaritans would go up to Mount Gerizim every year, and half an hour before sunset, as the 14th of Nisan draws to a close, their high priest leads the assembly in silent prayer:

Exactly at sunset the High Priest faces WESTWARD and reads that portion of the Pentateuch which orders the slaughtering of the Pesach sacrifice. About twelve or fourteen of the younger Samaritans busy themselves, meanwhile, with preparing the sacrificial animals. They form a circle about the pit of fire, holding the lambs between their legs, and as the High Priest utters the words, ‘And the whole assembly of the congregation of Israel shall kill it at dusk,’ they utter a benediction and throw the lambs, throats to the pit, where they are slaughtered by two ritual slaughterers. Six or seven sheep are slaughtered” (The Jewish Festivals, pg 63).

Their priest taught them a schismatic system to worship the Lord, the system imposed by King Jeroboam to wean his people away from the worship of the Jews and the Temple at Jerusalem. “Nevertheless, each national group made its own gods in the several towns where they settled, and set them up in the shrines the people of Samaria had made at the high places. . . . They pretended to worship the Lord as they appointed all sorts of people to officiate as priests in the shrines at their high places. Indeed, they were actually serving their own gods in accordance with the customs of the nations from which they had been brought from. 

Look at the photos above — the Samaritans are SUN worshippers. After sending the Northern Kingdom into exile in 721 BC, the king of the Assyrians brought the pagans from Babylon — Cuthah, Avah, Emath, and Sepharvaim — and placed them in Samaria. Today their modern followers would deny that they are SUN-worshipers and they would lie through their teeth that their beliefs are based in the Scriptures. So let’s continue with Wade Cox’s Samaritan version of his Wave Sheaf Offering:

Modern Judaism does not do this now. Pentecost was then counted from this day. This (the Sadduccean) position was held up until the destruction of the Temple in 70 CE (see F. F. Bruce, art. ‘Calendar’, The Illustrated Bible Dictionary, ed. by J. D. Douglas and N. Hillyer, IVP, 1980, Vol. 1, p. 225). After the dispersion, the Pharisaic position became the accepted practice, and the conflict is noted in the Mishnah (Hag. 2:4). After the dispersion, the Wave Sheaf was understood to be waved on the first Holy Day of Unleavened Bread, and Pentecost was then determined to fall on a fixed date, namely, Sivan 6. This practice was not followed during the days of the Temple priesthood and up until 70 CE and, hence, at the time of Christ. (The Wave Sheaf Offering No. 106b)

There are many problems with the above paragraph, but I’ll only mention the main ones. 

(a). The Targum could be traced all the way back much earlier than AD 70 to Ezra (480 BC – 440 BC). And the Targum states clearly that the counting is the morrow after the first festal day of Pascha:

And he shall uplift the sheaf before the Lord to be accepted for you. AFTER THE FIRST FESTAL DAY OF PASCHA (OR, THE DAY AFTER THE FEAST‑DAY OF PASCHA) on the day on which you elevate the sheaf, you shall make (the sacrifice of a lamb of the year, unblemished a burnt offering unto the Name of the Lord . . . 15 and number to you AFTER THE FIRST FEAST DAY OF PASCHA . . . (Leviticus 23:11-15, Jonathan)

(b) The Targum is like a mirror. When placed against the end-time CoG Communities, it reflects their nakedness. When the Jews returned from their exile in Babylon in the 6th century BC, most of them couldn’t speak Hebrew; they spoke Aramaic, but they still retained the Torah, which were read to them in Hebrew.

But the people couldn’t understand Hebrew. Something had to be done so that the people would understand God and His Word. The sages, starting with Ezra, found an answer. After hearing Ezra read a few verses of the Torah scroll in Hebrew, either he or other Levites translated it to Aramaic, hence it set the stage for the Aramaic version of the Bible, called a Targum, which simply means translation. Hence the Targum is an entrenched translation of the Hebrew Bible, first orally by Ezra for the returning Exiles in Judea, and was written or compiled from the Second Temple period until the later part of the first millennium.

“The Levites … instructed the people in the Law while the people were standing there.  They read from the Book of the Law of God, making it clear and giving the meaning so that the people understood what was being read.” (Nehemiah 8:7–8)

Nehemiah 8:7 NKJV says “and the Levites helped the people to understand the Law; and the people stood in their place. So they read distinctly from the book, in the Law of God; and they gave the sense, and helped them to understand the reading.”

The Targum translates and explains the counting of the wave sheaf from the Hebrew in Leviticus 23 into the vernacular, in a very simple language, and in verse 15 only the blind couldn’t see:

“And number to you after the first feast day of pascha from the day when you brought the sheaf for the elevation, seven weeks; complete they shall be. Until the day after the seventh week you shall number fifty days, and shall offer a mincha of the new bread unto the Name of the Lord.” Leviticus 23:15-16 Jonathan

This unique truth is captured by the GOD’S WORD Translation and the Wycliffe Bible (WYC)

Leviticus 23:15 “Count seven full weeks from the day after Passover (the day you bring the bundle of grain as an offering presented to the Lord) 16 until the day after the seventh week. This is a total of fifty days. Then bring a new grain offering to the Lord. GOD’S WORD Translation (GW

Leviticus 23:15 Therefore ye shall number from the other day of the sabbath, in which ye offered handfuls of the first fruits, seven full weeks, (And so ye shall count seven full weeks from the day after the sabbath, that is, after the Passover, in which ye offered the sheaves as a special gift,) (Wycliffe Bible)

These “seven weeks” do not have the same connotation as “seven Sabbaths” but have the same meaning as the “seven weeks” of Deuteronomy 16:9. They are both seven blocks of seven days, or heptad. So what is a heptad?  A heptad is a BLOCK OF SEVEN — either days or weeks — and a heptad can start on any day of the week.

We will get the timing of the Wave-Sheaf Offering from Leviticus 23.

Leviticus 23:9-14   And the LORD said to Moses, 10 “Say to the people of Israel, When you come into the land which I give you and reap its harvest, you shall bring the sheaf of the first fruits of your harvest to the priest; 11 and he shall wave the sheaf before the LORD, that you may find acceptance; on the morrow after the sabbath the priest shall wave it. 12 And on the day when you wave the sheaf, you shall offer a male lamb a year old without blemish as a burnt offering to the LORD. 13 And the cereal offering with it shall be two tenths of an ephah of fine flour mixed with oil, to be offered by fire to the LORD, a pleasing odor; and the drink offering with it shall be of wine, a fourth of a hin. 14 And you shall eat neither bread nor grain parched or fresh until this same day, until you have brought the offering of your God: it is a statute for ever throughout your generations in all your dwellings. (RSV)

As we have established at the beginning, the expression “wave sheaf” is also a mistranslation. It is “omer” in Hebrew, a finished product, not some freshly cut grains from the field. Secondly, the “wave sheaf” is made of MANY grains from a BUNDLE of barley plants? Of the bundle of grains only about ten percent made it to the end. Old and frankincense were added.

The Wave Sheaf offering represents human beings, that humans need to go through numerous trials and testings, to be acceptable before God. The priest represents Christ, not the other way round, who mediates before us, and for us as firstfruits. The omer as firstfruits have to go through ALL the thirteen sieves.

Only humans were required to go through numerous trials and testings, many fell by the waysides. “Thirteenth,” perhaps meaning these humans are principally from each of the thirteen tribes. The role of the Messiah was on a much higher plane — He was the sacrifice, the Passover Lamb, the Passover Sacrifice.

Jesus told many parables, but not a single one indicates he was a product of staple grains of the land, a firstfruits. He was always the Lamb, he was the “he Lamb” in Leviticus 23:12. And in parables, He was the husbandman, a landowner, the good shepherd, etc, but never was He portrayed as a firstfruits or produce of staple grains of the land.

The offering of the he-lamb and the waving of the first-fruits symbolised Christ as a first-fruit ascending into Heaven to his Father. Compare the passage concerning Mary Magdalene. In John 20:1,14-18, we find that Christ had waited that night. He was resurrected and he was waiting to ascend to the Father, and that ascension took place on the Sunday morning. The resurrection did not take place on Sunday morning at all; it took place on the Saturday night, and Christ waited until Sunday morning in readiness to ascend into Heaven. (The Wave Sheaf Offering No. 106b)

If waving symbolizes acceptance by the Father in heaven, why wouldn’t the he-lamb also be waved to signify the resurrected Christ? Why only the firstfruits were waved?

And, second, why would a resurrected Christ need to wait the entire night until morning, as if Heaven’s Throne were tied to the light of the earth? Why not immediately, why needing to wait, as though the Father wasn’t too eager to witness Christ’s triumph?

Did Christ go up to heaven and got a hug from the Father? When Moses went up to Mt Sinai to meet God, his face shone brightly when he returned, but why wasn’t Christ’s face shone after meeting His Father, neither his clothes glistened in white after His return? Was His seeing God inferior to that of Moses? Weird! 

See the source image

But when Jesus met His Father in heaven nothing happened.
No earthquake, no lightning, nothing!
When He returned, His disciples should have fallen backward.
“What happened?”
Not only did His face shone, but His whole garment too.
“Why is your face blaring at us?”
“Help! I can’t see, I’m blind.”
“I just came back from seeing my Father face-to-face. Don’t be afraid.”
No, nothing happened like this after being with God in Mount Sinai Exodus 34.

Also when there is a prophecy fulfilled, there is normally something supernatural accompanying it — lightning, earthquakes, darkening of days, etc. But there was none! Nothing! Something is obviously wrong! What happened? Was Jesus’ acceptance being delayed, or postponed? Or not accepted because a menstruating Mary had touched him?

John 20:15-17 Jesus said to her, “Woman, why are you weeping? Whom do you seek?” Supposing him to be the gardener, she said to him, “Sir, if you have carried him away, tell me where you have laid him, and I will take him away.” 16 Jesus said to her, “Mary.” She turned and said to him in Hebrew, “Rab-bo’ni!” (which means Teacher). 17 Jesus said to her, “Do not hold me, for I have not yet ascended to the Father; but go to my brethren and say to them, I am ascending to my Father and your Father, to my God and your God.” (RSV)

What would happen if Magdalene had touched Him? Would He be defiled? But numerous other translations say she held Him. Yes, she held Him.

Adam Clarke adds:

“Verse 17:  Touch me not – Μη μου ἁπτου, Cling not to me. APROMAI  has this sense in Job 31:7, where the Septuagint uses it for the Hebrew dabak, which signifies to cleave, cling, stick, or be glued to. . . . our Lord seems to have spoken to her to this effect:  ‘Spend no longer time with me now: I am not going immediately to heaven — you will have several opportunities of seeing me again: but go and tell my disciples, that I am, by and by, to ascend to my Father and God, who is your Father and God also.  Therefore, let them take courage.'”

Cambridge Greek writes:

17. μή μ. ἄπτου. This is a passage of well-known difficulty . . . the full meaning will therefore be, Do not continue holding Me, or simply, hold Me not. The old and often interrupted earthly intercourse is over; the new and continuous intercourse with the Ascended Lord has not yet begun: but that Presence will be granted soon, and there will be no need of straining eyes and clinging hands to realise it.

See the source image

Matthew 28:9 And as they (Mary Magdalene and other women) went to tell His disciples, behold, Jesus met them, saying, “All hail.” And they came, and held Him by the feet, and worshiped Him — that means, they had all touched Him. But Jesus’ face didn’t shine like Moses! What happened? Moses needed a veil to cover his face when he returned to face his people. Exodus 34:35.

And again, Jesus’ face didn’t shine when two disciples met Him on the road:

Luke 24:13 And behold, two of them were going that same day to a village called Emmaus, which was from Jerusalem about seven miles. 14 And they talked together of all these things which had happened.
15 And it came to pass that while they communed and reasoned together, Jesus Himself drew near and went with them.
16 But their eyes were held, that they should not know Him.
17 And He said unto them, “What manner of communications are these that ye have one to another as ye walk and are sad?”
18 And one of them, whose name was Cleopas, answering said unto Him, “Art thou only a stranger in Jerusalem, and hast not known the things which have come to pass there these days?”
19 And He said unto them, “What things?” And they said unto Him, “Concerning Jesus of Nazareth, who was a prophet mighty in deed and word before God and all the people;
20 and how the chief priests and our rulers delivered Him to be condemned to death and have crucified Him.
21 But we trusted that it had been He who should have redeemed Israel. And besides all this, today is the third day since these things were done.
22 Yea, and certain women of our company, who were early at the sepulcher, made us astonished.
23 And when they found not His body, they came saying that they had also seen a vision of angels, who said that He was alive.
24 And certain of those who were with us went to the sepulcher and found it even so as the women had said, but Him they saw not.”
25 Then He said unto them, “O fools, and slow of heart to believe all that the prophets have spoken!
26 Ought not Christ to have suffered these things and to enter into His glory?”
27 And beginning with Moses and all the prophets, He expounded unto them in all the Scriptures the things concerning Himself.
28 And they drew nigh unto the village whither they were going, and He made as though He would have gone further.
29 But they constrained Him, saying, “Abide with us, for it is toward evening and the day is far spent.” And He went in to tarry with them.
30 And it came to pass, as He sat at meat with them, He took bread and blessed it, and broke and gave it to them.
31 And their eyes were opened and they knew Him. And He vanished out of their sight.
32 And they said to one another, “Did not our hearts burn within us while He talked with us on the way and while He opened to us the Scriptures?”
33 And they rose up that same hour and returned to Jerusalem, and found the eleven gathered together and those who were with them,
34 saying, “The Lord has risen indeed and hath appeared to Simon!”
35 And they told what things were done on the way, and how He was known to them in the breaking of bread.

It would be a great opportunity for a risen Christ to tell His disciples He had been accepted by the Father, but He didn’t! Maybe He forgot!

The Septuagint, one that the NT writers used most often, is also a great testimony to the truth. It translates “on the morrow after the Sabbath” in the KJV as “on the morrow of the first day.” The first day is, of course, the first day of the Days of Unleavened Bread.

And the Targum states it even clearer: “After the first festal day of Pascha (or, the day after the feast‑day of Pascha).”

WHY WOULD WE IGNORE ALL THESE SCRIPTURES AS TESTIMONIES TO THE TRUTH?
UNLESS YOU’RE LIKE THOSE SIMILARLY STIFF-NECKED?

~~~~~

This is Part 2 of a five-part series on Wave Sheaf Offering, Pentecost or Shavuot

(1) A Critique of Frank Nelte’s Pentecost 
(2) A Critique of Wade Cox’s Wave Sheaf Offering
(3) A Critique of UCG’s Pentecost 
(4) A Critique of Fred Coulter’s Pentecost 
(5) A Critique of John Ritenbaugh’s Pentecost

A Critique of Frank Nelte’s Pentecost 

•June 1, 2026 • Leave a Comment

A Critique of Frank Nelte’s Pentecost 

Frank W Nelte, Ex-WCG Minister

Frank attended the Bricket Wood campus of the defunk Ambassador College in the 1960s and upon graduation in 1971, was hired by the now non-existing Worldwide Church of God to pastor several congregations in South Africa until early 1994, when he was sacked…

When Should We Keep Pentecost? — (January 1998)

How to Count Pentecost

Wave Sheaf, Wave Sheaf Offering, Pentecost, Feast of Weeks, Feast of Firstfruits, Heptad, Feast of Heptads, Wave Sheaf, Omer

This is a Critique of Frank Nelte’s Pentecost, the Feast of Weeks, or the Feast of Firstfruits. The Counting to Pentecost is an extremely important subject and we’ll follow it in every point discussed. Besides the main issue of when to start counting is how restrictive is the term “Sabbath.” Is it restricted only to a weekly Sabbath or was it meant to be an annual Sabbath, the first day of Unleavened Bread, the morrow before the 16th of Nisan.

Quoted are Frank Nelte Bible Study article “When Should We Keep Pentecost?” posted on his website, dated January 1998. They are in dark pink, indented and in block form so as to differentiate his from other comments. The Scriptures, in red, must be our primary focus and guide, and sometimes the Scriptures, which include the Septuagint and the Targum, say things very different from what he assumes! 

And so with that in mind, we’ll begin:

It’s worth noting that Jewish culture has developed many customs without direct biblical roots, yet there are also numerous traditions that are truly wonderful.

Most people do not understand that Hebrew as a spoken language had basically DIED OUT long before the year 1800 A.D.! Two thousand years ago the Jews had already abandoned speaking Hebrew in favour of speaking Aramaic. Even Jesus Christ conducted His whole ministry in the Aramaic language. Christ’s final words, as He was dying on the stake, were in Aramaic. They were “Eli, Eli, lama sabachthani” (Matthew 27:46), or as recorded by Mark “Eloi, Eloi, lama sabachthani” (Mark 15:34). (When Should We Keep Pentecost?)

Typical of those who studied and graduated from Ambassador College, they made a superficial observation, jumped to a conclusion right away, and then worked backward. Obviously the above are false on many fronts. The writer shows his hatred for the Jews more than a cool headed willingness to find the truth. The Hebrew Gospel of Matthew by George Howard testifies that the original was written in Hebrew.

Another book “Understanding the Difficult Words of Jesus” by David Bivin and Roy Blizzard, has been devoted to understanding the structure of poetry, and literal translations of Hebrew idioms which involve the case for claiming that Jesus spoke and taught in Hebrew instead of Greek or Aramaic and that the synoptic gospels (Matthew, Mark and Luke) were originally written in Hebrew, and when translated caused formidable problems for translators, resulting in the text that makes little sense to English (or even Greek) readers. 

Second, many of Christ’s sayings that have in the past been difficult to understand were presented and analyzed in the light of their Hebrew origins. The authors explain that lack of knowledge of Hebrew literary forms, especially the structure of poetry, and literal translations of Hebrew idioms caused formidable problems for translators, resulting in text that makes little sense to English (or even in Greek) readers. So, according to the authors, Hebrew, is the language that needs to be understood to correctly interpret the teachings of Christ in the synoptic gospels. This approach would yield a clearer understanding of the sayings of Christ that are puzzling or confusing, thus making the gospels much more readable. 

Third, had Hebrew been forgotten and DIED OUT two thousand years ago, how could the Aleppo Codex being developed, which were formulated around the ninth or tenth century? If they have forgotten how to read Hebrew, how could they remember suddenly to incorporate the vowels and turn it into the Masoretic Text? So much lying, deceits and bullshit! 

Now if we want to be clear about the meanings GOD attached to specific Hebrew words, then the best way to establish this is to look at ALL the places where God has inspired those specific words to be used. When any word is used a large number of times, then in most occurrences the intended meaning will be quite plain and easy to discern from the context.

When a Hebrew Dictionary CLAIMS that a certain word had a secondary meaning in biblical times, which meaning is NOT supported by actual usage ANYWHERE in the whole Old Testament, then this claim must be questioned. Is the claim perhaps based on a preconceived false interpretation of some biblical teaching? Is the claim perhaps made in order to support a non-biblical “tradition of the elders”? WHY is this claim made when there is no biblical usage anywhere in the entire Old Testament to support this claim?

THE HEBREW WORD “SHABUWA”:

Of the 20 times this word is used in the Old Testament, in the KJV it is 19 times translated as “week/s” and one time as “SEVEN”. That one place is Ezekiel 45:21.

In the first [month], in the fourteenth day of the month, ye shall have the passover, a feast of SEVEN DAYS; unleavened bread shall be eaten. (Ezekiel 45:21)

An examination of the 9 occurrences in the above-quoted 8 verses should make it quite clear that THIS is indeed the Hebrew word for “week” and “weeks”. This word really has no other meanings! It is NEVER used in any way to IMPLY any other meaning! Moses, who wrote the first five books of the Old Testament, was obviously familiar with this word. (When Should We Keep Pentecost?)

This is very true, and you don’t wait for a few days till the weekly Sabbath to start along with Shabuwa (H7620). The important point is that it starts IMMEDIATELY.

The critical verse is in Deuteronomy 16:9 “Seven weeks H7620 shalt thou number unto thee: begin to number the seven weeks H7620 from such time as thou beginnest to put the sickle to the corn. 

Deuteronomy 16:9 Seven weeks [H7620 shabua] — Strong translates shabua as seven, period of seven (days or years), heptad, week:

A. period of seven days, a week — Feast of Weeks or Heptads
B. heptad, seven (of years)

In the Scriptures there are a total of nine times (out of 20) where Shabua H7620 is used to designate Pentecost. Here they are:

(1) Exodus 34:22 And thou shalt observe the Feast of Weeks, H7620 of the firstfruits of wheat harvest, and the feast of ingathering at the year’s end. Feast of Weeks (each a block of seven)

(2) Numbers 28:26 “‘Also on the day of the firstfruits, when ye bring a new meat offering unto the Lord, after your weeks H7620 be out, ye shall have a holy convocation. Ye shall do no servile work. — after seven blocks of sevens

(3,4,5) Deuteronomy 16:9-10Seven weeks H7620 shalt thou number unto thee: begin to number the seven weeks H7620 from such time as thou beginnest to put the sickle to the corn. 10 And thou shalt keep the Feast of Weeks H7620 unto the Lord thy God with a tribute of a freewill offering of thine hand, which thou shalt give unto the Lord thy God according as the Lord thy God hath blessed thee. — seven blocks; Feast of Weeks (each a block of seven)

(6) Deuteronomy 16:16 Three times a year shall all thy males appear before the Lord thy God in the place which He shall choose: in the Feast of Unleavened Bread, and in the Feast of Weeks, H7620 and in the Feast of Tabernacles. And they shall not appear before the Lord empty. — Feast of Weeks (each a block of seven) 

(7) II Chronicles 8:13 according to a certain rate every day, offering according to the commandment of Moses on the Sabbaths and on the new moons and on the solemn feasts, three times in the year: on the Feast of Unleavened Bread and on the Feast of Weeks H7620 and on the Feast of Tabernacles. — Feast of Weeks (each a block of seven) 

(8) Jeremiah 5:24 Neither say they in their heart, Let us now fear the LORD our God, that giveth rain, both the former and the latter, in his season: he reserved unto us the appointed weeks H7620 of the harvest. — Feast of Weeks (each a block of seven) 

(9) Ezekiel 45:21 In the first month, in the fourteenth day of the month, ye shall have the passover, a feast of seven H7620 days; unleavened bread shall be eaten. — the days of unleavened bread didn’t wait until the following weekly sabbath to start counting the seven days

All the above show that the Feast of Weeks could also be called the Feast of Heptads. However, the important point is that it starts IMMEDIATELY, not waiting even a day. This is shown best below:

Ezekiel 45:21 In the first month, in the fourteenth day of the month, ye shall have the passover, a Feast days (a block of seven) H7620; unleavened bread shall be eaten. — this Scripture, among others, establishes that Passover is a composite feast, a feast of seven days, where unleavened bread is eaten; this is the most obvious example where it occurs IMMEDIATELY and is not connected to the weekly sabbath; and there’s not need to wait till the weekly sabbath to start.

The Aleppo Codex was developed around the ninth or tenth century, when Rabbinic Jews added vowels and transformed it into the Masoretic Text.

And here we have a non-Feast of Weeks example:

Leviticus 12:5 But if she bears a daughter, then she shall be unclean two weeks H7620  as in her separation: and she shall continue in the blood of her purifying threescore and six days. — two weeks, this occurs IMMEDIATELY after birth and not waiting until the weekly sabbath to start counting the two weeks of uncleanliness.

The Feast of Unleavened Bread follows Passover immediately without waiting for even a day. 

THE HEBREW WORD “SHABBATH”

This word “shabbath” is used 108 times in the Old Testament. It is thus quite common. Another word, which has been formed from this word “shabbath”, is the word “shabbathown”, which is used 11 times in 10 different verses, all 11 occurrences being in the books of Exodus and Leviticus. This word “shabbathown” is translated (in the KJV) 8 times as “REST” and 3 times as “SABBATH”. It is an intensive form of the word for “rest” and that is precisely what it means … EMPHATIC REST!

And ye shall count unto you from the morrow AFTER THE SABBATH, from the day that ye brought the sheaf of the wave offering; SEVEN SABBATHS shall be complete: (Leviticus 23:15)

Even unto the morrow AFTER THE SEVENTH SABBATH shall ye number fifty days; and ye shall offer a new meat offering unto the LORD. (Leviticus 23:16) (When Should We Keep Pentecost?)

Strong designates the word ‘sabbath’ H7676 108 times using various terms to include

(a) sabbath, (b) day of atonement, (c) sabbath year, (d) week, (e) produce (in sabbath year). Note that the term “week” is also included as one of its uses.

The ambiguity of the phrase “from the morrow after the Sabbath” has offered much confusion over the millennium. Unfortunately, the English Masoretic Text doesn’t provide an easy answer. But fortunately the Septuagint, one that the NT writers used most often, helps in presenting the truth. It translates “on the morrow after the Sabbath” as “on the morrow of the first day.” 

“And the Lord spoke to Moses, saying, Speak to the children of Israel, and thou shalt say to them, When ye shall enter into the land which I give you, and reap the harvest of it, then shall ye bring a sheaf, the first-fruits of your harvest, to the priest; and he shall lift up the sheaf before the Lord, to be accepted for you. On the morrow of the first day the priest shall lift it up” Leviticus 23:9-11 Septuagint

The first day is, of course, the first day of the Days of Unleavened Bread. And the morrow after the fifteenth is, of course, the sixteenth! Thus count from the sixteenth!

And this understanding is confirmed by the Scripture in the Masoretic Text, the JPS1917

“And they did eat of the produce of the land on the morrow after the Passover, unleavened cakes and parched corn, in the selfsame day. And the manna ceased on the morrow, after they had eaten of the produce of the land; neither had the children of Israel manna any more; but they did eat of the fruit of the land of Canaan that year” Joshua 5:11-12 JPS1917

And secondly, this is backed up by the Targum which states it even clearer. To ignore any of these Scriptures as testimonies to the truth is to ignore to its demise!

“And he shall uplift the sheaf before the Lord to be accepted for you. After the first festal day of Pascha (or, the day after the feast‑day of Pascha) on the day on which you elevate the sheaf . . . And number to you after the first feast day of Pascha, from the day when you brought the sheaf for the elevation, seven weeks; complete they shall beLeviticus 23:11-12, 15 Jonathan.

— finally, an important concept is that Christ’s acceptance before the Father isn’t based on agricultural symbols like grains or firstfruits, but solely on the blood of a lamb or goat, as shown in the blood offering on the Day of Atonement, when blood was presented on the Mercy Seat inside the Holy of Holies. This naturally connects to the day the Pascha-Lamb was killed—on the fourteenth;

— to break the Link back to the Sacrifice of the Lamb is to trivialize its importance, NOT waiting for some obscure SUNday to begin the Count, a strange concept the Samaritans brought with them from Babylon! Making the Link as if of no importance is pure wickedness! Nor wonder, Jesus rebuked the Samaritans, “Ye worship ye know not what; we know what we worship, for salvation is of the Jews” John 4:22.

The Fourteenth marks the shedding of blood by the Lamb, the Fifteenth is the eating or partaking of the Sacrifice of the Lamb, leading to the Sixteenth, which, after trials and testings, begins the presentation of humans by a resurrected Lamb to the Father.

Same thing, the day “after the feast-day of Pascha” is, again, the sixteenth! Its significance relies upon the Shedding of Blood by the Lamb, on the Fourteenth. The evidence from both the Septuagint and Targum are overwhelming. At times they are superior to the Masoretic Text. Here is an example:

How do you solve the problem of Genesis 15 where it says 400 years and in Exodus 12 says 430 years? Is there an error? Also, how does this tie into the age of Isaac when he was offered as the burnt offering? So where do we begin?

Genesis 15:12 And when the sun was going down, a deep sleep fell upon Abram; and, lo, an horror of great darkness fell upon him. 13 And he said unto Abram, Know of a surety that thy seed shall be a stranger in a land that is not theirs, and shall serve them; and they shall afflict them four hundred years (Masoretic KJ)

Exodus 12:40 Now the sojourning of the children of Israel, who dwelt in Egypt, was four hundred and thirty years (Masoretic KJ)

The Masoretic Text above says “in Egypt” but the Septuagint read “Egypt and Chanaan.” Chanaan is Canaan

From the Septuagint:

Genesis 15:12 And about sunset a trance fell upon Abram, and lo! a great gloomy terror falls upon him. 13 And it was said to Abram, Thou shalt surely know that thy seed shall be a sojourner in a land not their own, and they shall enslave them, and afflict them, and humble them four hundred years (Septuagint)

Exodus 12:40 And the sojourning of the children of Israel, while they sojourned in the land of Egypt and the land of Chanaan, [was] four hundred and thirty years (Septuagint)

From the Targum:

Genesis 15:13 And he said to Abram, Knowing, thou must know, that thy sons shall dwell in a land not their own, because thou hast not believed, and they will subjugate and afflict them four hundred years; and also that the people whom they shall serve I will judge with two hundred and fifty plagues, and afterwards they shall go forth into liberty with great riches. (Targum) — “dwell in a land not their own” is Canaan and Egypt, for the land of Canaan were not yet given to the seed of Abraham then;

Exodus 12:40 And the days of the dwelling of the sons of Israel in Mizraim were thirty weeks of years, (thirty times seven years,) which is the sum of two hundred and ten years. But the number of four hundred and thirty years (had passed away since) the Lord spoke to Abraham, in the hour that He spake with him on the fifteenth of Nisan, between the divided parts, until the day that they went out of Mizraim. And it was at the end of thirty years from the making of this covenant, that Izhak was born; and thence until they went out of Mizraim four hundred (years), on the selfsame day it was that all the hosts of the Lord went forth made free from the land of Mizraim. (Targum) — the children were only 210 years in Egypt; but since God spoke to Abraham much earlier, 430 years; and since Isaac was born, were 400 years.

Abraham (75 years old when he left Ur for Caanan: Gen 12:4; was 100 when Isaac was born: Gen 21:5) If the Covenant was made 30 years before Isaac was born, then Abraham would be 70 years old, i.e. when he probably had just arrived to live in the land of Canaan, to be inclusive of “in a land not their own,” for the land was not yet given.

Isaac (60 years old when he had Jacob: Gen 25:26)

See the source image
“Suddenly a sound like the blowing of a violent wind came from heaven and filled the whole house where they were sitting. They saw what seemed to be tongues of fire that separated and came to rest on each of them” Acts 2:1-4

Jacob (130 years old when he entered Egypt: Gen 47:9. When Jacob descended to Egypt at the age of 130, 190 years of the 400 years had already passed, thus leaving 210 years. This is the number of years that the Israelites lived in Egypt.

Levi (137 years old: Ex 6:16)
Kehath (133 years old: Ex 6:18)
Amram(137 years old: Ex 6:20)
Moses (80 years old when God called him: Ex 7:7; a fourth generation: Gen 15:16)

To elaborate the problem with the Masoretic text, presuming that Kehath was even only one day old when entering Egypt, he is recorded as living 133 years (Ex. 6:18). Kehath’s son is Amram who lives 137 years (Ex. 6:20) of which some presumably overlap with those of his father Kehath. Amram’s son is Moses who is 80 when standing before Pharaoh (Ex. 7:7) – presumably some of those years overlap with his father Amram’s years. Even without the issue of overlapping years, the total maximum number of years would only be 133 + 137 + 80 = 350 years. This would mean that even if Kehath entered Egypt on the first day of his life, had Amram on the last day of his life, and who, in turn, had Moses on the last day of his life, the longest period of time that the nation could have been in Egypt is 350 years.

Genesis 15:13 And he (God) said unto Abram, Know of a surety that thy seed shall be a stranger in a land that is not theirs, and shall serve them; and they shall afflict them four hundred years;

The count of the 400 years as recorded in Genesis 15:13 should start with the birth of Isaac. Isaac was 60 years old when he had Jacob (Gen. 25:26) and Jacob was 130 when standing before Pharaoh (Gen. 47:9). Therefore, when Jacob descended to Egypt at the age of 130, 190 years of the 400 years had already passed, thus leaving 210 years. This is the number of years that the Israelites lived in Egypt.

Therefore the Masoretic KJV of 430 years of “dwelling in Egypt” is a BLATANT ERROR. The Septuagint and the Targum gives an accurate account, but the Targum translates and elucidates with great insights. 

The Targum is like a mirror. When placed against the end-time CoG Communities, it reflects their emptiness. When the Jews returned from their exile in Babylon in the 6th century BC, most of them couldn’t speak Hebrew; they spoke Aramaic, but they still retained the Torah, which were read to them in Hebrew. Something had to be done so that the people would understand God and His Word. 

Starting with Ezra, the new communities found an answer. After hearing Ezra read a few verses of the Torah scroll in Hebrew, either he or other Levites translated it to Aramaic, hence it set the stage for the Aramaic version of the Bible, called a Targum, which simply means translation. Hence the Targum is an entrenched translation of the Hebrew Bible that was written or compiled in Judea from the Second Temple period until the early Middle Ages (late first millennium).

“The Levites … instructed the people in the Law while the people were standing there. They read from the Book of the Law of God, making it clear and giving the meaning so that the people understood what was being read” (Nehemiah 8:7–8)

Nehemiah 8:7-8 NKJV … and the Levites helped the people to understand the Law; and the people stood in their place. So they read distinctly from the book, in the Law of God; and they gave the sense, and helped them to understand the reading.

So they read in the book of the lawand gave the sense — i.e., they read and translated the meaning of the Hebrew words, and expounded them in the common language. And caused them to understand the reading — So they gave them both a translation of the Hebrew words, into the Chaldee or Syriac, and an exposition of the things contained in them, and of the duty incumbent upon the people by virtue thereof; to declare and teach these things were a great part of the duties of both priests and Levites.

Adam Clark comments on Nehemiah 8:8: I beg leave to make a few observations: – So they read in the book in the law of God distinctly, and gave the sense, and caused them to understand the reading . . . but it appears that they had in general lost the knowledge of the ancient Hebrew to such a degree, that when the book of the law was read, they did not understand it: but certain Levites stood by, and gave the sense, i. e., translated into the Chaldee dialect. This was not only the origin of the Chaldee Targums, or translation of the law and prophets into that tongue but was also, in all probability, the origin of preaching from a text; for it appears that the people were not only ignorant of their ancient language, but also of the rites and ceremonies of their religion, having been so long in Babylon, where they were not permitted to observe them. This being the case, not only the language must be interpreted, but the meaning of the rites and ceremonies must also be explained . . . 

John Gill comments on the above “they first read it in Hebrew, and . . . not hereby how to read it, but chiefly to understand what was read, that they might clearly know their duty to God and men.”

Ezra and those with him expounded obscurer passages, and in doing so naturally translated into the vernacular Aramaic dialect. This simply explains the former: they expounded as they read. They gave the meaning though the scriptures on how Ezra and those with him would understand the meaning from the Torah. 

THEREFORE IF GOD INTENDED FOR US TO “COUNT” FROM THE DAY AFTER THE FIRST DAY OF UNLEAVENED BREAD:
THEN SOMETIMES we would have to count “1 week” as being:

– from a Monday to the following Sunday; or
– from a Wednesday to the following Tuesday; or
– from a Friday to the following Thursday; or
– from a Sunday to the following Saturday. (When Should We Keep Pentecost?)

This is correct. Pentecost is never called the Feast of Sabbaths, it’s the Feast of Weeks, or Feast of Heptads (blocks of seven days). The Feast of Weeks could start at any day of the week. The best illustration is Ezekiel 45:21 where the seven-day Feast of Unleavened Bread could start at any time of the week — it DOESN’T HAVE TO WAIT UNTIL THE WEEKLY SABBATH TO START!. 

How could God possibly tell us: “counting FROM A WEDNESDAY TO THE FOLLOWING TUESDAY, COUNT SEVEN FULL WEEKS, COMING TO THE SEVENTH TUESDAY, AND THEN GO TO THE MORROW AFTER THAT TUESDAY TO ARRIVE AT A WEDNESDAY PENTECOST”?? How could God possibly refer to a period of time from a Wednesday to the following Tuesday as “A SHABBATH”?? (When Should We Keep Pentecost?)

Look at Ezekiel 45:21 again: In the first month, in the fourteenth day of the month, ye shall have the passover, a Feast of Weeks (Haptads) H7620 days; unleavened bread shall be eaten. — the seven days of Unleavened Bread starts any day IMMEDIATELY after Passover, so it could be a Monday, a Wednesday, a Friday or a Sunday. By your double question marks above, it demonstrated the opposite of what you intended, that the “Sabbath” could be translated as “weeks” as Strong shows below:

A. period of seven days, a week — Feast of Weeks or Heptads; B. heptad, seven (of years)

Leviticus 23:15-16 seven sabbaths [h7676 shabbat] according to Strong, this shabbat could be translated as:

(a) sabbath
(b) day of atonement
(c) sabbath year
(d) WEEK
(e) produce (in sabbath year)

James Strong (1822 – 1894)

According to Strong, both shabua (H7620) and sabbath (H7676) could be translated as weeks. Has Frank Nelte had a higher level of Hebrew degree at the uncredited Ambassador College than Strong’s? Who were his Hebrew lecturers at the now defunct Ambassador College can we ask him? James Strong was both acting President and Professor of Biblical Literature at Troy University; Professor of Exegetical Theology at Drew Theological Seminary, and was honored with a degree of Doctor of Laws (LL.D.) by Wesleyan University in 1881. 

And Strong’s definition allows the JPS 1917 and many other translators to transcribe the seven Sabbaths as seven WEEKS:

Leviticus 23:15 And ye shall count unto you from the morrow after the day of rest (footnote: Sabbath), from the day that ye brought the sheaf of the waving; seven weeks shall there be complete; 16 even unto the morrow after the seventh week shall ye number fifty days; and ye shall present a new meal-offering unto the LORD. (JPS 1917)

Other versions that translated “seven weeks” in Leviticus 23:15 are:

The Companion Bible (Bullinger)
Common English Bible (CEB)
Complete Jewish Bible (CJB)
Contemporary English Version (CEV)
Christian Standard Bible (CSB)
Darby Translation (DARBY)
Easy-to-Read Version (ERV)
English Standard Version (ESV)
Expanded Bible (EXB)
GOD’S WORD Translation (GW)
Good News Translation (GNT)
Holman Christian Standard Bible (HCSB)
International Children’s Bible (ICB)
International Standard Version (ISV)
Lexham English Bible (LEB)
The Message (MSG)
Modern English Version (MEV)
Names of God Bible (NOG)
New American Bible (Revised Edition) (NABRE)
New Century Version (NCV)
New English Translation (NET Bible)
New International Version (NIV)
New Life Version (NLV)
New Living Translation (NLT)
Revised Standard Version (RSV)
The Voice (VOICE)
Wycliffe Bible (WYC)
The Septuagint (LXX
The Targum Jonathan

Adam Clarke comments on “Ye shall count unto you – seven Sabbaths” – “That is, from the sixteenth of the first month to the sixth of the third month. These seven weeks, called here Sabbaths, were to be complete, i. e., the forty-nine days must be finished, and the next day, the fiftieth, is what, from the Septuagint, we call pentecost.”

Frank Nelte, a graduate of the defunk Ambassador College

DO JEWISH CUSTOMS AND AUTHORITIES STICK TO THE BIBLE?

If you are on the lookout for it, it is quite easy to find evidence that the Jews actually do not stick to what is revealed in the Bible at all. It is fairly easy to discover that for the Jews TRADITION is of far higher importance than what God actually instructed in the Old Testament. (When Should We Keep Pentecost?)

Some of their traditions are bad, but some are great. Only the wise know how to separate the good from the bad. The stupid renders all traditions as bad. Here is what Paul says:

“I profited in the Jews’ religion beyond many of my equals in mine own nation, being more exceedingly zealous for the traditions of my fathersGalatians 1:14.

“Therefore, brethren, stand fast and hold to the traditions which ye have been taught, whether by word or our epistle” II Thessalonians 2:15.

Paul, being a Pharisee, and son of a Pharisee’ and in all thirteen epistles are littered with Pharisaic precepts. He grew up and was “zealous for the traditions of my fathers” – namely, those of the Pharisees, bred up at the feet of Gamaliel. “Tradition (paradosis) embraces everything which is handed down orally or in writing from generation to generation,” says the Schaff’s Commentary.

Second, if traditions are always untrustworthy, then the Masoretic vowel points should also be considered untrustworthy. They are based on oral knowledge and traditions and should be rejected, because how to read any single Hebrew word comes from oral knowledge. Plain and Simple!

In the March 1992 edition of “Prophecy Flash” Mr Dankenbring has an article entitled “A Letter to the Chief Rabbi, London – on Passover and Pentecost”, and another article entitled “Reply from the Office of the Chief Rabbi”. This second article is interesting in that it clearly reveals the Jewish thinking. The last two paragraphs of that article are most revealing.

Firstly, the “Chief Rabbi” points out that

“… according to the Sadducees, PENTECOST WOULD ALWAYS FALL ON A SUNDAY”. (my emphasis)

THIS IS A STAGGERING ADMISSION!

During the time of Jesus Christ the Pharisees controlled the local synagogues, but THE SADDUCEES CONTROLLED THE TEMPLE AND THE TEMPLE WORSHIP! The priests, with very few exceptions, were Sadducees!

Therefore during the time of Christ Pentecost at the Temple in Jerusalem was always observed on a Sunday … and this information is given to us by the “Chief Rabbi” (Christ said to call no man ‘Rabbi’!) of London, England. Thus, when Christ observed the Day of Pentecost and when the disciples observed it at the Temple in Acts chapter 2, IT WAS ON A SUNDAY!

Frank W Nelte, a sacked WCG Minister

But continue reading this “reply from the office of ‘the chief rabbi'”. Notice the last paragraph of that article – it’s only six-and-a-half lines long. How did the Pharisees try to argue with the Sadducees? Notice! [The parenthetical statements are my comments.]

“The Pharisees … tried to do this from text [i.e. they tried by using THE OLD TESTAMENT SCRIPTURES!] WITHOUT relying on the oral traditions, [what “oral traditions”? – the ones Christ addressed in Matt 15:1-3 and Mark 7:8-9?] since their adversaries were not ready to accept all of the oral tradition [i.e. the Sadducees said: unless it’s in the Bible, we don’t believe it].”

But now notice this candid admission concerning pharisaical teachings:

“But the real reason they [i.e. the Pharisees] insisted on this interpretation [Pentecost on the 6th of Sivan] is based on two factors …”

WHAT ARE THOSE TWO FACTORS THAT DETERMINE PHARISAICAL BELIEFS?? God’s Word? the Bible? NO!! Continue with the quote:

“…1) The oral tradition which [they falsely claimed!] had come down from Moses’ time which they maintained and passed on; 2) Logic which dictated that …” (When Should We Keep Pentecost?)

Who was that “Chief Rabbi” of London who wrote “… according to the Sadducees, PENTECOST WOULD ALWAYS FALL ON A SUNDAY.”  Actually there is nothing wrong with what he wrote. The truth is that no sensible Orthodox Rabbi would be so naive as to claim such a thing as the truth. He only wrote that “according to the Sadducees, Pentecost would always fall on a Sunday.” The Rabbi didn’t say that’s what he believes nor that that is the truth. If the “Chief Rabbi” believes such is the truth, the only possibilities are that he is either a rabbi from (a) a Karaite Organisation, or (b) one from a Reform Movement. 

Both the Karaites and Reform Jews have Sadducaic leaning. And they, of course, claim that during the first century, the Sadducees had control over the Temple functions. But Josephus, the first century Jewish historian, wrote in his Antiquities of the Jews, informing us that the Pharisees were the dominant religious party in Judaea during the time of Christ, and that although they controlled the Temple, they followed the Pharisaic precepts, because they fear the people.

Josephus wrote:

The common people followed the Pharisees. And although the Sadducees were occupying the upper stratum of the Jewish aristocracy, they were few and unable and unwilling to carry out their own beliefs in the Temple service, but to carry “the notions of the Pharisees”:

But the doctrine of the Sadducees is this: That souls die with the bodies; nor do they regard the observation of any thing besides what the law enjoins them; for they think it an instance of virtue to dispute with those teachers of philosophy whom they frequent: but this doctrine is received but by a few, yet by those still of the greatest dignity. But they are able to do almost nothing of themselves; for when they become magistrates, as they are unwillingly and by force sometimes obliged to be, they addicted themselves to the notions of the Pharisees, because the multitude would not otherwise bear them. (Antiquities 18,1,4)

The Sadducees that controlled the Temple – “Disappeared” during the AD 70 Inferno!

Also, the Unger’s Bible Dictionary tells us further political-religious amalgamation called the Sadducees:

And keeping the Oral Knowledge and Traditions could be true and valid. The Talmud tells the story of a Gentile who went to Hillel the Elder and said to him, “I want to convert, but I want to accept only the Written Torah, and not the Oral Torah. I don’t wish to accept the words of the Rabbis. So teach me only the Written Torah.”

But Hillel knew that the man wanted to do the right thing, but he didn’t understand the purpose of the Oral Torah. So Hillel began to teach him the Aleph Bet (Hebrew alphabet). The first day, Hillel taught him the first two letters, aleph and bet.

The next day, Hillel taught him the same two letters in reverse. He showed him the letter aleph, but called it “bet.” 

The man objected, “but yesterday you taught it the other way!”

A Critique of Frank Nelte's Passover (I) | The mystery of life blog

“Well, then, you need me, a Rabbi, to teach you the Aleph Bet? So you have to trust my knowledge of the tradition of the letters. What I tell you is the Oral Tradition. You can’t read the alphabet if no one tells you how they are pronounced. And you think you don’t need the Rabbis’ knowledge of Jewish Tradition in order to understand the words of the Torah? Those are much more difficult! Without an Oral Tradition you will never be able to learn the Torah.”

So it is clear that an Oral Tradition is needed, and that one exists. If you don’t agree, try to define: (a) what circumcision is, and (b) when is Sabbath — from the Bible alone and without tradition! and (c) how do you pronounce the 22 Hebrew alphabets when you don’t have the Oral Traditions? And how to identify and pronounce each of the vowels with the 22 alphabets?

But did you notice one other point in this statement by the “Chief Rabbi”? When the Pharisees tried to argue with the Sadducees based purely on the written Word of God, they couldn’t succeed. Did you notice this? What does this tell you?

It tells you that about 2000 years ago already the Sadducees, the keepers of the Temple Scriptures, the ones who were of the priestly line and who were responsible for all of the Temple services, DID NOT ACCEPT THAT “SHABBATH” MEANS “WEEKS”! And those learned Sadducees knew more about the Hebrew language than all of the “noted Biblical scholars and Bible dictionaries” of today put together! It makes clear that the Pharisees tried to attach the meaning of “weeks” to the word “shabbath” and that the Sadducees did not accept this as valid. (When Should We Keep Pentecost?)

Yes, the above were very true, but not all, especially this line: “When the Pharisees tried to argue with the Sadducees based purely on the written Word of God, they couldn’t succeed.” On almost every issue they debated frequently. And it was left for Christ to judge. John the Baptist prophesied about judgement time and the Messiah:

Luke 3:16 John answered, saying unto them all, “I indeed baptize you with water; but One mightier than I cometh, the straps of whose shoes I am not worthy to unloose. He shall baptize you with the Holy Ghost and with FIRE. 17 His winnowing fan is in His hand, and He will thoroughly purge His floor and will gather the wheat into His garner; but the chaff He will burn with FIRE unquenchable.”

Let’s get back to a basic parable where the tares and wheat were growing together:

Matthew 13:1 The same day, Jesus went out of the house and sat by the seaside. 2 And great multitudes were gathered together unto Him, so that He went into a boat and sat, and the whole multitude stood on the shore . . .
24 Another parable put He forth before them, saying, “The Kingdom of Heaven is likened unto a man who sowed good seed in his field; 25 but while men slept, his enemy came and sowed tares among the wheat, and went his way. 26 But when the blades had sprung up and brought forth fruit, then appeared the tares also.
27 So the servants of the householder came and said unto him, ‘Sir, didst not thou sow good seed in thy field? From whence then hath come the tares?’ 28 He said unto them, ‘An enemy hath done this.’ The servants said unto him, ‘Wilt thou then have us go and gather them up?’
29 But he said, ‘Nay, lest while ye gather up the tares, ye root up also the wheat with them. 30 Let both grow together until the harvest, and in the time of harvest I will say to the reapers, “Gather ye together first the tares, and bind them in bundles to burn them, but gather the wheat into my barn.”’”

As the Pharisees and Sadducees thrived together for a designated time only, and forty years later, it was decision time, judgement time — to put the tares into the fire. And who were those that met their fate during the fire and brimstones of the 70 AD inferno? The Sadducees and their allies — the Herodians and Boethusians. The Essenes (who practiced an anti-Sanhedrin calendar), all ended in the inferno. Every Blind Guide ignores the significance of the destruction of Judea in the 70 AD conflagration BECAUSE THEY ARE BLIND!

How did the Sadducees and Essenes just “DISAPPEARED” from this 70 AD INFERNO?

“Shall a trumpet be blown in the city, and the people not be afraid? Shall there be evil in a city, and the LORD hath not done it?” Amos 3:6

And these are the words that the LORD spoke concerning Israel and concerning Judah:
“For thus saith the Lord: ‘We have heard a voice of trembling, of fear and not of peace.
Ask ye now, and see whether a man doth travail with child? Why do I see every man with his hands on his loins, as a woman in travail, and all faces are turned into paleness?
Alas! for that day is great, so that none is like it. It is even the time of Jacob’s trouble, but he shall be saved out of it.
Jeremiah. 30:4-7

“Say thou unto them, ‘Thus saith the LORD God: This burden concerneth the prince in Jerusalem and all the house of Israel that are among them.’ Say, ‘I am your sign: as I have done, so shall it be done unto them. They shall go into exile as captives.
“And they shall know that I am the LORD, when I shall scatter them among the nations and disperse them in the countries. But I will leave a few men of them from the Sword, from the Famine and from the Pestilence, 
that they may declare all their abominations among the nations whever they go; and they shall know that I am the LORD.” Ezekiel 12:10-11, 15-16

~~~~~

This is Part 1 of a five-part series on Wave Sheaf Offering, Pentecost or Shavuot

(1) A Critique of Frank Nelte’s Pentecost 
(2) A Critique of Wade Cox’s Wave Sheaf Offering
(3) A Critique of UCG’s Pentecost 
(4) A Critique of Fred Coulter’s Pentecost 
(5) A Critique of John Ritenbaugh’s Pentecost

The Targum, an Insight of Ezra (D)

•May 31, 2026 • Leave a Comment

The Targum, which originated in the Aramaic language and is strongly linked to the work of Ezra, holds significance for shedding light on biblical concepts. When the Masoretic Text can be vague, uncertain, or unclear, the Targum often offers clearer meaning, broader insight, and deeper understanding.

Yes, sometimes the Targum clarifies metaphors and interprets idioms or difficult passages instead of translating them literally, which often makes no sense. Such an endeavor should be highly commended rather than criticized.

For example, the Targum interprets natural imagery—like cedars, cypresses, oaks, forests, and fire—as metaphors for political political and social structures, especially kings, rulers, governors, and wealthy elites. Such imagery can be sweeping: forests laid waste, lions roaring as their habitat is destroyed, and power structures crumbling. Fire symbolizes divine punishment, sweeping through defenses and dismantling the very foundations of their power.

Translating such natural imagery literally could convey limited information or even distort it, but Ezra was determined to share their true meaning. He was a righteous man, for God had prepared his heart to seek the law of the Lord, to follow it, and to teach the statutes and judgments in Israel Ezra 7:10.

(1) And the Lord said unto Moses, “See, I have made thee a god to Pharaoh, and Aaron thy brother shall be thy prophet. Exodus 7:1

— a god ’ĕ·lō·hîm to Pharaoh; “a god” that is, he was to act in this business as God’s representative, God’s envoy, to act and speak in His name and to perform things beyond the ordinary course of nature;

— any messenger (mal·’āḵ) is also an angel; and God gives authority for an messenger to carry God’s name, “for My name is in him;”

“Behold, I send a messenger (mal·’āḵ) before thee to keep thee in the way, and to bring thee into the place which I have prepared;

Have regard for him, and obey his voice. Provoke him not, for he will not pardon your transgressions, for My name is in him. Exodus 23:20-21

— the Targum of Jonathan reveals another dimension, saying,

“And the Lord said to Moses: ‘Why are you afraid? Behold, I have already placed you as a terror to Pharaoh, as if you were his god; and Aaron your brother shall be your prophet.’” Exodus 7:1 Jonathan

(2) Then Pharaoh also called the wise men and the sorcerers. Now the magicians of Egypt, they also did in like manner with their enchantments. Exodus 7:11

— the names of these magicians of Egypt, Janis and Jamberes, were already incorporated in the Targum of Jonathan

But Pharoh called the hachems and magicians; and they also, Janis and Jamberes, magicians of Mizraim, did the same by their burnings of divination. Exodus 7:11 Jonathan

— also being mentioned in Exodus 1:15 Jonathan, introduced as the chief of the magicians; but also picked up by Paul; that’s right, Paul also used the Targum for understanding deeper issues

“Now as Jannes and Jambres withstood Moses, so do these also resist the truth — men of corrupt minds, reprobate concerning the faith.” II Timothy 3:8

(3) And it came to pass, when Pharaoh had let the people go, that God led them not through the way of the land of the Philistines, although that was near; for God said, “Lest perhaps the people repent when they see war, and they return to Egypt.” Exodus 13:17

— when they see war; for the Philistines were viewed as one of the most warlike people of the time; as the Targum of Jonathan reveals an earlier misadventure by the tribe of Ephraim, saying

“And it was when Pharaoh released the people, that the Lord did not lead them by the way of the land of the Philistines, although it was near; for the Lord said, ‘Lest the people be dismayed when they see their brothers who died in battle—two hundred thousand armed men of the tribe of Ephraim, grasping shields, spears, and weapons of war.

“They went down to Gath to plunder the livestock of the Philistines; and because they transgressed against the decree of the Memra (Word) of the Lord and left Egypt thirty years before the [appointed] end, they were delivered into the hands of the Philistines, who killed them.

“These were the ‘dry bones’ that the Word of the Lord brought to life through the hand of Ezekiel the prophet in the Valley of Dura. If [the Israelites] see this, they will be afraid and return to Egypt.’” Exodus 13:17 Jonathan

— the details of this eposode was recorded by the Book of Jasher, Chapter 75, where after 180 years in Egypt, the tribe of Ephraim, thirty thousand valiant men on foot, who trusted in their own strength, who have come forth from Egypt to take the cattle of the Philistines before their appointed time; “but the Lord delivered the children of Ephraim into the hands of the Philistines,” leaving only ten men to report back what a disaster it had been;

— “And Ephraim their father mourned many days, and his brethren came to comfort him.” I Chronicles 7:22

(4a) “I am the Lord thy God, who have brought thee out of the land of Egypt, out of the house of bondage.” Exodus 20:2

— which have brought thee out of the land of Egypt: where they had been afflicted many years, and reduced to great distress, but were brought forth with an high hand;

— out of the house of bondage: where they had been servants and slaves, but now were made free, and were become a body politic, a kingdom of themselves, under their Lord, King, Lawgiver.

— the Targum of Jonathan reveals it isn’t just sound; it’s sparks, lightning and fire, saying

“And then it cried out and said: ‘My people, children of Israel, I am the Lord your God, who redeemed and brought you out redeemed from the land of the Egyptians, from the house of the bondage of slaves.’”

“The First Word (Commandment), when it went forth from the mouth of the Holy One—blessed be His name—was like sparks, and like lightnings, and like flames of fire. A lamp of light was at His right hand, and a lamp of fire at His left.

“It flew and soared through the air of the heavens, and returned and was seen over the camps of Israel. Then it returned and became engraved upon the Tablets of the Covenant that were placed in the hands of Moses, turning itself upon them from side to side.

(4b) “Thou shalt have no other gods before Me. — there shall not be to thee another god, or other gods, to wit, idols, which others have, esteem, and worship as gods;

— again, the Targum of Jonathan reveals there are sparks, lightning and fire, saying

“And then it cried out and said: ‘My people, House of Israel, you shall have no other god besides Me.’”

“The Second Word (Commandment), when it went forth from the mouth of the Holy One—blessed be His name—was like sparks, and like lightnings, and like flames of fire. A lamp of light was at His right hand, and a lamp of fire at His left.

“It flew and soared through the air of the heavens, returned and was seen over the camps of Israel, and returned and became engraved upon the Tablets of the Covenant, turning itself upon them from side to side.

(5) And the Lord said unto Moses, “Come up to Me onto the mount, and be there; and I will give thee tablets of stone, and a law and commandments which I have written, that thou mayest teach them.” Exodus 24:12

— come up to me into the mount, and be there; for as yet Moses was not got up to the top of the mount, only up some part of it with the elders, though at some distance from the people: but now he is bid to come up higher;

— the Targum of Jonathan reveals the 613 laws were already identified during Moses time

“And the Lord said to Moses: ‘Ascend before Me to the mountain and be there; and I will give to you the tablets of stone, in which are hinted (alluded to) the rest of the words of the Torah, and the six hundred and thirteen commandments which I have written for their instruction.’”

(6) And thou shalt put in the breastplate of judgment the Urim and the Thummim; and they shall be upon Aaron’s heart, when he goeth in before the Lord: and Aaron shall bear the judgment of the children of Israel upon his heart before the Lord continually. Exodus 28:30

— the twelve stones into the breastplate were put in by the workmen, Exodus 39:10-21; the breastplate of Urim and Thummim dressed upon Aaron by Moses, Leviticus 8:1-8;

— this Urim and Thummim; signifing lights and  integrity or perfections: by which the will of God would be made known in doubtful cases; and asking counsel of God in any emergency;

— the Targum Onkelos says the Urim and Thummim inside the Breastplate of Judgment

“And you shall place in the Breastplate of Judgment the Urim and the Thummim, and they shall be upon the heart of Aaron when he goes in before the Lord; and Aaron shall bear the judgment of the children of Israel upon his heart before the Lord continually.”

— the Targum of Jonathan reveals further hidden things of the Urim and Thummim, saying

“And you shall put in the Breastplate of Judgment the Urim, which illuminate their words and reveal the hidden things of the House of Israel; and the Thummim, which perfect their deeds for the High Priest who seeks instruction from before the Lord through them.

“For upon them is engraved and expressed the Great and Holy Name, by which three hundred and ten worlds were created. It is also engraved and expressed upon the Foundation Stone, with which the Master of the World sealed the mouth of the Great Deep from the beginning.

“And anyone who call upon that Holy Name in a time of distress is saved, and hidden things are revealed to them. And they shall be upon Aaron’s heart when he enters before the Lord; and Aaron shall bear the judgment of the children of Israel upon his heart before the Lord continually.”

— some observations from the Targum of Jonathan above

— Urim from Or (Light), they “illuminate” hidden truths, legal, moral and prophetic, of the House of Israel; a divine light exposes what is concealed;

— Thummim from Tam (Complete/Perfect); they give final, complete answers from the Lord to the High Priest’s questions;

— the “310 worlds” that are reserved as a reward for the righteous;

— by wearing the Urim and Thummim, Aaron carries the same “code” that keeps the universe stable; or a seal against chaos and maintains the cosmic order; and it highlights the High Priest’s role as a mediator carrying Israel’s judgment before God;

— the Holy Name of God isn’t just for the High Priest; it is a source of help and rescue for anyone who cried out in “a time of distress.” That is, it emphasizes the power of the Divine Name, “Whoever remembers that Holy Name in a time of distress is delivered.” His explicit Divine Name, is יהוה YHVH Yehovah.

— Cases in use

Or where there is no answer I Samuel 14, 37; “Lord, God of Israel, why haven’t you answered me today?” And the answer, if it could be considered an answer, is a forced one? I Samuel 14:40-42Septuagint

If he were standing before the ark, he probably received instructions from off the mercy-seat, as Moses did, Exodus 25:22.

If he were at a distance from the ark, as David was when he inquired of the Lord through Abiathar (1 Samuel 23:1-12), then the answer was given either by a voice from heaven, or by an impulse upon the mind of the high-priest, or the inquirer.

(7) And the Lord said unto Moses, “Depart and go up hence, thou and the people whom thou hast brought up out of the land of Egypt, unto the land which I swore unto Abraham, to Isaac, and to Jacob, saying, ‘Unto thy seed will I give it.’ Exodus 33:1

— the land which I swore unto Abraham, Isaac and to Jacob; saying, unto thy seed will I give it: meaning the land between the two great rivers, which as he had promised with an oath to their fathers to give it to them, he would faithfully observe it, though they were unworthy of such a favour;

— the Targum of Jonathan reveals a specific psychological motivation for the command to leave, saying,

“And the Lord spoke with Moses: ‘Go, depart from here—lest My burning anger intensify against the people and I destroy them. Therefore, travel you and the people whom you brought up from the land of Egypt, to the land which I swore to Abraham, to Isaac, and to Jacob, saying: To your children I will give it.’”

— God shifts the “ownership” of the nation; He doesn’t call them “My people,” but rather “the people whom you brought up.” That is, even in anger, God remains faithful to the Covenant of the Patriarchs; because of His promise to Abraham, Isaac, and Jacob.

(8) And He said, “Behold, I make a covenant. Before all thy people I will do marvels such as have not been done in all the earth, nor in any nation; and all the people among whom thou art shall see the work of the Lord, for it is a fearsome thing that I will do with thee. Exodus 34:10

— following the Golden Calf, there was fear that God would “replace” Israel with another nation;

— but the Targum of Jonathan reveals God’s unwillingness to change his chosen people

“And He said: ‘Behold, I decree a covenant that I will not exchange this people for another people. However, from you shall go forth multitudes of righteous ones.

“In the presence of all your people, I will perform wonders for them at the time they go into captivity by the rivers of Babylon; I will bring them up from there and settle them within the River Sambatyon.

“Such wonders as these have not been created among all the inhabitants of the earth or among any of the nations. And all the people among whom you dwell shall see on that day the work of the Lord, for awesome is that which I am doing with you.’”

— the Targum, however, affirms the eternal nature of the bond, even in the face of sin as it looks far into the future, specifically addressing the exile and the fate of the “lost” parts of the nation, promising they shall bring “forth multitudes of righteous ones.”

(9) And it came to pass, when Moses came down from Mount Sinai with the two tablets of testimony in Moses’ hand, when he came down from the mount, that Moses knew not that the skin of his face shone while he talked with Him. Exodus 34:29

— Moses did not know his face shone, while he talked with him; this radiance was why Moses eventually has to wear a veil when speaking to the people, “for they were afraid to come near to him” Exodus 34:30–35;

— the Targum of Jonathan reveals that Moses had achieved the highest possible level of intimacy with the Divine that a human could survive, saying

“And it was, at the time of Moses’ descent from Mount Sinai, with the two Tablets of Testimony in the hand of Moses as he descended from the mountain, that Moses did not know that the splendor of the features of his face shone; which became his from the splendor of the Glory of the Shekhinah of the Lord, at the time of His speaking with him.”

— the Targum of Jonathan reveals Moses didn’t know that his face shone with the splendour which had come upon him from the brightness of the glory of the Lord’s Shekinah in the time of His speaking with him.

(10) And Moses said unto Aaron, “Go unto the altar, and offer thy sin offering and thy burnt offering, and make an atonement for thyself and for the people; and offer the offering of the people and make an atonement for them, as the Lord commanded.” Leviticus 9:7

— and Moses said unto Aaron; though he was now the duly-installed high priest, yet he did not approach the altar till he was solemnly called upon by Moses to do it;

— the Targum of Jonathan says

“And it happened, that when Aaron saw the altar, its horns appeared to him like the horns of a calf. He became afraid to approach it.

“Therefore, Moses said to him: ‘Strengthen your resolve (literally: “Enforce your mind/knowledge”) and draw near to the altar; do not be afraid. Perform your sin offering and your burnt offering, and atone for yourself and for the people; and perform the offering of the people and atone for them, just as the Lord has commanded.’”

— the Targum explains that Aaron was suffering from a guilty conscience: he saw the Golden Calf he had helped create at Sinai. To him, the altar looked like the very idol that had nearly led to the nation’s destruction;

— perhaps it was a Paralysis of Shame: Aaron felt unworthy; he felt that by approaching the altar, he was reminding God of his greatest failure. His fear wasn’t of the fire or the ritual, but of his own past.

— the Question is, why was the four corners embedded with four horns of a calf?

A Prophecy against Esau

•May 30, 2026 • Leave a Comment
Scene of desperation after finding out Jacob had stolen his birthright from him

The prophecy against Esau, also known as Edom, is a significant aspect of biblical prophecy. It foretells the rivelry and yoke that Edom must bear before finally be able to gain himself from his brother, of those from the house of Jacob, Israel.

After Esau had discovered that Jacob had stolen his birthright blessing from him, he pleaded his father, Isaac, “Bless me, even me also, O my father!” pleading if there was anything left for him, “Hast thou not reserved a blessing for me?” upon which Isaac pronounced the most profound and intriguing prophecy to understand:

“Behold, I have made him thy lord, and all his brethren have I given to him for servants; and with corn and wine have I sustained him. And what shall I do now unto thee, my son?” Genesis 27:37

The Targum offers further insight, a more dramatic scene

“And Isaac answered and said to Esau: ‘Behold, I have appointed him as a ruler (“Shalit”) over you, and all his brothers I have placed before him as servants; and with grain and wine I have sustained him.

“And now, go and be expelled from me; for what can I do for you, my son?'” Genesis 27:37 Jonathan

Isaac explains to Esau that the blessing wasn’t just a wish; it was a legal and divine spiritual transfer of power.

By calling Jacob a “Shalit” (ruler), Isaac acknowledges that the hierarchy is now fixed. In the ancient patriarchal world, there could only be one “head of the house.” By blessing Jacob first, Isaac inadvertently exhausted the unique legal capacity of the firstborn’s blessing.

Jacob was deemed to be the master, and Esau to be the servant.

This “Go and be Expelled from me” is a very harsh insight revealed from the Targum, which indicates that once the blessing was given, a spiritual “gulf” opened even between Isaac and Esau.

Isaac realized that they could no longer dwell in the same spiritual space because their destinies had fundamentally diverged. Hence Esau lifted up his voice and wept, pleading again, “Hast thou but one blessing, my father? Bless me, even me also, O my father!” 

And Isaac his father answered and said unto him,

“Behold, thy dwelling shall be of the fatness of the earth, and of the dew of heaven from above.

“And by thy sword shalt thou live, and shalt serve thy brother; and it shall come to pass when thou shalt have the dominion, that thou shalt break his yoke from off thy neck.” Genesis 27:39-40

Isaac is essentially saying: “Your brother has the spiritual heart of the world (Jerusalem/Israel), but you will still be given “the best fruits” and physical “dwelling,” and the material abundance of some great empires of the earth.

The prophecy is found in Obadiah 1:18, which states, “The house of Esau will be as stubble and consumed by fire.” It originated from Jacob, who was afraid to return to Canaan because of his brother Esau; but this originates from the Jonathan version of Genesis 30:25, which reveals through the Holy Spirit that Jacob knew Esau, the “stubble,” could only be defeated by the “flame” of Joseph

“And it was, when Rachel had given birth to Joseph, that Jacob said through the Holy Spirit that the House of Joseph is destined to be like a flame to consume the House of Esau. He said: ‘From now on, I am not afraid of Esau and his legions.’ And he said to Laban: ‘Send me away, that I may go to my own place and to my own land.’” Genesis 27:40 Jonathan

And this Jonathan narrative is being confirmed the prophet Obadiah. And so when Joseph was born, Jacob asked Laban to be sent back to his own country:

“And the house of Jacob shall be a fire, and the house of Joseph a flame, and the house of Esau for stubble; and they shall kindle them and devour them. And there shall not be any remaining of the house of Esau, for the Lord hath spoken it” Obadiah 1:18

This prophecy is part of a larger narrative where Esau’s lineage is depicted as a temporary rule before the rightful inheritance of Jacob’s posterity.

The prophecy is also referenced in Ezekiel 35, where the prophet warns against the arrogance of Esau’s heart and its consequences. The prophecy serves as a warning to nations that exalt themselves against the Lord and ultimately leads to their downfall.

Thus it was establised that the posterity of Esau were to serve his younger brother Jacob in the years to come, in fact, the years to the endtime. But how such a prophecy were to played out were left with not mush details.

However, from other Scriptures, we were to know the descendants were to be numbered in billions.

To Isaac, God promised through Rebekah billions in her descendants

“And they blessed Rebekah and said unto her, “Thou art our sister; be thou the mother of thousands of millions; and let thy seed possess the gate of those who hate them” Genesis 24:60

Rebekah was to become a matriarch of a vast multitude, “thousands of millions,” meaning billions, for the descendants of Esau and Jacob.

The Masoretic offers the shell, but the Targum brings forth the Genesis account which reveals with greater insight. Esau realized that Cain had made a mistake by killing Abel too soon; he plans, instead, to delay his revenge until Isaac’s death, avoiding Cain’s mistake; as after Abel’s death, Adam and Eve had another son, Seth, and the birthright slipped away from Cain.

But a more detailed setting of this Prophecy could be expounded from the Targum of Jonathan version

And upon thy sword shalt thou depend, entering at every place: yet thou shalt be supple and credulous, and be in subjection to thy brother; but it will be that when his sons become evil, and fall from keeping the commandments of the law, thou shalt break his yoke of servitude from off thy neck. Genesis 27:40 Jonathan

“And Esau harbored hatred in his heart against Jacob, his brother, because of the blessing with which his father had blessed him.

“And Esau said in his heart, ‘I will not do as Cain did, who killed Abel during their father’s lifetime and then their father had another son, Seth.

“Rather, I will wait until the days of mourning for my father have passed, and then I will kill Jacob my brother, and I will be the sole heir.’” Genesis 27:41 Jonathan

— that is, explaining what the Masoretic Text lacks: Esau reasoned that he wouldn’t repeat Cain’s error. Instead, by his calculation, by waiting, he will both avenge himself and secure the birthright; hence he would wait until his father had died and the mourning period had passed before killing Jacob, so he would solely inherit the birthright;

— in short, the Targum provides greater insights, portrays Esau as harboring Cain-like hatred but scheming to avoid Cain’s mistake. He plans to kill Jacob only after Isaac’s death, believing this will secure both vengeance and inheritance. This interpretive expansion deepens the biblical narrative by casting Esau as a new Cain, while also explaining Rebecca’s urgent intervention;

— then, following a severe drought in his homeland of Canaan, Jacob and his descendants migrated to neighboring Egypt through the help of his son Joseph, who had become a trusted confidant of the pharaoh. Jacob died in Egypt at the age of 147 and believed to have been buried in the Cave of Machpelah in Hebron. What happened—did Esau fail to kill his brother as he had once vowed to do? Did Esau repent, or was it all part of a prophecy?

— if Esau had repented, what made him repent? Or is this a prophecy? 

Leviticus (23-24)

•May 29, 2026 • Leave a Comment

Question: the priesthood bestored upon the Levites, to operate in God’s Temple; the scepter and kingship belong to Judah, to rule and uphold God’s laws, statutes and ordinances; the birthright bestored upon Joseph, but what is the posterity of Joseph supposed to do? Just eat, sleep and indulge in gluttony? Or be self-glorifying, narcissistic and jingoistic?

Joseph’s descendants were to be a great nation and a company of nations (Gen 48:19); they are to be as numerous the stars of heaven and the sands of the seashore, and they shall control the gates of its enemies (Gen 22:17). But what are their collective duties as his co-heirs have to do? Should they resign themselves to the stupor of mindless gluttony, or pivot to the frantic histrionics of naked nationalism?

Perhaps some elements of Manifest Destiny and Monroe Doctrine could indicate a clue.

(a) Manifest Destiny, the city on a hill mimics the stars in heaven; the idea of American exceptionalism; to let the nations see the great light (Matthew 5:14), the stars of heaven that were promised to Abraham, to light the paths for the Gentiles, so they could similarly see the great way of life from God, his laws, statues and ordinances.

“I, the Lord, have called Thee in righteousness, and will hold Thine hand, and will keep Thee, and give Thee for a covenant of the people, for a light to the Gentiles” Isaiah 42:6; or ‘a light to the nations’ (go-yim);

“And He said: ‘It is a light thing that Thou shouldest be My servant to raise up the tribes of Jacob and to restore the preserved of Israel. I will also give Thee for a light to the Gentiles (go-yim), that Thou mayest be My salvation unto the end of the earth’” Isaiah 49:6.

(b) Monroe Doctrine, a Big Stick approach needed for those nations stubbornly and persistently refused to obey God; context shows this will be fully enforced during the Millennium; some nations like “Gog and Magog” would still be similarly stiff-necked.

“And if the family of Egypt go not up and come not, upon whom there is no rain, there shall be the plague (leprosy during biblical times, but could be Covid-19, or Hantavirus, or Ebola; or a new disease you have never heard before) wherewith the Lord will smite the nations who come not up to keep the Feast of Tabernacles” Zechariah 14:18.

The strategy works in two parts. It starts with the “City on a Hill” approach—an olive branch meant to inspire and lead by example. If that doesn’t work, the “Big Stick” steps in, using the Arrow method of gunboat diplomacy to keep order. It’s this push and pull between the beacon and the blade that influences how nations act around the world.

And now we have arrived at Leviticus 23 which culminates how all the nations of the world would come to know all the festivals of God and how to observe them.

Leviticus 23

1 And the Lord spoke unto Moses, saying, — this isn’t a law of Moses, but a Command of God convey to all the Israelites through Moses; thus it is a Command of God as “it shall be a statute for ever throughout your generations (v14).”

“Speak unto the children of Israel and say unto them: ‘Concerning the feasts of the Lord, which ye shall proclaim to be holy convocations, even these are My feasts.

— as the festivals discussed here were to be solemnly kept by the children of Israel, Moses is ordered to address these regulations to them;

— concerning the feasts of the Lord; better, these are festivals of the Lord which ye shall proclaim as holy convocations, these are my festivals; that is, the following festivals God claims as His, on which solemn assemblies are to be held in the sanctuary and in the land of Israel.

“‘Six days shall work be done, but the seventh day is the Sabbath of rest, a holy convocation. Ye shall do no work therein; it is the Sabbath of the Lord in all your dwellings.

— the weekly Sabbath: six days shall work be done; recurring every week, and being the most important as well as the oldest of all festivals, the Sabbath introduces the holy seasons.

“‘These are the feasts of the Lord, even holy convocations, which ye shall proclaim in their seasons.

— these are the annual feasts of the Lord; because the following are the festivals proper as distinguished from the Sabbath (Leviticus 23:37-38), and because they are now enumerated in their regular order, the introductory heading is here repeated.

On the fourteenth day of the first month at evening is the Lord’S Passover. — at even; or in the evening, as renders this phrase in the parallel passage (Exodus 12:6), literally, this is between the two evenings;

— the interpretation of this expression constituted one of the differences between the Sadducees and the Pharisees during the second Temple, and seriously debates about the time for offering up the paschal lamb and the evening sacrifices;

— according to the Sadducees, who followed the relegated Samaritans, it is the time between the setting of the sun and the moment when the stars become visible, or when darkness sets in, that is, roughly between six and seven o’clock, a space of about one hour and twenty minutes;

— according to the Pharisees, however, “between the two evenings” means from the afternoon, to the disappearing of the sun. The first evening is from the time when the sun begins to decline towards the west, or after noon or twelve o’clock the middle of the day; whilst the second is when it goes down and vanishes out of sight;

— this is the reason why the paschal lamb in the evening sacrifice began to be killed and the blood sprinkled from 12.30 pm onward; which is more in harmony with the fact that the large number of sacrifices on this day could only be offered up in the longer period of time;

— for other detailed Study on the Passover, see Archive for the ‘Passover’ Category; or Fred Coulter.

Despite their problems, Jesus ordered his disciples to follow the Pharisees, saying, “The scribes and the Pharisees sit in Moses’ seat,” simply because they hold the right teachings concerning the Feasts, the Passover, Pentecost and the Calendar.

And on the fifteenth day of the same month is the Feast of Unleavened Bread unto the Lord; seven days ye must eat unleavened bread. — the Feast of Unleavened Bread was instituted at the same time with the Feast of the Passover;

— in fact, they are a composite Feast; the whole made a festival of eight days, called indifferently the Feast of the Passover, or the Feast of Unleavened Bread; hence those who thought they are two distinct feasts read the Gospel Texts with much confusion.

On the first day ye shall have a holy convocation; ye shall do no servile work therein. — the first day of unleavened bread, which commenced on the evening of the 14th, in other words, the 15th Abib, ye shall have a holy convocation.

But ye shall offer an offering made by fire unto the Lord seven days. On the seventh day is a holy convocation; ye shall do no servile work therein.’” — in the seventh day is an holy convocation, ye shall do no servile work therein; as on the first day.

And the Lord spoke unto Moses, saying, — that is, this isn’t a law of Moses, but a Command of God convey to all the Israelites through Moses.

10 “Speak unto the children of Israel and say unto them: ‘When ye come into the land which I give unto you and shall reap the harvest thereof, then ye shall bring a sheaf of the firstfruits of your harvest unto the priest.

— ye shall bring the first-fruit omer of your harvest; the omer had to be from the best and ripest standing corn of a field near Jerusalem.

11 And he shall wave the sheaf before the Lord to be accepted for you; on the morrow after the Sabbath the priest shall wave it.

— “wave sheaf” as translated into our English Language gives a misconception, so is “firstfruits” plural. It is “omer” in Hebrew, a finished product (grains that had been thrashed, dried and roasted, and only a tenth part taken), now a tenth of this is called the omer and given the the priest, who laced it with oil and frankincense (Leviticus 2:15), becoming a baked cake, now waving before the altar, not some freshly cut grains from the field, which is misleading;

— and he shall wave the sheaf; that is, and he shall wave the omer, waved it, took it and caused it to ascend in smoke; on the morrow after the sabbath; the interpretation of this phrase also constituted one of the differences between the Pharisees and the Sadducees;

— according to the Pharisees, the term Sabbath here, as elsewhere (Leviticus 23:24,32,39), is not the weekly Sabbath, but the next day, or the first day of the holy convocation, the first day of Passover, a Sabbath;

— the Sadducees, infiltrated by the relegated Samaritans, however, maintained that it is to be understood in its literal sense as denoting the weekly Sabbath in the Passover week, which might happen to fall within the seven days;

— on the morrow after the Sabbath the priest shall wave it; not after the weekly seventh day, but after the first day of the feast of unleavened bread, which was a Sabbath, in which no servile work was to be done, Lev 23:7; and so the Targum of Jonathan calls it the first festal day of Pascha (or, the day after the feast-day of Pascha), that is, the sixteenth of Nisan;

— the standard of Christ’s acceptance before the Father rests not upon agricultural symbols like grains or firstfruits, but exclusively upon the blood of a lamb or goat; typified by the blood offering on the Day of Atonement, wherein blood was presented upon the Mercy Seat within the Holy of Holies;

— to break the link back to the Sacrifice of the Lamb is to trivialize its importance, NOT waiting for some obscure SUNday to begin the Count, a strange concept the Samaritans brought with them from Babylon! Making the Link as if of no importance is pure wickedness! Nor wonder, Jesus rebuked the Samaritans, “Ye worship ye know not what; we know what we worship, for salvation is of the Jews” John 4:22;

Okay, that is archaic English; below are more straight forward English

You Samaritans worship what you do not know. We worship what we do know, because salvation is from the Jews. John 4:22 CSBA

You Samaritans worship what you do not know. We Jews worship what we know, because salvation is from the Jews. John 4:22 DLNT

— for more, see Pentecost, when to start Counting.

12 And ye shall offer that day when ye wave the sheaf a helamb without blemish of the first year for a burnt offering unto the Lord.

— an he lamb without blemish of the first year, for a burnt offering unto the Lord; typical of the perfect and immaculate Lamb of God, whose sufferings are fitly signified by a burnt offering; and which were endured at the time he became the firstfruits of his people, and sanctified them.

13 And the meat offering thereof shall be two-tenths part of fine flour mingled with oil, an offering made by fire unto the Lord for a sweet savor; and the drink offering thereof shall be of wine, a fourth part of a hin.

— the offering described in this passage was made on the sixteenth of the first month, the day following the first Passover Sabbath.

14 And ye shall eat neither bread nor parched corn nor green ears, until the selfsame day that ye have brought an offering unto your God; it shall be a statute for ever throughout your generations in all your dwellings. — it shall be a statute for ever throughout all your generations without exception.

15 “‘And ye shall count unto you from the morrow after the Sabbath, from the day that ye brought the sheaf of the wave offering; seven Sabbaths shall be complete. — from the first day, which was an holy convocation, a Sabbath in which no servile work was to be done, Leviticus 23:7;

— from the Targum of Jonathan

And number to you after the first feast day of Pascha, from the day when you brought the sheaf for the elevation, seven weeks; complete they shall be.

— “seven Sabbaths shall be complete;” for more, see A Critique of Frank Nelte’s Pentecost 

16 Even unto the morrow after the seventh Sabbath shall ye number fifty days, and ye shall offer a new meat offering unto the Lord. — even unto the morrow after the seventh sabbath; that is, the day after the seven complete weeks, or the fiftieth day; hence its name, “Pentecost, or fiftieth-day” feast.

17 Ye shall bring out of your habitations two wave loaves of two-tenths part. They shall be of fine flour; they shall be baked with leaven; they are the firstfruits unto the Lord.

— you won’t wave sin toward heaven, isn’t it: “baked with leaven” and waved them toward heaven; so leaven couldn’t be representing sin, as most believe during the days of unleavened bread;

— two omers of the flour; they were called wave-loaves because they were presented to God by waving them toward heaven: they are the firstfruits unto the LORD. Why two omers and fruitS, plural, if it was supposed to represent Christ, one person?

18 And ye shall offer with the bread seven lambs without blemish of the first year, and one young bullock and two rams; they shall be for a burnt offering unto the Lord, with their meat offering and their drink offerings, even an offering made by fire, of sweet savor unto the Lord.

— seven lambs; the additional sacrifices for the feast day consisted of two bullocks, one ram, and seven lambs: seven lambs could symbolise the seven Churches of God; or seven eras of God’s Church of Revelation 2 and 3;

— and one young bullock, and two rams; in Numbers 28:27 it is two young bullocks, and one ram.

19 Then ye shall sacrifice one kid of the goats for a sin offering, and two lambs of the first year for a sacrifice of peace offerings.

20 And the priest shall wave them with the bread of the firstfruits for a wave offering before the Lord with the two lambs; they shall be holy to the Lord for the priest. — two lambs were brought into the Temple and waved together or separately by the priest while yet alive.

21 And ye shall proclaim on the selfsame day that it may be a holy convocation unto you. Ye shall do no servile work therein; it shall be a statute for ever in all your dwellings throughout your generations.

— the Feast of Weeks or day of Pentecost was held in remembrance of the giving of the law, fifty days after the departure from Egypt; and looked forward to the outpouring of the Holy Spirits.

22 “‘And when ye reap the harvest of your land, thou shalt not rid cleanly the corners of thy field when thou reapest, neither shalt thou gather any gleanings of thy harvest. Thou shalt leave them unto the poor and to the stranger: I am the Lord your God.’”

— the Feast of Weeks being the feast of the firstfruits of the wheat harvest, it is repeated, that they might not forget what God had commanded them to do at that time, namely, to leave somewhat for the poor;

— for a detailed Study, see Archive for the ‘Pentecost’ Category

23 And the Lord spoke unto Moses, saying,

24 “Speak unto the children of Israel, saying, ‘In the seventh month, on the first day of the month, shall ye have a sabbath, a memorial of blowing of trumpets, a holy convocation.

— according to Jewish understanding, “the first day” of this month was the first day of the Civil year in use whereof as to civil matters before the Exodus, and was observed as the festival of the New Year.

25 Ye shall do no servile work therein, but ye shall offer an offering made by fire unto the Lord.’” — blowing of trumpets; here and in Numbers 29:1, literally “shouting” there is no mention of trumpets in the Hebrew text of the Law in connection with this day;

— yet there is no reason to doubt the tradition that the day was distinguished by a general blowing of trumpets throughout the land.

The Blowing of the Trumpets against the Walls of Jericho

26 And the Lord spoke unto Moses, saying, — this isn’t a law of Moses, but a Decree of God convey to the people through Moses.

27 “Also on the tenth day of this seventh month there shall be a Day of Atonement. It shall be a holy convocation unto you; and ye shall afflict your souls, and offer an offering made by fire unto the Lord.

— afflict your souls; from the evening of the ninth till the evening of the tenth, by resting from all work on pain of death, with fasting and bitter repentance for all, and especially their national sins, among which, no doubt, God would have them remember their sin of the golden calf;

Examples of Fastings

a) Before taking his mission, which is a major mission to inaugurated his public ministry, Jesus went to fast for forty days and forty nights “And when He had fasted forty days and forty nights, He afterward hungered” Matthew 4:2

b) Also Esther fasted, who asked her countrymen to fast for her: “Go, gather together all the Jews who are present in Shushan, and fast ye for me; and neither eat nor drink three days, night or day. I also and my maidens will fast likewise. And so will I go in unto the king, which is not according to the law; and if I perish, I perish” Esther 4:16

c) Moses also fasted: “When I went up the mountain to receive the tablets of stone, the tablets of the covenant that the Lord made with you, I remained on the mountain forty days and forty nights. I neither ate bread nor drank water” Deuteronomy 9:9

d) Fasting is also in the New Testament: Now there were in the church at Antioch prophets and teachers, Barnabas, Simeon who was called Niger, Lucius of Cyrene, Manaen a lifelong friend of Herod the tetrarch, and Saul. While they were worshiping the Lord and fasting, the Holy Spirit said, “Set apart for me Barnabas and Saul for the work to which I have called them.” Then after fasting and praying they laid their hands on them and sent them off, Acts 13:1-3.

— the Targum of Jonathan says

“However, on the tenth day of this seventh month, it is the Day of Atonement; a holy convocation it shall be for you, and you shall afflict your souls from eating and from drinking, and from the pleasure of the bath-house, and from ointments, and from the use of the bed, and from the sandal; and you shall bring an offering before the Lord.”

28 And ye shall do no work in that same day, for it is a Day of Atonement to make an atonement for you before the Lord your God. — the general festal sacrifices are described in Numbers 29:8-11.

29 For whatsoever soul it be that shall not be afflicted in that same day, he shall be cut off from among his people. — he shall be cut off from among his people; by an untimely death, by the hand of God; the Targum of Jonathan says, cut off by death from among his people.

30 And whatsoever soul it be that doeth any work in that same day, the same soul will I destroy from among his people. — any sort of work whatever; for, as before observed, it was to be kept as strictly as the weekly Sabbath.

31 Ye shall do no manner of work; it shall be a statute for ever throughout your generations in all your dwellings.

— it shall be a statute for ever, throughout your generations, in all your dwellings; unto the coming of the Messiah and even beyond, who, by the atoning sacrifice of himself, would answer to this law, and put an end to it.

32 It shall be unto you a sabbath of rest, and ye shall afflict your souls. On the ninth day of the month at evening, from evening unto evening, shall ye celebrate your sabbath.”

— and ye shall afflict your souls; having set forth in Leviticus 23:30-31, and in the first clause of this verse, the duty of abstaining from all work, and of celebrating this day as a day of solemn rest,

— the law giver repeats the second feature of the day, which is of equal importance, namely, the fasting, lest some should think that doing the one and leaving the other undone would pass as having kept this law;

— in the ninth day of the month at even to that of the tenth; the fast was to begin at the close of the ninth day, and to continue to the end of the tenth.

33 And the Lord spoke unto Moses, saying, — that is, this is a Command of God convey to all the Israelites through Moses.

34 “Speak unto the children of Israel, saying, ‘The fifteenth day of this seventh month shall be the Feast of Tabernacles for seven days unto the Lord. — in the Feast of Tabernacles there was a remembrance of their dwelling in tents, or booths, in the wilderness, as in a life’s journey;

— for seven days; like the Passover, the Feast of Tabernacles commenced at the full moon, on the fifteenth day of the month, and lasted for seven days.

35 On the first day shall be a holy convocation; ye shall do no servile work therein. — on the first day shall be an holy convocation;

— when they should be called together to holy exercises, to prayer, praising, and reading the law; and at this present time they observe this day, by rising early in the morning and going to the synagogue.

36 Seven days ye shall offer an offering made by fire unto the Lord. On the eighth day shall be a holy convocation unto you, and ye shall offer an offering made by fire unto the Lord. It is a solemn assembly, and ye shall do no servile work therein.

— on the eighth day shall be an holy convocation unto you; as on the first day; it is a solemn assembly; of all the people, when they were gathered together before the Lord.

37 “‘These are the feasts of the Lord which ye shall proclaim to be holy convocations, to offer an offering made by fire unto the Lord, a burnt offering and a meat offering, a sacrifice and drink offerings, every thing upon his day”

— these are the feasts of the Lord; that is, the above-named six festivals of Leviticus 23:

(1) a composite Feast of the Passover and Days of Unleavened Bread (Leviticus 23:4-14), (2) Pentecost (Leviticus 23:15-22), (3) Trumpet (Leviticus 23:23-25), (4) Day of Atonement (Leviticus 23:26-32), (5) Tabernacles (Leviticus 23:33-36a), and (6) the Last Great Day (Leviticus 23:36b). Thus the list of these annual festivals concludes with the formula by which they were introduced in Leviticus 23:4.

38 besides the Sabbaths of the Lord, and besides your gifts, and besides all your vows, and besides all your freewill offerings which ye give unto the Lord.

— “Beside the Sabbaths” that is, the Sabbath sacrifices (Numbers 28:9-10), and the gifts and offerings, which formed a different part of the keeping of the feasts and Sabbaths, but might be offered on those days.

39 “‘Also on the fifteenth day of the seventh month, when ye have gathered in the fruit of the land, ye shall keep a feast unto the Lord seven days; on the first day shall be a sabbath, and on the eighth day shall be a sabbath.

— on the first day and on the eight day shall be a Sabbath; both on the first and last days of this festival there is to be abstention from all servile work.

40 And ye shall take for yourselves on the first day the boughs of goodly trees, branches of palm trees, and the boughs of thick trees, and willows of the brook; and ye shall rejoice before the Lord your God seven days. — the palm, the myrtle, and the willow, when tied together into one bundle, constitute the Lulab.

41 And ye shall keep it a feast unto the Lord seven days in the year. It shall be a statute for ever in your generations; ye shall celebrate it in the seventh month.

— seven days in the year; these seven days Tabernacle is the feast of Tabernacles proper, whilst the eight days in Leviticus 23:39 include the concluding festival of the Last Great Day (in Heb Hoshana Rabbah).

42 Ye shall dwell in booths seven days; all that are Israelites born shall dwell in booths, — — but that last day was the eighth, the ceremony of drawing water from the pool, which was done on the Last Great Day, (in Heb Hoshana Rabbah). seems to have been the introduction of a later period (John 7:37).

43 that your generations may know that I made the children of Israel to dwell in booths when I brought them out of the land of Egypt: I am the Lord your God.’”

— that your generations may know; when their posterity are securely occupying the land of Canaan, the temporary dwelling in booths once a year may remind them of the goodness of God vouchsafed to their fathers in delivering them from the land of bondage, and sheltering them in booths in the wilderness.

44 And Moses declared unto the children of Israel the feasts of the Lord. — that is, these are but a Command of God convey to all the Israelites through Moses.

Leviticus 24

~~~

1 And the Lord spoke unto Moses, saying,

“Command the children of Israel that they bring unto thee pure olive oil, beaten for the light, to cause the lamps to burn continually. — the oil for the lamps of the tabernacle and the meal for the showbread were to be offerings; and the lamps to burn continually.

Outside the veil of the testimony, in the tabernacle of the congregation, shall Aaron order it from the evening unto the morning before the Lord continually; it shall be a statute for ever in your generations.

— shall Aaron order it from the evening unto the morning, before the Lord continually; that is, the lamp or lamps, or candlestick, in which they were;

— or the light of them; his business was, and so every priest’s that succeeded him, to supply the lamps with oil, to dress, him, and snuff them, that they might burn clear, and burn always, and that before the Lord, in the presence of the Lord.

He shall order the lamps upon the pure candlestick before the Lord continually. — the pure candlestick; because of its resplendent brightness, or because it was of pure gold; before the Lord; because it was before the veil into the ark and mercy-seat, where God was peculiarly present;

— Aaron must always keep the lamps burning on the lampstand of pure gold before the Lord? As Aaron was only allowed to be in the Holy of Holies only once a year, he has the candlestick just outside the Veil, in the Holy Place, but not inside the Holy of Holies.

“And thou shalt take fine flour and bake twelve cakes thereof, twotenths part shall be in one cake.

And thou shalt set them in two rows, six on a row, upon the pure table before the Lord.

And thou shalt put pure frankincense upon each row, that it may be on the bread for a memorial, even an offering made by fire unto the Lord.

Every Sabbath he shall set it in order before the Lord continually, being taken from the children of Israel by an everlasting covenant.

— every Sabbath a fresh supply was furnished; hot loaves were placed on the altar instead of the stale ones, which, having lain a week, were removed, and eaten only by the priests.

And it shall be Aaron’s and his sons’; and they shall eat it in the holy place, for it is most holy unto him of the offerings of the Lord made by fire by a perpetual statute.”

— they shall eat it in the holy place; of the many things connected with the national service which became a perquisite of the priests: they had to be consumed within the precincts of the sanctuary.

10 And the son of an Israelite woman, whose father was an Egyptian, went out among the children of Israel; and this son of the Israelite woman and a man of Israel strove together in the camp.

— the Targum of Jonathan enhances with more details, saying

“A wicked man, a rebel against the God of heaven, went out from Egypt—the son of the Egyptian man who had killed an Israelite man in Egypt and had gone in unto his wife, and she became pregnant and gave birth to a son in the midst of the children of Israel.

“And when Israel were dwelling in the wilderness, he desired to pitch his tent in the midst of the tribe of the children of Dan, but they would not allow him; because by the standards of Israel, a man dwells by his own standard with the signs according to the genealogy of their fathers.

“And they quarreled together in the camp, and they went to the house of judgment: the son of the Israelite woman, and the man, a son of Israel, who was from the tribe of Dan.”

11 And the Israelite woman’s son blasphemed the name of the Lord and cursed. And they brought him unto Moses (his mother’s name was Shelomith, the daughter of Dibri, of the tribe of Dan);

— out of Egypt, being one of that mixed multitude which came out with the Israelites, Exodus 12:38. It is probable this was done when the Israelites were near Sinai;

— and they brought him unto Moses; having heard his blasphemy, to charge him with it before him, or in order to have due punishment inflicted on him;

12 and they put him under guard, that the mind of the Lord might be shown them. — that the mind of the Lord might be shewed them; that is, that he might direct them according to the command of the Lord;

—the Targum of Jonathan says

“This is one of the four judgments which came up before Moses the prophet, and he judged them according to the mouth of the Word from on high.

“Some of them were monetary judgments, and some of them were capital judgments. In monetary judgments Moses was swift, but in capital judgments he was deliberate.

“And in these, Moses said, ‘I have not heard,’ for the purpose of teaching the heads of the Sanhedrins of Israel who are destined to arise after him, that they should be swift in monetary judgments and deliberate in capital judgments, and that they should not be ashamed to ask concerning a judgment which is difficult for them.

“For if Moses, the master of Israel, found it necessary to say, ‘I have not heard’—because of this, they shut him [the blasphemer] up in the guardhouse until the time that it should be made clear to them by the decree of the Word of the Lord.”

13 And the Lord spoke unto Moses, saying,

14 “Bring forth him that hath cursed outside the camp; and let all who heard him lay their hands upon his head, and let all the congregation stone him.

— let all the congregation stone him; the witnesses, who are the representatives of the people, cast the first stone, and then all the people who stood by covered the convict with stones.

15 And thou shalt speak unto the children of Israel, saying, ‘Whosoever curseth his God shall bear his sin. — this offender was the son of an Egyptian father, and an Israelitish mother.

16 And he that blasphemeth the name of the Lord, he shall surely be put to death, and all the congregation shall certainly stone him. As well the stranger as he that is born in the land, when he blasphemeth the name of the Lord, shall be put to death.

— and all the congregation shall certainly stone him; shall have no pity on him, nor spare him, but stone him till he dies.

17 And he that killeth any man shall surely be put to death. — the Targum of Jonahan says he shall verily be put to death by the sword.

18 And he that killeth a beast shall make it good, beast for beast. — beast for beast; or “soul for soul”; life for life, that is, a living one for that the life of which is taken away, and one every way as good as that.

19 And if a man cause a blemish in his neighbor, as he hath done, so shall it be done to him— — as he hath done, so shall it be done unto him;

20 breach for breach, eye for eye, tooth for tooth. As he hath caused a blemish in a man, so shall it be done to him again.

21 And he that killeth a beast, he shall restore it; and he that killeth a man, he shall be put to death.

— and he that killeth a man, he shall be put to death; or he that smites a man, though he does not kill him, as only makes a wound or bruise in him, because it is not said, the soul of a man, as before; but such damages did not require death, but satisfaction in another way.

22 Ye shall have one manner of law, as well for the stranger as for one of your own country; for I am the Lord your God.’” — as well for the stranger as for one of your own country; the above laws were binding upon proselytes as well as Israelites.

23 And Moses spoke to the children of Israel, that they should bring forth him that had cursed out of the camp and stone him with stones. And the children of Israel did as the Lord commanded Moses.

— and the children of Israel did as the Lord commanded Moses; they took the blasphemer, and led him out of the camp, put their hands on him, and stoned him with stones till he died.

Leviticus (21-22)

•May 28, 2026 • Leave a Comment

Leviticus 21

1 And the Lord said unto Moses, “Speak unto the priests the sons of Aaron, and say unto them: ‘There shall none be defiled for the dead among his people,

— he shall not defile himself for a dead person; that is, the priest is not to contract defilement by contact with a corpse; none of the priests shall touch the dead body, or assist at his funeral, or eat at any funeral feast.

except for his kin who is near unto him, that is: for his mother, and for his father, and for his son, and for his daughter, and for his brother, — but for his kin, that is near unto him; there are, however, seven exceptions to the general rule; should add, “and his wife”

— these being all near relations, and for whom natural affection would lead and oblige him to mourn, and show a concern for their death, and to take care of their funeral.

and for his sister, a virgin who is nigh unto him, who hath had no husband; for her may he be defiled. — and for his sister a virgin, that is nigh unto him; that is, his maiden sister who still remains in sole relationship with him; and no husband to take care of her funeral.

But he shall not defile himself, being a chief man among his people, to profane himself. — a chief man, for such not only the high priest, but others also of the inferior priests, were;

— MSG says

God spoke to Moses: “Speak to the priests, the sons of Aaron. Tell them, A priest must not ritually contaminate himself by touching the dead, except for close relatives: mother, father, son, daughter, brother,

or an unmarried sister who is dependent on him since she has no husband; for these he may make himself ritually unclean, but he must not contaminate himself with the dead who are only related to him by marriage and thus profane himself. (Leviticus 21:1-4 MSG)

They shall not make baldness upon their head, neither shall they shave off the corner of their beard nor make any cuttings in their flesh.

— not to make baldness upon their head; tattooing, too, not to show itself in the practices which disfigure their bodily appearance.

They shall be holy unto their God and not profane the name of their God, for the offerings of the Lord made by fire and the bread of their God they do offer; therefore they shall be holy. — priests are to be devoted to God’s service, and always prepared for it, and therefore shall keep themselves from all defilements;

— from MSG

“Priests must not shave their heads or trim their beards or gash their bodies. They must be holy to their God and must not profane the name of their God. Because their job is to present the gifts of God, the food of their God, they are to be holy.” (Leviticus 21:5-6 MSG)

They shall not take a wife who is a whore or profane, neither shall they take a woman put away from her husband; for he is holy unto his God. — laws concerning the priests; without blemish, and separate from sinners; profane, or defiled, or defloured, a woman who has been seduced, or one of illegitimate birth. 

Thou shalt sanctify him therefore, for he offereth the bread of thy God. He shall be holy unto thee; for I the Lord, who sanctify you, am holy. — he shall be holy unto thee; in thy account and estimation, and for thy service to offer holy sacrifices, and therefore should be careful of his holiness to preserve it;

— from MSG

“Because a priest is holy to his God he must not marry a woman who has been a harlot or a cult prostitute or a divorced woman. Make sure he is holy because he serves the food of your God. Treat him as holy because I, God, who make you holy, am holy. (Leviticus 21:7-8 MSG)

And the daughter of any priest, if she profane herself by playing the whore, she profaneth her father. She shall be burned with fire. — she shall be burnt with fire; whilst the married daughter of a layman who had gone astray was punished with death by strangling (see Leviticus 20:10).

10 “‘And he that is the high priest among his brethren, upon whose head the anointing oil was poured and who is consecrated to put on the garments, shall not uncover his head nor rend his clothes;

— nor rend his clothes; that is, “in the time of distress, or mourning for the dead,” being the intercessor between God and man, such outward expressions of sorrow might lead those in whose behalf he ministers in the sanctuary to believe that he thereby impugns the justice of Divine judgment.

11 neither shall he go in to any dead body, nor defile himself for his father or for his mother; — neither shall he go in to any corpse; that is, into a tent or house where any dead body lies, would be unclean for seven days and would be prevented doing the duty of his office;

12 neither shall he go out of the sanctuary nor profane the sanctuary of his God, for the crown of the anointing oil of his God is upon him: I am the Lord. — the anointing oil of his God are upon him; the anointing oil, which was a crown of glory, and gave him a superior dignity to others, which it became him to be careful not to debase by any of the above things.

13 And he shall take a wife in her virginity. — or, a virgin, partly for the decency of the type; though polygamy was practised by the Israelites, and even by the common priests, yet it was by no means allowed to a high priest.

14 A widow or a divorced woman or profane or a harlot, these shall he not take; but he shall take a virgin of his own people for a wife. — nor a divorced woman; whether by a priest, or a common Israelite; and indeed, if a common priest might not marry such a person, much less an high priest.

15 Neither shall he profane his seed among his people, for I the Lord do sanctify him.’” — neither shall he profane his seed among his people; by marrying any such persons, whereby his children, born of them, would lie under disgrace, and be unfit to succeed him in the priesthood, or by marrying among mean persons, or by marrying them to such as were unlawful, and would be a disparagement to them.

16 And the Lord spoke unto Moses, saying,

17 “Speak unto Aaron, saying, ‘Whosoever he be of thy seed in their generations who hath any blemish, let him not approach to offer the bread of his God.

— whosoever he be of thy seed, whether the high priest or the inferior ones; in their generations; in all successive ages, as long as your priesthood and policy endures;

— any blemish, i.e. any defect or excess of parts, any notorious deformity, or imperfection in his body; that still such persons as have notorious defects or deformities, which render them contemptible, are not fit for the ministry.

18 For whatsoever man he be that hath a blemish, he shall not approach: a blind man, or a lame, or he that hath a flat nose, or any thing superfluous, — any deformity relating to it, either the want of it wholly or in part, or the shortness, flatness, or crookedness of it;

19 or a man who is brokenfooted, or brokenhanded, — brokenfooted, or brokenhanded; that is, one with a badly cured fractured foot or hand, since in ancient days such accidents were scarcely ever properly cured.

20 or crookbacked, or a dwarf, or who hath a blemish in his eye, or hath scurvy, or scabbed, or hath his stones broken— — or crookbackt; rather, or whose eyebrows cover his eyes;

— the Targum of Jonathan says

or whose eyelids droop so as to cover his eyes, who hath no hair on his eyelids; or who hath a suffusion of whiteness with darkness in his eyes; or who hath the dry scurvy, or who is full of the blotches of Egypt, or whose testicles are swollen or shrunk,

21 no man that hath a blemish of the seed of Aaron the priest shall come nigh to offer the offerings of the Lord made by fire. He hath a blemish: he shall not come nigh to offer the bread of his God.

— no man that hath a blemish; any notorious blemish whereby he is disfigured; whether an high priest or a common priest that lies on him anyone of the above blemishes;

— he shall not come nigh to offer the bread of his God: this is repeated for its confirmation, and to show how determined the Lord was in this matter; and how much he should resent it in any that should be found guilty of the breach of those rules.

22 He shall eat the bread of his God, both of the most holy and of the holy. — he shall eat the bread of his God; but though unfit for serving at the altar, and reduced to do the menial work connected with the sanctuary, he was not only allowed to partake of the less holy sacrificial gifts.

23 Only he shall not go in unto the veil nor come nigh unto the altar, because he hath a blemish, that he profane not My sanctuaries; for I the Lord do sanctify them.’” — not to set the shewbread upon the table there, nor to light and him the lamps in the candlestick, nor to offer incense on the altar of incense.

24 And Moses told it unto Aaron and to his sons, and unto all the children of Israel. — and to all the children of Israel; to the heads of the tribes and elders of the people, and by them to the whole, that they might know who were fit, and who not, to put their sacrifice into their hands, to offer for them.

Leviticus 22

1 And the Lord spoke unto Moses, saying,

“Speak unto Aaron and to his sons, that they separate themselves from the holy things of the children of Israel, and that they profane not My holy name in those things which they hallow unto Me: I am the Lord.

— that they profane not my holy name, that is, not to take that which is holy, set apart, and elevated, and drag it down into the common, ordinary, or defiled. A careless or irreverent use of things consecrated to God tends to dishonor the name and bring disrespect on the name of God;

— this includes false swearing (Leviticus 19:12): “And ye shall not swear by My name falsely, so that thou profane the name of thy God: I am the Lord.” Using the divine name to guarantee a lie instantly treats that absolute truth as empty or worthless.

Say unto them: ‘Whosoever he be of all your seed among your generations, who goeth unto the holy things which the children of Israel hallow unto the Lord, having his uncleanness upon him, that soul shall be cut off from My presence: I am the Lord.

— having his uncleanness upon him; through a leprosy, or running issue, or touching any unclean person or thing.

Whatsoever man of the seed of Aaron is a leper or hath a running issue, he shall not eat of the holy things until he is clean. And whoso toucheth any thing that is unclean by the dead, or a man whose seed goeth from him,

— what man soever of the seed of Aaron is a leper; a young, or an old man, as the Targum of Jonathan, and indeed man or woman; for the wives and daughters of the priests, if in this, and other circumstances following, might not eat of the holy things until cleansed;

or whosoever toucheth any creeping thing whereby he may be made unclean, or a man of whom he may take uncleanness, whatsoever uncleanness he hath—

the soul who hath touched any such shall be unclean until evening, and shall not eat of the holy things unless he wash his flesh with water.

And when the sun is down he shall be clean, and shall afterwards eat of the holy things, because it is his food. — because it is his common food, his ordinary diet, that by which he subsists, having nothing else to live upon; this being the ordination of God, that he which ministered about holy things should live on them.

That which dieth of itself or is torn with beasts, he shall not eat to defile himself therewith: I am the Lord. — that which dieth of itself, or is torn with beasts; whether fowls or beasts, and even clean ones.

They shall therefore keep Mine ordinance, lest they bear sin for it and die therefore if they profane it: I the Lord do sanctify them. — lest they bear sin for it: the sanctuary, by neglecting it, and so be charged with the guilt of sin, and be obliged to bear such punishment;

— the Targum of Jonathan says, “lest they die by flaming fire, because they have profaned it.”

10 “‘There shall no stranger eat of the holy thing. A sojourner of the priest or a hired servant shall not eat of the holy thing. — there shall no stranger eat of the holy thing; by holy thing here is meant, that portion of the sacrifices which belonged to the priests.

11 But if the priest buy any soul with his money, he shall eat of it, and he that is born in his house; they shall eat of his meat.

— but if the priest buy any soul; the case, however, was different with heathen slaves whom the priest purchased; these were admitted into the Jewish community by the rite of circumcision, they were allowed to partake of the paschal lamb, and of every privilege of the Israelites;

— one special case is Samuel, though he wasn’t a slave; but an Israelites, though not of priestly line.

12 If the priest’s daughter also be married unto a stranger, she may not eat of an offering of the holy things.

— if the priest’s daughter be married; or if the priest’s daughter be married, by marrying a Hebrew of non-Aaronic descent, and thus leaving her paternal home, the daughter of the priest ceased to be part of the family circle, and lost her right to partake of the holy things.

13 But if the priest’s daughter be a widow or divorced, and have no child, and is returned unto her father’s house as in her youth, she shall eat of her father’s meat; but there shall no stranger eat thereof.

— be a widow, or divorced, and have no child; an exception, however, to this rule is, when the priest’s married daughter loses her husband either by death or by divorce, and has no children; under such circumstances she may resume her family ties under her paternal roof.

14 And if a man eat of the holy thing unwittingly, then he shall put a fifth part thereof unto it, and shall give it unto the priest with the holy thing. — if anyone eats from a holy offering accidentally, he must give back the holy offering to the priest and add twenty percent over and above the principal of the value to it.

15 And they shall not profane the holy things of the children of Israel, which they offer unto the Lord, — and they shall not profane; that is, the priests are not to desecrate the holy gifts of the Israelites by carelessly exposing them, and by not treating them with that sacred regard which is due to their being the bread of God.

16 or allow them to bear the iniquity of trespass when they eat their holy things: for I the Lord do sanctify them.’” — when they eat their holy things; the holy things belonging to the priests, which they permitting them to do.

17 And the Lord spoke unto Moses, saying,

18 “Speak unto Aaron and to his sons and unto all the children of Israel, and say unto them: ‘Whosoever he be of the house of Israel or of the strangers in Israel, who will offer his oblation for all his vows and for all his freewill offerings, which they will offer unto the Lord for a burnt offering”

— that will offer his oblation for all his vows, and for all his freewill offerings, which they will offer unto the Lord for a burnt offering; distinguish between a vow and a freewill offering; every vow is a freewill offering, but every freewill offering is not a vow;

19 ye shall offer at your own will a male without blemish of the beeves, of the sheep, or of the goats. — bullocks, sheep, and goats, were the only sorts of beasts, out of which sacrifices were taken, and those that were for burnt offerings were always to be males, and unblemished.

20 But whatsoever hath a blemish, that shall ye not offer; for it shall not be acceptable for you. — to secure for him the good pleasure of God; but an animal with a fault would not be acceptable.

21 And whosoever offereth a sacrifice of peace offerings unto the Lord to accomplish his vow, or a freewill offering in beeves or sheep, it shall be perfect to be accepted; there shall be no blemish therein.

— every peace-offering was also to be faultless, whether brought “to fulfil a special vow” or as a freewill gift.

22 Blind, or broken, or maimed, or having a wen, or scurvy, or scabbed, ye shall not offer these unto the Lord, nor make an offering by fire of them upon the altar unto the Lord.

— ye shall not offer these unto the Lord; any creatures defective in any of these instances; three times this is said, to make them careful concerning their sanctification and concerning their slaying and sprinkling of their blood.

23 Either a bullock or a lamb that hath any thing superfluous or lacking in his parts, that mayest thou offer for a freewill offering, but for a vow it shall not be accepted.

— but for a vow it shall not be accepted; because the other was according to a man’s will and pleasure, and he might bring what he would on that account; but when he made a vow that he would offer such a sacrifice, it must be of creatures that were perfect, and without blemish.

24 Ye shall not offer unto the Lord that which is bruised, or crushed, or broken, or cut; neither shall ye make any offering thereof in your land.

— that is, not only are animals thus mutilated prohibited as offerings for the altar, but this practice of gelding (castrated) is altogether forbidden to the Israelites with regard to any animal whatsoever throughout the country.

25 Neither from a stranger’s hand shall ye offer the bread of your God of any of these, because their corruption is in them and blemishes are in them; they shall not be accepted for you.’” — that is, animals that are imported and sold to the Israelites by the hands of foreigners.

26 And the Lord spoke unto Moses, saying,

27 “When a bullock or a sheep or a goat is brought forth, then it shall be seven days with its dam; and from the eighth day and thenceforth it shall be accepted for an offering made by fire unto the Lord.

— it shall be seven days under the dam; animals were not considered perfect nor good for food till the eighth day.

28 And whether it be cow or ewe, ye shall not kill it and her young both in one day. — this prohibition to slaughter the dam and its youngling the same day was not only designed to remind the Israelites of the sacred relations which exist between parent and offspring, but was especially intended to keep up feelings of humanity.

29 And when ye will offer a sacrifice of thanksgiving unto the Lord, offer it at your own will. — offer it at your own will; just what they pleased, whether a bullock, a sheep, or a goat, and whether a male or female; these were left to their own option.

30 On the same day it shall be eaten up; ye shall leave none of it until the morrow: I am the Lord. — ye shall leave none of it till the morning; of another day.

31 “Therefore shall ye keep My commandments and do them: I am the Lord. — the law about the priests and sacrifices now concludes with an appeal to both the priests and the people to faithfully observe these commandments.

32 Neither shall ye profane My holy name, but I will be hallowed among the children of Israel. I am the Lord who hallow you, — neither shall ye profane my holy name; either by despising me and my command yourselves, or by giving others occasion to profane them.

33 that brought you out of the land of Egypt to be your God: I am the Lord.” — I am the Lord; that hath sovereign right unto them, and claim upon them, and therefore they ought to be subject to his will, and observe his laws ordinances.

Leviticus (19-20)

•May 27, 2026 • Leave a Comment

Pentecost is to be counted from the first day (Leviticus 23:11 Septuagint), but what is the first Day?

“and he shall lift up the sheaf before the Lord, to be accepted for you. On the morrow of the first day the priest shall lift it up.” Lev 23:11 LXX

Leviticus 23:5 gives the context that this takes place in the first month, starting on the fourteenth day with Passover and the Days of Unleavened Bread, which last seven days. The first day, the fifteenth, is to be a holy gathering. On the following day, the sixteenth, the priest is to present the wave sheaf offering.

From the day you present the sheaf of the offering, count seven full weeks, which is forty-nine days, until the day after the seventh week—the fiftieth day—which will be Pentecost.

And from another testimony from the Targum

And on the fifteenth day of this month the feast of unleavened cakes to the Name of the Lord. Seven days you shall eat unleavened bread.

On the first day of the feast a holy convocation shall be to you; ye shall do no work of labour,

but offer the oblation to the Name of the Lord seven days; in the seventh day of the feast shall be a holy convocation; you shall do no work of labour.

And the Lord spake with Mosheh, saying:

Speak with the sons of Israel, and say to them: When you have entered into the land which I give you, and you reap the harvest, you shall bring the sheaf of the first fruits of your harvest unto the priest;

and he shall uplift the sheaf before the Lord to be accepted for you. After the first festal day of Pascha (or, the day after the feast-day of Pascha) Leviticus 23:7-11 Jonathan

Leviticus 19

And the Lord spoke unto Moses, saying,

“Speak unto all the congregation of the children of Israel, and say unto them: ‘Ye shall be holy, for I the Lord your God am holy. — ye shall be holy; separated from all the forementioned defilements, and entirely consecrated to God, and obedient to all his laws and statutes.

Ye shall fear every man his mother and his father, and keep My Sabbaths: I am the Lord your God. — and keep my Sabbaths; this is expressed in the plural number, because there were various Sabbaths:

— the seventh day Sabbath, and the seventh year Sabbath, and the jubilee, which was once in seven times seven years; even the land Sabbath; the seventh day Sabbath is chiefly meant.

Turn ye not unto idols, nor make to yourselves molten gods: I am the Lord your God. — turn ye not unto idols; as the Lord is their God, and there is no other God besides Him, the Israelites must never turn their affections nor address prayers or enquiries to idols.

“‘And if ye offer a sacrifice of peace offerings unto the Lord, ye shall offer it at your own will. — at your own will; or, according to your own pleasure,

— at your own will; or a voluntary freewill offering, of their own accord, and not by force, what you think fit; for though this sacrifice, was appreciated, it was left to their choice to determine the particulars.

It shall be eaten the same day ye offer it, and on the morrow; and if aught remain until the third day, it shall be burned in the fire.

— it shall be eaten the same day ye offer it, and on the morrow; the meaning is, that if it could be, it was best to eat it all up the same day it was offered, but if not, the remainder was to be eaten on the morrow, but by no means to be kept any longer.

And if it be eaten at all on the third day, it is abominable; it shall not be accepted. — it is abominable; it is as any common thing, as if it was no sacrifice; yea, as if it was corrupt and putrefied flesh.

Therefore every one who eateth it shall bear his iniquity, because he hath profaned the hallowed thing of the Lord; and that soul shall be cut off from among his people.

— therefore everyone that eateth it shall bear his iniquity; be chargeable with sin, be pronounced guilty, and endure the punishment, which is cutting off.

“‘And when ye reap the harvest of your land, thou shalt not wholly reap the corners of thy field, neither shalt thou gather the gleanings of thy harvest. — thou shall not wholly reap the corner of the field; but a part was to be left for the poor.

10 And thou shalt not glean thy vineyard, neither shalt thou gather every grape of thy vineyard. Thou shalt leave them for the poor and stranger: I am the Lord your God.

— left for the poor; is the poor Israelite; “the stranger” is properly the foreigner, or a proselyte who could possess no land of his own in the land of Israel.

11 “‘Ye shall not steal, neither deal falsely, neither lie one to another. — not dealing falsely; not defrauding and over reaching in trade and commerce, particularly not being faithful to a trust committed to them.

12 And ye shall not swear by My name falsely; neither shalt thou profane the name of thy God: I am the Lord. — not swearing by my name falsely: this is to show how one sin draws on another, and that when men will lie for their own advantage, they will easily be induced to perjury.

13 “‘Thou shalt not defraud thy neighbor, neither rob him. The wages of him that is hired shall not remain with thee all night until the morning. — MSG “Don’t exploit your friend or rob him. “Don’t hold back the wages of a hired hand overnight.

14 Thou shalt not curse the deaf, nor put a stumbling block before the blind, but shalt fear thy God: I am the Lord. — do no hurt to any, because they are unable to avenge themselves. We ought to take heed of doing any thing which may occasion our weak brother to fall.

14 Thou shalt not curse the deaf, nor put a stumbling block before the blind, but shalt fear thy God: I am the Lord. — thou shalt not curse the deaf; to revile one who cannot hear, and is therefore unable to vindicate himself, is both inexpressibly mean and wicked.

15 “‘Ye shall do no unrighteousness in judgment. Thou shalt not respect the person of the poor, nor honor the person of the mighty, but in righteousness shalt thou judge thy neighbor.

— ye shall do no mischiefs in judgment; this is said with respect to judges and witnesses; that the one should not bear false witness in a court of judicature to the perversion of justice, and the other should not pronounce an unrighteous sentence, justifying the wicked and condemning the righteous.

16 “‘Thou shalt not go up and down as a talebearer among thy people; neither shalt thou stand against the blood of thy neighbor: I am the Lord.

— thou shalt not be a tale-bearer, or thou shalt not go about slandering; either by bearing a false testimony, whereby his blood is in danger of being shed when innocent; or by being silent, and not hearing a testimony for him, whereby the shedding of his innocent blood might have been prevented.

17 “‘Thou shalt not hate thy brother in thine heart. Thou shalt in any wise rebuke thy neighbor, and not let sin come upon him. — you shall not hate your brother in your heart, nor shall you rebuke your brother in any way, lest you bear sin because of him.

18 Thou shalt not avenge, nor bear any grudge against the children of thy people, but thou shalt love thy neighbor as thyself: I am the Lord.

— but thou shalt love thy neighbour as thyself; sincerely and heartily, as a man loves himself, doing all the good to him as a man does to himself, or would have done to himself.

19 “‘Ye shall keep My statutes. Thou shalt not let thy cattle breed with a diverse kind. Thou shalt not sow thy field with mingled seed; neither shall a garment mingled with linen and wool come upon thee.

— thou shall not let thy cattle gender with a diverse kind; or “cause them to gender” for cattle do not usually of themselves gender with a diverse kind, unless directed and solicited to it, as a male of one kind with a female of another;

— for instance, an horse with a she ass, or an he ass with a mare, and even creatures that were like one another, yet of different kinds, were not to mix together; as a wolf and a dog, a hound and a fox, goats and roebucks, goats and sheep, a horse and a mule, a mule and an ass; for though they are like one another, they are of different kinds.

20 “‘And whosoever lieth carnally with a woman who is a bondmaid, betrothed to a husband, and not at all redeemed nor freedom given her, she shall be scourged. They shall not be put to death, because she was not free.

— betrothed to an husband; rather, who has been betrothed to a man. The reference appears to be to a bondwoman who has been betrothed to a fellow-servant by her master;

— she shall be scourged; and not he, as the Targum of Jonathan says.

21 And he shall bring his trespass offering unto the Lord, unto the door of the tabernacle of the congregation: even a ram for a trespass offering. — he shall bring his trespass offering unto the Lord; to the priest of the Lord, to offer it for him; he, and not she, as the Targum of Jonathan has it.

22 And the priest shall make an atonement for him with the ram of the trespass offering before the Lord for his sin which he hath done, and the sin which he hath done shall be forgiven him.

23 “‘And when ye shall come into the land and shall have planted all manner of trees for food, then ye shall count the fruit thereof as uncircumcised. Three years shall it be as uncircumcised unto you. It shall not be eaten of.

— as uncircumcised, that is, as unclean, not to be eaten, but cast away, and counted abominable, as the foreskins are;

— three years shall it be; the cutting off of the fruit is to be repeated every year during three successive years. As the produce of the earliest year when let to grow upon the trees is both stunted and tasteless.

24 But in the fourth year all the fruit thereof shall be holy with which to praise the Lord. — but in the fourth year shall be holy; separated and devoted to the service of God, to be given to the priest.

25 And in the fifth year shall ye eat of the fruit thereof, that it may yield unto you the increase thereof: I am the Lord your God. — and in the fifth year; it was only in the fifth year that the owner was permitted to eat the fruits without redeeming them.

26 “‘Ye shall not eat any thing with the blood; neither shall ye use enchantment, nor observe omens. — any thing with the blood; any flesh out of which the blood is not first poured.

27 Ye shall not round off the corners of your heads, neither shalt thou mar the corners of thy beard. — round the corners of your heads; that is, they are not to shave off the hair around the temples and behind the ears, so as to leave the head bald;

— neither shall thou mar the corners of thy beard; by shaving them entirely.

28 Ye shall not make any cuttings in your flesh for the dead, nor print any marks upon you: I am the Lord.

— ye shall not make any cuttings in your flesh for the dead; by tattooing, imprinting figures of flowers, leaves, stars; either with their nails, tearing their cheeks and other parts, or with any instrument: knife, razor; it was the custom of the Amorites, when anyone died, to cut their flesh.

29 “‘Do not prostitute thy daughter to cause her to be a whore, lest the land fall to whoredom and the land become full of wickedness. — lest the land fall to whoredom, and the land become full of wickedness: of the wickedness of whoredom.

30 Ye shall keep My Sabbaths and reverence My sanctuary: I am the Lord. — ye shall keep my sabbaths; by attending to the worship and service of God on Sabbath days, they and their children would be preserved from the idolatry of the Gentiles, and all the filthy practices attending it.

31 “‘Regard not those who have familiar spirits, neither seek after wizards to be defiled by them: I am the Lord your God.

— those who have familiar spirits; it implied that those who practised this craft were supposed to be attended by an invisible spirit who was subject to their call to supply them with supernatural information; or practising as witchcrafts; 

— neither seek after wizards or soothsayers; such as pretend to a great deal of knowledge, as the word signifies; such as are called cunning men; the expression “wizard,” which in old English denotes “wise man,” “sage,” is almost the exact equivalent of the word in the original.

32 “‘Thou shalt rise up before the hoary head and honor the face of the old man, and fear thy God: I am the Lord. — rise up before the hoary head; but though no regard is to be paid to these soothsayers and cunning men, the greatest reverence is to be shown to the aged, for “with the old is wisdom, and in length of days understanding.”

33 “‘And if a stranger sojourn with thee in your land, ye shall not vex him. — ye shall not vex him; having once been admitted into the community, the Israelites were forbidden to upbraid him with his nationality or throw at him the fact that he was originally a heathen.

34 But the stranger who dwelleth with you shall be unto you as one born among you, and thou shalt love him as thyself, for ye were strangers in the land of Egypt: I am the Lord your God.

— shalt love him as thyself; he is not simply to be treated with consideration and courtesy because he is a foreigner, and enjoy the rights and receive the justice due to every human being, but he is to be put on a perfect equality with the ordinary Israelite.

35 “‘Ye shall do no unrighteousness in judgment, in measuring length, weight, or number. — in weight, or in measure; the first of these signifies the measure of land, of fields and so likewise of anything that is measured, not only by the rod or line, but by the yard or ell, as cloth and other things.

36 Just balances, just weights, a just ephah, and a just hin shall ye have: I am the Lord your God, who brought you out of the land of Egypt. — just balances, just weights; that is, they were to be the same for buying as for selling.

37 Therefore shall ye observe all My statutes and all My judgments, and do them: I am the Lord.’” — because my blessings and deliverances are not indulgences to sin, but greater obligations to all duties to God.

Leviticus 20

And the Lord spoke unto Moses, saying,

“Again, thou shalt say to the children of Israel: ‘Whosoever he be of the children of Israel, or of the strangers who sojourn in Israel, who giveth any of his seed unto Molech, he shall surely be put to death. The people of the land shall stone him with stones.

— Molech, literally, “the King,” called also Moloch, Milcom, and Malcham, was known in later times as “the abomination of the Ammonites” 1 Kings 11:5

— the nature of the rite and of the impious custom called passing children through the fire to Molech is probably true; the practices appear to have been essentially connected with magical arts, probably also with unlawful lusts, and with some particular form of profane swearing.

And I will set My face against that man and will cut him off from among his people, because he hath given of his seed unto Molech, to defile My sanctuary and to profane My holy name.

— and to profane my holy name: by sacrificing to an idol, when sacrifice should be offered to God; and such a sacrifice as would cause the name of God, and his holy laws, and true religion, to be blasphemed and evil, spoken of among the Gentiles.

And if the people of the land do in any way hide their eyes from the man when he giveth of his seed unto Molech and kill him not,

— and if the people of the land; if the community itself, whose duty it is to execute the sentence, either from culpable indifference or criminal sympathy with the sin, connive at it;

then I will set My face against that man and against his family and will cut him off, and all who go a whoring after him to commit whoredom with Molech, from among their people.

— then I will set my face against that man; that man that sees him do the fact, and winks at it, or the judge that connives at him, and will not condemn him, as well as the man that has committed the iniquity.

“‘And the soul that turneth after such as have familiar spirits and after wizards to go a whoring after them, I will even set My face against that soul and will cut him off from among his people.

— such as have familiar spirits; to seek knowledge, or counsel, or help from them; the same punishment will be visited upon the man who consults necromancers; Jonathan says “and will destroy him by a plague from among his people.”

“‘Sanctify yourselves therefore and be ye holy, for I am the Lord your God. — sanctify yourselves therefore; by abstaining from such impious and idolatrous practices, as well as by observing the holy commandments of the Lord; otherwise internal sanctification is not the work of man, but of the Lord himself.

“‘And ye shall keep My statutes and do them: I am the Lord who sanctify you. — and ye shall keep my statutes, and do them; not only those respecting the above things, but all others, which would be a means of preserving them from sin, and of promoting holiness in their lives and conversations;

— I am the Lord which sanctify you: who had separated and distinguished them from all other people on earth, and who had given them holy laws, as the means of holiness; and who only could and did sanctify internally, by his spirit, such or them as were sanctified in heart, as well as outwardly.

“‘For every one that curseth his father or his mother shall be surely put to death. He hath cursed his father or his mother: his blood shall be upon him.

— for everyone that curseth his father or his mother; here begins the account of the penalties annexed to the several laws in the preceding chapter; and that respecting the fear and honour of parents being the first,

10 “‘And the man that committeth adultery with another man’s wife, even he that committeth adultery with his neighbor’s wife, the adulterer and the adulteress shall surely be put to death.

— this death was inflicted for six crimes; (1) upon him who had commerce with another man’s wife; (2) who smote his father or mother; (3) who stole an Israelite; (4) who being an elder rebelled against the decree of the senate (Deuteronomy 17:12); (5) who played the false prophet; and (6) who prophesied in the name of another god.

11 And the man that lieth with his father’s wife hath uncovered his father’s nakedness. Both of them shall surely be put to death: their blood shall be upon them.

— it should be noted that having sex with a stepmother or daughter-in-law are put, by the punishment inflicted upon them, on the same level with adultery and unnatural crimes.

12 And if a man lie with his daughter-in-law, both of them shall surely be put to death. They have wrought confusion: their blood shall be upon them. — confusion; by perverting the order which God hath appointed, and making the same offspring both his own child and his grand-child.

13 “‘If a man also lie with mankind as he lieth with a woman, both of them have committed an abomination. They shall surely be put to death: their blood shall be upon them.

— if a man lie also with a man as he lieth with a woman; is guilty of the sin of sodomy, this is a breach of the law and worthy of death; be slain by stoning,

— as the Targum of Jonathan says

And if a man lie with a man as with a woman, they have wrought abomination; both of them shall die by the stoning of stones.

14 “‘And if a man take a wife and her mother, it is wickedness. They shall be burned with fire, both he and they, that there be no wickedness among you.

— it is wickedness; abominable wickedness, shocking and detestable; there are other things, which also are wicked and not to be done, but this is extremely wicked, wickedness to a high degree.

15 “‘And if a man lie with a beast, he shall surely be put to death; and ye shall slay the beast. — if a man lie with a beast; a sin quite unnatural, exceeding shocking and detestable, forbidden in Leviticus 18:23.

16 And if a woman approach unto any beast and lie down thereto, thou shalt kill the woman and the beast. They shall surely be put to death: their blood shall be upon them.

— thou shall kill the woman and the beast: the woman by stoning, and the beast with clubs, as the Targum of Jonathan; and this for the same reasons as before, as well as to prevent monstrous births.

17 “‘And if a man shall take his sister, his father’s daughter or his mother’s daughter, and see her nakedness and she see his nakedness, it is a wicked thing; and they shall be cut off in the sight of their people. He hath uncovered his sister’s nakedness: he shall bear his iniquity.

— if a man shall take his sister, his father’s daughter, or his mother’s daughter; take her to be his wife, or commit lewdness with her, it is not lawful to marry her, or lie with her.

18 “‘And if a man shall lie with a woman having her sickness and shall uncover her nakedness, he hath discovered her fountain, and she hath uncovered the fountain of her blood; and both of them shall be cut off from among their people.

— a woman having her sickness; her monthly periods, which make her weak and languid, which is forbidden.

19 And thou shalt not uncover the nakedness of thy mother’s sister nor of thy father’s sister, for he uncovereth his near kin: they shall bear their iniquity. — for he uncovereth his near kin; as an aunt is to a man, and so an uncle to a woman, and both equally criminal.

20 And if a man shall lie with his uncle’s wife, he hath uncovered his uncle’s nakedness. They shall bear their sin: they shall die childless.

— they shall die childless; either the offspring should not be regarded as lawfully theirs, nor be entitled to any hereditary privileges, or they should have no blessing in their children.

21 And if a man shall take his brother’s wife, it is an unclean thing. He hath uncovered his brother’s nakedness: they shall be childless. — and if a man shall take his brother’s wife; to his wife, whether in his life, as the Targum of Jonathan adds, or whether after his death;

— unless when there is no issue, then he was obliged to it by another law, Deuteronomy 25:5; which is now ceased, and the law in Leviticus 18:16; here referred to, stands clear of all exceptions.

22 “‘Ye shall therefore keep all My statutes and all My judgments, and do them, that the land whither I bring you to dwell therein spew you not out. — that the land spue you not; as the stomach does its food when it is loathsome and nauseous to it, and it cannot bear it; Leviticus 18:25.

23 And ye shall not walk in the manners of the nation which I cast out before you; for they committed all these things, and therefore I abhorred them.

— for there were seven nations cast out for them; and notorious for their wickedness: hence we often meet with this phrase, “the way of the Amorites” they would be ejected and abhorred by him, as the Targums of Jonathan says.

24 But I have said unto you, “Ye shall inherit their land, and I will give it unto you to possess it, a land that floweth with milk and honey.” I am the Lord your God, who have separated you from other people.

— but I have said unto you; that is, promised to your fathers Abraham, Isaac, and Jacob, and also to you, that he would expel the Canaanites, and give the land to the Israelites as an inheritance;

— I am the Lord your God; had chosen them above all people, to be a special and peculiar people to him; had distinguished them by his favours, and had given them particular laws and ordinances, to observe and walk according to them, different from all other nations, which it became them carefully to regard.

25 Ye shall therefore put difference between clean beasts and unclean, and between unclean fowls and clean; and ye shall not make your souls abominable by beast or by fowl, or by any manner of living thing that creepeth on the ground, which I have separated from you as unclean.

— have separated you from other people; your selection from the rest of the nations was for the all-important end of preserving the knowledge and worship of the true God amid the universal apostasy.

26 And ye shall be holy unto Me; for I the Lord am holy and have severed you from other people, that ye should be Mine.

— and ye shall be holy unto me; separated from all unclean persons and things, and devoted to his service, and obedient to all his commands, and so live holy lives and conversations, according to his will, and to his honour and glory;

— for I the Lord am holy; and therefore they, his people, should be like him, and imitate him, and observe those things which are agreeable to his holy nature and will, and yield a cheerful obedience to his holy precepts;

— and have severed you from other people, that ye should be mine; which is a very forcible argument, a strong motive, and which laid them under great obligation to obedience and holiness.

27 “‘A man also or woman who hath a familiar spirit, or who is a wizard, shall surely be put to death. They shall stone them with stones: their blood shall be upon them.’”

— but a man also or woman; that is, because the Israelites are God’s holy ones, therefore any man or woman who pretends to disclose future events by means of necromancy, thus usurping the functions of God, is to be stoned to death.

THE MISSING HOURS OF CHRIST

•May 26, 2026 • Leave a Comment

Concerning our coronavirus pandemic mayhem . . .

Deuteronomy 28:28 The LORD shall smite thee with madness, and blindness, and astonishment of heart; 29 and thou shalt grope at noonday, as the blind gropeth in darkness.
Isaiah 45:7 I create darkness; and I create evil; I, the LORD, do all these things.

THAT NIGHT WAS THE THIRTEENTH

AND

THE MISSING 18 HOURS OF CHRIST BEFORE BEING CRUCIFIED

The purpose of this article and the details given is to show that the Last Supper occurred on the thirteenth of Nisan and not on the fourteenth as most Christians believe. Neither was the Last Supper a Passover, not for Christ and His disciples nor even for the Sadducees, who would have kept their Passover on the fourteenth.

That night was on the thirteenth and was just an ordinary supper!

Beside, there were the missing 18 hours that most students of the Gospels missed.

Below are the evidence, right from the Scriptures:

Jesus’ Last Hours
(The Hours used are Jewish reckoning; AM (Ante Meridiem “before noon”), and PM (Post Meridiem “after noon”) are Romans)

Prelude to the Passover
Matthew 26:1 (KJ21) And it came to pass, when Jesus had finished all these sayings, He said unto His disciples,
2 “Ye know that after two days is the Feast of the Passover, and the Son of Man is betrayed to be crucified.”
3 Then the chief priests and the scribes and the elders of the people assembled together unto the palace of the high priest, who was called Caiaphas,
4 and consulted that they might take Jesus by stealth and kill Him.
5 But they said, “Not on the feast day, lest there be an uproar among the people.”

Jesus anointed in Bethany
Matthew 26:6 Now when Jesus was in Bethany in the house of Simon the leper,
7 there came unto Him a woman having an alabaster box of very precious ointment, and poured it on His head as He sat at meat.
8 But when His disciples saw it, they were indignant, saying, “To what purpose is this waste?
9 For this ointment might have been sold for much and given to the poor.”
10 When Jesus perceived this, He said unto them, “Why trouble ye the woman? For she hath wrought a good work upon Me.
11 For ye have the poor always with you, but Me ye have not always.
12 For in that she hath poured this ointment on My body, she did it for My burial.
13 Verily I say unto you, wheresoever this Gospel shall be preached in the whole world, there shall also this, which this woman hath done, be told as a memorial of her.”

Judas promised 30 pieces of silver
Matthew 26:14 Then one of the twelve, called Judas Iscariot, went unto the chief priests
15 and said unto them, “What will ye give me if I will deliver Him unto you?” And they covenanted with him for thirty pieces of silver.
16 And from that time he sought opportunity to betray Him.

Disciples prepared for Passover
Matthew 26:17 Now on the first day of the Feast of Unleavened Bread, the disciples came to Jesus, saying unto Him, “Where wilt Thou that we prepare for Thee to eat the Passover?”
18 And He said, “Go into the city to a certain man and say unto him, ‘The Master saith, “My time is at hand; I will keep the Passover at thy house with My disciples.”’”
19 And the disciples did as Jesus had appointed them, and they made ready the Passover.

The Last Supper Monday (6:00 PM) Even, 13th Nisan
Luke 22:14 And when the hour had come, He sat down and the twelve apostles with Him.
15 And He said unto them, “With desire I have desired to eat this Passover with you before I suffer”

If that night was the Passover night, Jesus would had broken one of the ordinances according to Numbers 9:12: “They shall leave none of it [food remains] unto the morning (boqer), nor break any bone of it. According to all the ordinances of the Passover they shall keep it.”

They left early and if Jesus had sinned, all humanity would be flushed down the toilet.

Second, if they had killed the lamb at sunset at 6 PM as the Church of God Communities believe, it would be a miracle if they could have the lamb roasted and meal ready before 10 PM, but for this exercise, let’s start at 6 PM, because that night was the thirteenth.

Taking into consideration a very unusual word for “desire” is epithumia in the Greek, which is something forbidden, perhaps this verse should be translated as: “With fervent desire I have desired to eat this Passover with you before I suffer; but I’m saying to you now, I am forbidden and denied this privilege, and I will no longer eat with you until we’re all in the kingdom of God.” — for a detailed exegesis see endnote.

16 for I say unto you, I will not anymore eat thereof until it be fulfilled in the Kingdom of God.” John 13:1 Now before the Feast of the Passover, when Jesus knew that His hour had come that He should depart out of this world unto the Father, having loved His own who were in the world, He loved them unto the end.

John 12:2 And supper being ended, and the devil having now put into the heart of Judas Iscariot, Simon’s son, to betray Him, — other translations say “during supper” — if it was a Passover why didn’t any of the Gospel writers say so? Not one!
3 Jesus, knowing that the Father had given all things into His hands and that He had come from God and was going to God,

Foot washing (only recorded by John) (7:00 PM) Monday Night, 13th Nisan
John 13:4 rose from supper and laid aside His garments, and took a towel and girded Himself.
5 After that He poured water into a basin, and began to wash the disciples’ feet and to wipe them with the towel wherewith He was girded.

Among Eastern people it was customary, before eating, to wash the feet; and to do this, or to bring water for it, was one of the rites of hospitality. See Genesis 18:4; Judges 19:21. The reasons for this were, that they wore “sandals,” which covered only the bottom of the feet, and that when they ate they reclined on couches or sofas. It became therefore necessary that the feet should be often washed.

6 Then came He to Simon Peter, and Peter said unto Him, “Lord, dost Thou wash my feet?”
7 Jesus answered and said unto him, “What I do thou knowest not now, but thou shalt know hereafter.”
8 Peter said unto Him, “Thou shalt never wash my feet.” Jesus answered him, “If I wash thee not, thou hast no part with Me.”
9 Simon Peter said unto Him, “Lord, not my feet only, but also my hands and my head.”
10 Jesus said to him, “He that is washed needeth not but to wash his feet, but is clean every whit. And ye are clean, but not all.”
11 (For He knew who would betray Him; therefore He said, “Ye are not all clean.”)
12 So after He had washed their feet and had taken His garments and had sat down again, He said unto them, “Know ye what I have done to you?
13 Ye call Me Master and Lord; and ye say well, for so I am.
14 If I then, your Lord and Master, have washed your feet, ye also ought to wash one another’s feet.
15 For I have given you an example, that ye should do as I have done to you.
16 Verily, verily I say unto you, the servant is not greater than his lord, neither he that is sent greater than he that sent him.
17 If ye know these things, happy are ye if ye do them.

Judas left to betray Jesus (7:00 PM) Monday Night, 13th Nisan
John 13:18 “I speak not of you all. I know whom I have chosen; but that the Scripture may be fulfilled, ‘He that eateth bread with Me hath lifted up his heel against Me.’
19 Now I tell you before it comes that, when it is come to pass, ye may believe that I am He.
20 Verily, verily I say unto you, he that receiveth whomsoever I send, receiveth Me; and he that receiveth Me, receiveth Him that sent Me.”
21 When Jesus had thus said, He was troubled in spirit, and testified and said, “Verily, verily I say unto you that one of you shall betray Me.”
22 Then the disciples looked at one another, not knowing of whom He spoke.
23 Now there was leaning on Jesus’ bosom, one of His disciples, whom Jesus loved.
24 Simon Peter therefore beckoned to him, that he should ask who it should be of whom He spoke.
25 He then, leaning on Jesus’ breast, said unto Him, “Lord, who is it?”
26 Jesus answered, “He it is to whom I shall give a sop when I have dipped it.” And when He had dipped the sop, He gave it to Judas Iscariot, the son of Simon.
27 And after the sop, Satan entered into him. Then Jesus said unto him, “What thou doest, do quickly.”
28 Now no man at the table knew with what intent He spoke this unto him.
29 For some of them thought, because Judas had the money bag, that Jesus had said unto him, “Buy those things that we have need of for the feast,” or that he should give something to the poor.
30 Judas then, having received the sop, went immediately out. And it was night.
31 Therefore when he had gone out, Jesus said, “Now is the Son of Man glorified, and God is glorified in Him.
32 If God be glorified in Him, God shall also glorify Him in Himself, and shall straightway glorify Him.

Wine and unleavened bread (7:00 PM) Monday Night, 13th Nisan
Luke 22:17 And He took the cup, and gave thanks and said, “Take this, and divide it among yourselves;
18 for I say unto you, I will not drink of the fruit of the vine until the Kingdom of God shall come.”
19 And He took bread, and gave thanks and broke it and gave it unto them, saying, “This is My body which is given for you. This do in remembrance of Me.”
20 Likewise also He took the cup after supper, saying, “This cup is the new testament in My blood, which is shed for you.
21 But behold, the hand of him that betrayeth Me is with Me on the table.
22 And truly the Son of Man goeth as it was determined; but woe unto that man by whom He is betrayed!”
23 And they began to inquire among themselves which of them it was that should do this thing.
24 And there was also a contention among them, which of them should be accounted the greatest.
25 And He said unto them, “The kings of the Gentiles exercise lordship over them, and they that exercise authority over them are called ‘benefactors.’
26 But ye shall not be so; but he that is greatest among you, let him be as the younger, and he that is chief, as he that doth serve.
27 For who is greater, he that sitteth at meat or he that serveth? Is it not he that sitteth at meat? But I am among you as He that serveth.
28 “Ye are they that have continued with Me in My temptations.
29 And I appoint unto you a Kingdom, as My Father hath appointed unto Me,
30 that ye may eat and drink at My table in My Kingdom, and sit on thrones judging the twelve tribes of Israel.”

A new commandment (8:00 PM) Monday Night, 13th Nisan
John 13:33 Little children, yet a little while I am with you. Ye shall seek Me; and as I said unto the Jews, ‘Whither I go ye cannot come,’ so now say I to you.
34 A new commandment I give unto you: that ye love one another, as I have loved you, that ye also love one another.
35 By this shall all men know that ye are My disciples: if ye have love one for another.”

Prophecy about Peter denying Christ
Luke 22:31 And the Lord said, “Simon, Simon! Behold, Satan hath desired to have you, that he may sift you as wheat.
32 But I have prayed for thee, that thy faith fail not; and when thou art converted, strengthen thy brethren.”
33 And Peter said unto Him, “Lord, I am ready to go with Thee, both into prison and to death.”
34 And He said, “I tell thee, Peter, the cock shall not crow this day before thou shalt thrice deny that thou knowest Me.”

Christ’s instruction to the disciples (8:00 PM) Monday Night, 13th Nisan
Luke 22:35 And He said unto them, “When I sent you without purse and pack and shoes, lacked ye anything?” And they said, “Nothing.”
36 Then said He unto them, “But now, he that hath a purse, let him take it and likewise his pack; and he that hath no sword, let him sell his garment and buy one.
37 For I say unto you that this that is written must yet be accomplished in Me: ‘And He was reckoned among the transgressors.’ For the things concerning Me have an end.”
38 And they said, “Lord, behold, here are two swords.” And He said unto them, “It is enough.”

Thomas Coke Commentary on Luke 22:38. Lord, behold, here are two swords.— Our Lord’s disciples, mistaking his meaning about the swords, replied, they had two: the reason why they had any at all, probably, was, that they might defend themselves against robbers in their journey from Galilee and Perea, and from the beasts of prey which in those parts were very frequent and dangerous in the night time: it afterwards appears, that one of these swords was Peter’s. See John 18:10. Our Lord replies to the disciples, “It is enough for weapons of this sort; my chief intent is, to direct you to another kind of defence; even that which arises from piety and faith.” This is strongly intimated by our Lord’s saying that two swords were sufficient; which, it is evident, they could not have been for so many men, had our Lord meant what he said in a literal sense.

They sang a hymn and left (9:00 PM) Monday Night, 13th Nisan
Matthew 26:30 And when they had sung a hymn, they went out unto the Mount of Olives.

“They shall leave none of it [food remains] unto the morning (boqer), nor break any bone of it. According to all the ordinances of the Passover they shall keep it” Numbers 9:12.

Jesus and His disciples left for the Garden of Gethsemane and according to most timeline it was around 9:00 PM. Further, they left without burning any food remains or the bones, infringing one of the Passover ordinances according to Numbers 9:12, if that night was a Passover night. OBVIOUSLY IT WASN’T. — for a detailed exegesis see endnote.

More discourse (9:00 PM) Monday Night, 13th Nisan
John 14:1 “Let not your heart be troubled. Ye believe in God; believe also in Me.
2 In My Father’s house are many mansions; if it were not so, I would have told you. I go to prepare a place for you.
3 And if I go and prepare a place for you, I will come again and receive you unto Myself, that where I am, there ye may be also.
4 And whither I go ye know, and the way ye know.”
5 Thomas said unto Him, “Lord, we know not whither Thou goest; and how can we know the way?”
6 Jesus said unto him, “I am the Way, the Truth, and the Life; no man cometh unto the Father, but by Me.
7 If ye had known Me, ye should have known My Father also; and from henceforth ye know Him, and have seen Him.”
8 Philip said unto Him, “Lord, show us the Father, and it sufficeth us.”
9 Jesus said unto him, “Have I been so long a time with you, and yet hast thou not known Me, Philip? He that hath seen Me hath seen the Father; and how sayest thou then, ‘Show us the Father’?
10 Believest thou not that I am in the Father, and the Father in Me? The words that I speak unto you I speak not of Myself; but the Father that dwelleth in Me, He doeth the works.
11 Believe Me that I am in the Father, and the Father in Me; or else believe Me for the very works’ sake.
12 Verily, verily I say unto you, he that believeth in Me, the works that I do he shall do also; and greater works than these shall he do, because I go unto My Father.
13 And whatsoever ye shall ask in My name, that will I do, that the Father may be glorified in the Son.
14 If ye shall ask anything in My name, I will do it.
15 “If ye love Me, keep My commandments.
16 And I will pray the Father, and He shall give you another Comforter, that He may abide with you forever”
17 even the Spirit of Truth, whom the world cannot receive, because it seeth Him not, neither knoweth Him. But ye know Him, for He dwelleth with you, and shall be in you.
18 “I will not leave you comfortless; I will come to you.
19 Yet a little while and the world seeth Me no more, but ye see Me. Because I live, ye shall live also.
20 At that day ye shall know that I am in My Father, and you in Me, and I in you.
21 He that hath My commandments and keepeth them, he it is that loveth Me; and he that loveth Me shall be loved by My Father, and I will love him and will manifest Myself to him.”
22 Judas (not Iscariot) said unto Him, “Lord, how is it that Thou wilt manifest Thyself unto us, and not unto the world?”
23 Jesus answered and said unto him, “If a man love Me, he will keep My words; and My Father will love him, and We will come unto him and make Our abode with him.
24 He that loveth Me not, keepeth not My sayings. And the Word which you hear is not Mine, but the Father’s who sent Me.
25 “These things have I spoken unto you, being yet present with you.
26 But the Comforter, who is the Holy Ghost whom the Father will send in My name, He shall teach you all things and bring all things to your remembrance, whatsoever I have said unto you.
27 “Peace I leave with you; My peace I give unto you, not as the world giveth, give I unto you. Let not your heart be troubled, neither let it be afraid.
28 Ye have heard how I said unto you, ‘I go away and come again unto you.’ If ye loved Me, ye would rejoice because I said, ‘I go unto the Father,’ for My Father is greater than I.
29 And now I have told you before it comes to pass, that when it is come to pass, ye might believe.
30 “Hereafter I will not talk much with you, for the prince of this world cometh, and hath nothing in Me.
31 But that the world may know that I love the Father, as the Father gave Me commandment, even so I do. Arise, let us go hence.

More discourse (9:30 PM) Monday Night, 13th Nisan
John 15:1 “I am the true vine, and My Father is the husbandman.
2 Every branch in Me that beareth not fruit He taketh away; and every branch that beareth fruit, He purgeth it, that it may bring forth more fruit.
3 Now ye are clean through the Word which I have spoken unto you.
4 “Abide in Me, and I in you. As the branch cannot bear fruit of itself, unless it abide in the vine, no more can ye, unless ye abide in Me.
5 “I am the vine, ye are the branches. He that abideth in Me and I in Him, the same bringeth forth much fruit, for without Me ye can do nothing.
6 If a man abides not in Me, he is cast forth as a branch and is withered; and men gather them and cast them into the fire, and they are burned.
7 If ye abide in Me, and My words abide in you, ye shall ask what ye will, and it shall be done unto you.
8 Herein is My Father glorified, that ye bear much fruit; so shall ye be My disciples.
9 “As the Father hath loved Me, so have I loved you. Continue ye in My love.
10 If ye keep My commandments, ye shall abide in My love, even as I have kept My Father’s commandments, and abide in His love.
11 These things have I spoken unto you, that My joy might remain in you, and that your joy might be full.
12 “This is My commandment: that ye love one another, as I have loved you.
13 Greater love hath no man than this, that a man lay down his life for his friends.
14 Ye are My friends if ye do whatsoever I command you.
15 Henceforth I call you not servants, for the servant knoweth not what his lord doeth; but I have called you friends, for all things that I have heard of My Father, I have made known unto you.
16 Ye have not chosen Me, but I have chosen you and ordained you, that ye should go and bring forth fruit and that your fruit should remain, that whatsoever ye shall ask of the Father in My name, He may give it to you.
17 These things I command you, that ye love one another.
18 “If the world hates you, ye know that it hated Me before it hated you.
19 If ye were of the world, the world would love his own; but because ye are not of the world, but I have chosen you out of the world, therefore the world hateth you.
20 Remember the word that I said unto you: ‘The servant is not greater than his lord.’ If they have persecuted Me, they will also persecute you; if they have kept My saying, they will keep yours also.
21 But all these things will they do unto you for My name’s sake, because they know not Him that sent Me.
22 If I had not come and spoken unto them, they would not have sin, but now they have no cloak for their sin.
23 He that hateth Me hateth My Father also.
24 If I had not done among them the works which no other man did, they would not have had sin; but now they have both seen and hated both Me and My Father.
25 But this cometh to pass, that the word might be fulfilled that is written in their law: ‘They hated Me without a cause.’
26 “But when the Comforter is come, whom I will send unto you from the Father, even the Spirit of Truth who proceedeth from the Father, He shall testify of Me.
27 And ye also shall bear witness, because ye have been with Me from the beginning.

More discourse (9:30 PM) Monday Night, 13th Nisan
John 16:1 “These things have I spoken unto you, that ye should not lose faith.
2 They shall put you out of the synagogues; yea, the time cometh that whosoever killeth you will think that he doeth God service.
3 And these things will they do unto you, because they have not known the Father, nor Me.
4 But these things have I told you, that when the time shall come, ye may remember that I told you of them. “And these things I said not unto you at the beginning, because I was with you.
5 But now I go My way to Him that sent Me, and none of you asketh Me, ‘Whither goest Thou?’
6 But because I have said these things unto you, sorrow hath filled your heart.
7 Nevertheless I tell you the truth. It is expedient for you that I go away, for if I go not away, the Comforter will not come unto you; but if I depart, I will send Him unto you.
8 And when He is come, He will reprove the world concerning sin, and concerning righteousness, and concerning judgment:
9 concerning sin, because they believe not in Me;
10 concerning righteousness, because I go to My Father and ye see Me no more;
11 concerning judgment, because the prince of this world is judged.
12 “I have yet many things to say unto you, but ye cannot bear them now.
13 However when He, the Spirit of Truth, is come, He will guide you into all truth; for He shall not speak from Himself, but whatsoever He shall hear, that shall He speak; and He will show you things to come.
14 He shall glorify Me, for He shall receive of Mine, and shall show it unto you.
15 All things that the Father hath are Mine; therefore I said that He shall take of Mine, and shall show it unto you.
16 A little while, and ye shall not see Me; and again a little while, and ye shall see Me, because I go to the Father.”
17 Then said some of His disciples among themselves, “What is this that He saith unto us, ‘A little while, and ye shall not see Me; and again a little while, and ye shall see Me,’ and, ‘because I go to the Father’?”
18 They said therefore, “What is this that He saith, ‘A little while’? We cannot tell what He saith.”
19 Now Jesus knew that they were desirous of asking Him, and said unto them, “Do ye inquire among yourselves of what I said, ‘A little while, and ye shall not see Me; and again a little while, and ye shall see Me’?
20 Verily, verily I say unto you that ye shall weep and lament, but the world shall rejoice; and ye shall be sorrowful, but your sorrow shall be turned into joy.
21 A woman when she is in travail hath sorrow, because her hour is come; but as soon as she is delivered of the child, she remembereth no more the anguish, for the joy that a man is born into the world.
22 And ye now therefore have sorrow; but I will see you again, and your heart shall rejoice, and your joy no man taketh from you.
23 And in that day ye shall ask Me nothing. Verily, verily I say unto you, whatsoever ye shall ask the Father in My name, He will give it to you.
24 Hitherto have ye asked nothing in My name. Ask and ye shall receive, that your joy may be full.
25 “These things have I spoken unto you in proverbs; but the time cometh when I shall no more speak unto you in proverbs, but I shall show you plainly of the Father.
26 In that day ye shall ask in My name, and I say not unto you that I will pray the Father for you;
27 for the Father Himself loveth you, because ye have loved Me and have believed that I came out from God.
28 I came forth from the Father, and am come into the world. Again, I leave the world and go to the Father.”
29 His disciples said unto Him, “Lo, now speakest Thou plainly and speakest no proverb.
30 Now are we sure that Thou knowest all things and needest not that any man should ask Thee. By this we believe that Thou camest forth from God.”
31 Jesus answered them, “Do ye now believe?
32 Behold, the hour cometh, yea, is now come, that ye shall be scattered, every man to his own, and shall leave Me alone. And yet I am not alone, because the Father is with Me.
33 These things I have spoken unto you, that in Me ye might have peace. In the world ye shall have tribulation, but be of good cheer: I have overcome the world.”

In Gethsemene to pray (10:00 PM) Monday Night, 13th Nisan
Luke 22:39 And He came out and went, as He was wont, to the Mount of Olives; and His disciples also followed Him.

Jesus’ ‘inner circle’
Mark 14:33 And He took with Him Peter and James and John, and began to be sore amazed and very heavy of heart. — These three disciples were there during Christ’s time of prayers and distress
34 And He said unto them, “My soul is exceeding sorrowful unto death; tarry ye here, and watch.”

Jesus prayed for 3 hours (10:00 PM) Monday Night, 13th Nisan
Matthew 26:39 And He went a little farther, and fell on His face and prayed, saying, “O My Father, if it be possible, let this cup pass from Me; nevertheless, not as I will, but as Thou wilt.”
40 And He came unto the disciples and found them asleep, and said unto Peter, “What, could ye not watch with Me one hour?
41 Watch and pray, that ye enter not into temptation. The spirit indeed is willing, but the flesh is weak.”
42 He went away again the second time and prayed, saying, “O My Father, if this cup may not pass away from Me, unless I drink it, Thy will be done.”
43 And He came and found them asleep again, for their eyes were heavy.
44 And He left them and went away again, and prayed a third time, saying the same words.

Up to this point, Jesus still hoped and prayed that this cup could be taken away from Him, so He could take the Passover with His disciples. But it wasn’t granted.
Second, He sweated profusely, His blood falling to the ground, not so much as death awaited Him, but the process of tortues under the Roman soldiers that most people would fear of.
And being in agony, He prayed more earnestly, and His sweat was, as it were, great drops of blood falling down to the ground (Luke 22:44).
Then He said unto them, “My soul is exceeding sorrowful, even unto death; tarry ye here and watch with Me.” And He went a little farther, and fell on His face and prayed, saying, “O My Father, if it be possible, let this cup pass from Me; nevertheless, not as I will, but as Thou wilt” (Matthew 26:38-39).

The Lord’s prayer (1:00 AM) Tuesday Early Morning, 13th Nisan
John 17:1 These words spoke Jesus and lifted up His eyes to Heaven and said, “Father, the hour is come. Glorify Thy Son, that Thy Son also may glorify Thee,
2 as Thou hast given Him power over all flesh, that He should give eternal life to as many as Thou hast given Him.
3 And this is life eternal: that they might know Thee, the only true God, and Jesus Christ whom Thou hast sent.
4 I have glorified Thee on the earth; I have finished the work which Thou gavest Me to do.
5 And now, O Father, glorify Thou Me with Thine own Self with the glory which I had with Thee before the world was.
6 “I have manifested Thy name unto the men whom Thou gavest Me out of the world. Thine they were, and Thou gavest them to Me, and they have kept Thy Word.
7 Now they have known that all things whatsoever Thou hast given Me are of Thee.
8 For I have given unto them the Words which Thou gavest Me; and they have received them and have known surely that I came out from Thee, and they have believed that Thou didst send Me.
9 I pray for them; I pray not for the world, but for them whom Thou hast given Me, for they are Thine.
10 And all Mine are Thine, and Thine are Mine, and I am glorified in them.
11 And now I am no more in the world, but these are in the world, and I come to Thee. Holy Father, keep through Thine own name those whom Thou hast given Me, that they may be one, as We are.
12 While I was with them in the world, I kept them in Thy name. Those that Thou gavest Me I have kept, and none of them is lost, but the son of perdition, that the Scripture might be fulfilled.
13 “And now come I to Thee, and these things I speak in the world, that they might have My joy fulfilled in themselves.
14 I have given them Thy Word, and the world hath hated them, because they are not of the world, even as I am not of the world.
15 I pray not that Thou shouldest take them out of the world, but that Thou shouldest keep them from the evil.
16 They are not of the world, even as I am not of the world.
17 Sanctify them through Thy truth: Thy Word is truth.
18 As Thou hast sent Me into the world, even so have I also sent them into the world.
19 And for their sakes I sanctify Myself, that they also might be sanctified through the truth.
20 “Neither pray I for these alone, but for them also who shall believe in Me through their word,
21 that they all may be one, as Thou, Father, art in Me and I in Thee, that they also may be one in Us, that the world may believe that Thou hast sent Me.
22 And the glory which Thou gavest Me I have given them, that they may be one, even as We are one:
23 I in them and Thou in Me, that they may be made perfect in one, and that the world may know that Thou hast sent Me and hast loved them, as Thou hast loved Me.
24 “Father, I will that they also, whom Thou hast given Me, be with Me where I am, that they may behold My glory which Thou hast given Me; for Thou loved Me before the foundation of the world.
25 “O righteous Father, the world hath not known Thee, but I have known Thee, and these have known that Thou hast sent Me.
26 And I have declared unto them Thy name, and will declare it, that the love wherewith Thou hast loved Me may be in them, and I in them.”

Judas’s betrayal (1.30 AM) Tuesday Early Morning, 13th Nisan
John 18:1 When Jesus had spoken these words, He went forth with His disciples over the Brook Kidron, where was a garden into which He entered with His disciples.
2 And Judas also, who betrayed Him, knew the place, for Jesus often resorted thither with His disciples.
3 Judas then, having received a band of men and officers from the chief priests and Pharisees, came thither with lanterns and torches and weapons.
4 Jesus therefore, knowing all things that should come upon Him, went forth and said unto them, “Whom seek ye?”
5 They answered Him, “Jesus of Nazareth.” Jesus said unto them, “I am He.” And Judas also, who betrayed Him, stood with them.
6 As soon then as He had said unto them, “I am He,” they went backward and fell to the ground.
7 Then He asked them again, “Whom seek ye?” And they said, “Jesus of Nazareth.”
8 Jesus answered, “I have told you that I am He. If therefore ye seek Me, let these go their way,”
9 that the saying might be fulfilled which He spoke, “Of those that Thou gavest Me, have I lost none.”

Healing of High Priest servant’s ear (2:00 AM) Tuesday Early Morning, 13th Nisan
John 18:10 Then Simon Peter, having a sword, drew it and smote the high priest’s servant and cut off his right ear. The servant’s name was Malchus.
11 Then said Jesus unto Peter, “Put up thy sword into the sheath. The cup which My Father hath given Me, shall I not drink it?” — Peter was there during Christ’s time of distress
12 Then the band and the captain and officers of the Jews took Jesus and bound Him,

Disciples deserted Him (2:00 AM) Tuesday Early Morning, 13th Nisan
Mark 14:50 And they all forsook Him and fled.
51 And there followed Him a certain young man, having a linen cloth cast about his naked body; and the young men laid hold on him. — this disciple during Christ’s trial was probably James.

Acts 12:2 He killed James the brother of John with the sword,

52 And he left the linen cloth and fled from them naked.

They led Him to Annas (2.30 AM) Tuesday Early Morning, 13th Nisan
John 18:13 and led Him away to Annas first, for he was the father-in-law of Caiaphas, who was the high priest that same year.
14 Now it was Caiaphas who gave counsel to the Jews that it was expedient that one man should die for the people.

Peter followed near a fire (3:00 AM) Tuesday Early Morning, 13th Nisan
John 18:15 And Simon Peter followed Jesus, and so did another disciple. That disciple was known unto the high priest, and went in with Jesus into the palace of the high priest. — John, shy to identify himself, was another disciple during Christ’s time of distress.
16 But Peter stood at the door outside. Then the other disciple, who was known unto the high priest, went out and spoke unto her who kept the door, and brought in Peter.
17 Then the damsel who kept the door said unto Peter, “Art not thou also one of this man’s disciples?” He said, “I am not.”
18 And the servants and officers stood there, who had made a fire of coals, for it was cold and they warmed themselves. And Peter stood with them, and warmed himself.

Before Annas and Caiaphas (4:00 AM) Tuesday Early Morning, 13th Nisan
John 18:19 The high priest then asked Jesus about His disciples and about His doctrine.
20 Jesus answered him, “I spoke openly to the world; I ever taught in the synagogue and in the temple whither the Jews always resort, and in secret have I said nothing.
21 Why askest thou Me? Ask them that heard Me what I have said unto them. Behold, they know what I said.”
22 And when He had thus spoken, one of the officers who stood by struck Jesus with the palm of his hand, saying, “Answerest thou the high priest so?”
23 Jesus answered him, “If I have spoken evil, bear witness of the evil; but if well, why smitest thou Me?”
24 Now Annas had sent Him bound unto Caiaphas, the high priest.

Annas and Caiaphas are known to be Sadducees or their close allies, the Boethusiasns or the Herodians, and according to their beliefs they would be having their passover that night, on the fourteenth. Their minds would be on their passover, and it would be highly unlikely they had planned and wanted to be troubled on something else on such an occasion.

The Sanhedrin (5:00 AM) Tuesday Before Dawn, 13th Nisan
Matthew 26:59 Now the chief priests and elders and all the council sought false witness against Jesus to put Him to death,

KJ21 Mark 14:55 And the chief priests and all of the council (i.e. the entire Sanhedrin members alone would be 70 or 72, not including elders and false witnesses) sought for witnesses against Jesus to put Him to death, and found none. It would probably take one or two hours to assemble them together. Those days they didn’t have telephones, only runners.
Second, if that night were the fourteenth, it would be a passover night for the Sadducees, who made up a large portion of the Sanhedrin at that time. It would be inconceivable to believe that many runners could be found during the early morning hours and dared to trouble all the Sanhedrin members in their sleep. This together with the comment above on Annas and Caiaphas are strong indications that that night wasn’t the fourteenth.

60 but found none. Yea, though many false witnesses came, yet found none. At the last came two false witnesses,
61 and said, “This fellow said, ‘I am able to destroy the temple of God and to build it in three days.’”
62 And the high priest arose and said unto Him, “Answerest thou nothing? What is it which these witnesses say against thee?”
63 But Jesus held His peace. And the high priest answered and said unto Him, “I adjure thee by the living God that thou tell us whether thou be the Christ, the Son of God.”
64 Jesus said unto him, “Thou hast said; nevertheless I say unto you, hereafter shall ye see the Son of Man sitting at the right hand of Power, and coming in the clouds of heaven.”
65 Then the high priest rented his clothes, saying, “He hath spoken blasphemy! What further need have we of witnesses? Behold, now ye have heard his blasphemy!
66 What do you think?” They answered and said, “He is deserving of death!”
67 Then they spit in His face and buffeted Him, and others smote Him with the palms of their hands,
68 saying, “Prophesy unto us, thou Christ! Who is he that smote thee?”

Peter denied Jesus three times (5:00 AM) Tuesday, Before Dawn, 13th Nisan
Matthew 26:69 Now Peter sat outside in the palace, and a damsel came unto him, saying, “Thou also wast with Jesus of Galilee.”
70 But he denied it before them all, saying, “I know not what thou sayest.”
71 And when he had gone out onto the porch, another maid saw him and said unto those who were there, “This fellow was also with Jesus of Nazareth.”
72 And again he denied with an oath, “I do not know the man!”
73 And after a while came unto him those who stood by, and said to Peter, “Surely thou also art one of them, for thy speech betrayeth thee.”
74 Then he began to curse and to swear, saying, “I know not the man!” And immediately the cock crowed.
75 And Peter remembered the word of Jesus, when He said unto him, “Before the cock crow, thou shalt deny Me thrice.” And he went out and wept bitterly.

The best scientific evidence says that normally endogenous cycles stimulate a cock to crow in response to incremental changes in light intensity.

Sanhedrin condemned Him (6:00 AM) Tuesday, Dawn, 13th Nisan
Luke 22:66 And as soon as it was day, the elders of the people and the chief priests and the scribes came together, and led Him into their council, saying,
67 “Art thou the Christ? Tell us.” And He said unto them, “If I tell you, ye will not believe.
68 And if I also ask you, ye will not answer Me nor let Me go.
69 Hereafter shall the Son of Man sit on the right hand of the power of God.”
70 Then said they all, “Art thou then the Son of God?” And He said unto them, “Ye say that I am.”
71 And they said, “What need of any further witness? For we ourselves have heard it from his own mouth.”

The Sanhedrin sent Him to Pilate (6:00 AM) Tuesday, Dawn, 13th Nisan
Luke 23:1 And the whole multitude of them arose and led Him unto Pilate.

Judas hung himself (6:00 AM) Tuesday, Dawn, 13th Nisan
Matthew 27:3 Then Judas, who had betrayed Him, when he saw that He was condemned, repented and brought back the thirty pieces of silver to the chief priests and elders,
4 saying, “I have sinned in that I have betrayed the innocent blood.” And they said, “What is that to us? See thou to that!”
5 And he cast down the pieces of silver in the temple and departed, and went and hanged himself.
6 And the chief priests took the silver pieces and said, “It is not lawful to put them into the treasury, because it is the price of blood.”
7 And they took counsel and bought with them the potter’s field, to bury strangers in.
8 Therefore that field was called the Field of Blood unto this day.
9 Then was fulfilled that which was spoken by Jeremiah the prophet, saying, “And they took the thirty pieces of silver, the price of Him that was valued, whom they the children of Israel did value,
10 and gave them for the potter’s field, as the Lord appointed me.”

Before Pilate (9:00 AM) Tuesday, 3rd hour, 13th Nisan
Luke 23:2 And they began to accuse Him, saying, “We found this fellow perverting the nation and forbidding to give tribute to Caesar, saying that he himself is Christ, a king.”
3 And Pilate asked Him, saying, “Art thou the king of the Jews?” And He answered him and said, “Thou sayest it.”

“How Dare You Trouble Me?” It would be inconceivable or even fanciful to think that Pilate as king of Judea could be troubled in the middle of the night by someone subordinate to him as traditional understanding demands. Pilate was a tyrant and known to kill anybody at will those who displeased him. It would be far more reasonable to assume that he attended court at a reasonable hour at around 9 AM the earliest.

4 Then said Pilate to the chief priests and the people, “I find no fault in this man.”
5 And they became the more fierce, saying, “He stirreth up the people, teaching throughout all Judea, beginning from Galilee to this place.”
6 When Pilate heard of Galilee, he asked whether the Man were a Galilean.

Before Herod (10:00 AM) Tuesday, 4th hour, 13th Nisan
Luke 23:7 And as soon as he learned that He belonged unto Herod’s jurisdiction, he sent Him to Herod, who himself also was at Jerusalem at that time.
8 And when Herod saw Jesus he was exceedingly glad, for he had been desirous to see Him for a long time, because he had heard many things about Him, and he hoped to see some miracle done by Him. — remember, in those days they only have runners in sending and receiving messages. And protocol required letters were properly written, signed and sealed before being despatched.
9 Then he questioned Him with many words, but He answered him nothing.
10 And the chief priests and scribes stood and vehemently accused Him.
11 And Herod, with his men of war, treated Him with contempt and mocked Him, and arrayed Him in a gorgeous robe and sent Him again to Pilate.
12 And on the same day, Pilate and Herod were made friends together, for before that there was enmity between them.
13 And Pilate, when he had called together the chief priests and the rulers and the people,
14 said unto them, “Ye have brought this man unto me as one who perverteth the people. And behold, I, having examined him before you, have found no fault in this man concerning those things whereof ye accuse him.
15 No, nor yet Herod; for I sent you to him, and lo, nothing worthy of death is done unto him.
16 I will therefore chastise him and release him.”
17 (For of necessity he must release one unto them at the Feast.)
18 And they all cried out at once, saying, “Away with this man, and release unto us Barabbas”
19 (who had been cast into prison for a certain sedition made in the city, and for murder).
20 Pilate therefore, desiring to release Jesus, spoke again to them.
21 But they cried, saying, “Crucify him, crucify him!”
22 And he said unto them the third time, “Why? What evil hath he done? I have found no cause for death in him. I will therefore chastise him and let him go.”
23 But they were instant with loud voices, requiring that He might be crucified. And the voices of them and of the chief priests prevailed.

Pilate: Barabbas or Jesus (11:00 AM) Tuesday, 5th hour, 13th Nisan
Matthew 27:15 Now at that feast, the governor was wont to release unto the people a prisoner, whom they would.
16 And they had then a notable prisoner called Barabbas.
17 Therefore when they were gathered together, Pilate said unto them, “Whom will ye that I release unto you: Barabbas, or Jesus who is called Christ?”
18 For he knew that for envy they had delivered Him.
19 When he had sat down on the judgment seat, his wife sent unto him, saying, “Have thou nothing to do with that just man; for I have suffered many things this day in a dream because of him.”
20 But the chief priests and elders persuaded the multitude that they should ask for Barabbas and destroy Jesus.
21 The governor answered and said unto them, “Which of the two will ye that I release unto you?” They said, “Barabbas!”
22 Pilate said unto them, “What shall I do then with Jesus, who is called Christ?” They all said unto him, “Let him be crucified!”
23 And the governor said, “Why, what evil hath he done?” But they cried out the more, saying, “Let him be crucified!”
24 When Pilate saw that he could not prevail, but rather that a tumult was beginning, he took water and washed his hands before the multitude, saying, “I am innocent of the blood of this just person. See ye to it.”
25 Then answered all the people and said, “His blood be on us, and on our children!”
26 Then released he Barabbas unto them; and when he had scourged Jesus, he delivered Him to be crucified.
27 Then the soldiers of the governor took Jesus into the common hall, and gathered unto Him the whole detachment of soldiers.
28 And they stripped Him and put on Him a scarlet robe.
29 And when they had plaited a crown of thorns, they put it upon His head and a reed in His right hand, and they bowed their knees before Him and mocked Him, saying, “Hail, King of the Jews!”
30 And they spat upon Him, and took the reed and smote Him on the head.
31 And after they had mocked Him, they took the robe off from Him and put His own raiment on Him, and led Him away to crucify Him.

“Crucify him! Crucify him!” (12 NOON) Tuesday, 6th hour, 13th Nisan
John 19:6 When therefore the chief priests and the officers saw Him, they cried out, saying, “Crucify him! Crucify him!” Pilate said unto them, “Ye take him and crucify him, for I find no fault in him.”
7 The Jews answered him, “We have a law, and by our law he ought to die, because he made himself the Son of God.”
8 When Pilate therefore heard that saying, he was the more afraid.
9 And he went again into the judgment hall and said unto Jesus, “From whence art thou?” But Jesus gave him no answer.
10 Then said Pilate unto Him, “Speakest thou not unto me? Knowest thou not that I have power to crucify thee, and have power to release thee?”
11 Jesus answered, “Thou couldest have no power at all against Me, unless it were given thee from above. Therefore he that delivered Me unto thee hath the greater sin.”
12 And from thenceforth Pilate sought to release Him, but the Jews cried out, saying, “If thou let this man go, thou art not Caesar’s friend. Whosoever maketh himself a king speaketh against Caesar.”
13 When Pilate therefore heard that saying, he brought Jesus forth and sat down in the judgment seat in a place that is called the Pavement, but in Hebrew, Gabbatha.
14 And it was the Preparation of the Passover and about the sixth hour, and Pilate said unto the Jews, “Behold your king!” (NOON, 13TH NISAN)

This sixth hour would be the same sixth hour where Jesus talked with the Samaritan woman at the well, established to be at noon, when Jesus was wearied and needed a drink (John 4:6). To think that John suddenly popped up Roman time to suit a belief is just trying to be fanciful. Like a virgin who suddenly upskirts herself at an intersection, such distraction and deception would surely result in many fatalities.
“Ephraim compasseth me about with lies, and the house of Israel with deceit” (Hosea 11:12).

15 But they cried out, “Away with him, away with him! Crucify him!” Pilate said unto them, “Shall I crucify your king?” The chief priests answered, “We have no king but Caesar!”

They led Him away to be crucified, but first to be flogged, including scourging and mocking — the missing hours, probably back at the praetorium, (about 18 hours where there is no record of Him; from about noon on the thirteenth to daybreak on the fourteenth of Nisan). And it is thus obvious, that that evening, the evening where Jesus and His disciples were taking supper, were indeed a supper. There is no evidence of a Passover—no lamb, no bitter herbs—not even a Samaritan or a Sadducean Passover, where it would be on an early fourteenth of Nisan.

The night before, while He prayed, His blood fell to the ground. He knew He would be flogged nearly to the point of death before they pounded the metal spikes into His flesh. He knew the prophetic words of Isaiah spoken seven centuries earlier that He would be beaten so badly that He would be “disfigured beyond that of any man” and “beyond human likeness” (Isaiah 52:14).

Image result for roman whipForerunner Commentary of the King James Version Isaiah 52:14:
Jesus had to die a death that was excruciatingly painful. Why? To depict the horrible pain that sin causes. It would not have served God’s purpose if He had died a painless death. The picture would have been incomplete.
Any criminal of that time would have despaired to learn he was to be crucified. Crucifixion was not only an execution, but also a method of torture. The Romans usually gave the victim an excruciating scourging first. Jesus was no exception. Before He ever touched His cross, He was scourged, beaten, and insulted.
Image result for roman whippingOver the years we have heard quite a bit about the Roman lictor (Roman officer), the soldier charged with dispensing this dreaded punishment. He used a whip, often with imbedded pieces of metal, bone, or other sharp objects. Romans did not limit their lictors to the Israelite practice of “forty stripes save one,” nor to striking just the victim’s back. He would let the whip strike and wrap around every inch of the person’s body until he was within an inch of death.
The prophet Isaiah prophesies how Jesus appeared after the scourging: “Just as many were astonished at you, so His visage [appearance, margin] was marred more than any man, and His form more than the sons of men” (Isaiah 52:14). He goes on to say that He was “wounded [pierced through, margin] for our transgressions, He was bruised [crushed] for our iniquities” (53:5).

Just as there were many who were appalled at him — his appearance was so disfigured beyond that of any human being and his form marred beyond human likeness — Isaiah 52:14 NIV.

Many people were shocked when they saw him. He was so scarred that he no longer looked like a person. His body was so twisted that he did not look like a human being anymore Isaiah 52:14 NIRV.

The Jews will mourn One whom they had rejected: “And they shall look to Me whom they have pierced; then they shall mourn for him, as one mourns for an only son” (Zechariah 12:10). But the Christians have nothing to mourn? Currently these endtime virgins are described as lukewarm and in need of nothing, but would they not mourn when they realise that they had been blind, wretched and naked, seeing finally that Christ had suffered far more through His torn flesh and shed blood than they had ever realised? No? Regardless, these at the moment are described in Revelation 3:17. “As many as I love, I rebuke and chasten: or else I will spew thee out of My mouth (v16,19).”

The Lord shall smite thee with madness, and blindness, and astonishment of heart; and thou shalt grope at noonday, as the blind gropeth in darkness. That was written for the Old Testament time in Deuteronomy 28:28-29. But at the endtime, there are ten virgins – blind, wretched and naked – and they are groping amazingly in the light.

The next morning (6:00 AM) Wednesday, Dawn, 14th Nisan
Luke 23:26 And as they led Him away, they laid hold upon one Simon, a Cyrenian, coming out of the country, and on him they laid the cross, that he might bear it after Jesus.
27 And there followed Him a great company of people, and of women who also bewailed and lamented Him.
28 But Jesus, turning unto them, said, “Daughters of Jerusalem, weep not for Me, but weep for yourselves and for your children.
29 For behold, the days are coming in which they shall say, ‘Blessed are the barren, and the wombs that never bore and the breasts which never gave suck.’
30 Then shall they begin to say to the mountains, ‘Fall on us!’ and to the hills, ‘Cover us!’
31 For if they do these things in a green tree, what shall be done in the dry?”

They led Him to be crucified (7:00 AM)
John 19:16 Then he delivered Him therefore unto them to be crucified. And they took Jesus and led Him away.
17 And He, bearing His cross, went forth into a place called the Place of a Skull (which is called in the Hebrew, Golgotha)

The Third hour (9:00 AM) Wednesday, 3rd hour, 14th Nisan
John 19:18 where they crucified Him and two others with Him, one on either side and Jesus in the midst.
19 And Pilate wrote a title and put it on the cross. And the writing was: Jesus Of Nazareth The King Of The Jews.
20 Then many of the Jews read this title, for the place where Jesus was crucified was nigh to the city, and it was written in Hebrew and Greek and Latin.
21 Then said the chief priests of the Jews to Pilate, “Write not ‘The King of the Jews,’ but, ‘He said, I am King of the Jews.’”
22 Pilate answered, “What I have written, I have written.”
23 Then the soldiers, when they had crucified Jesus, took His garments and made four parts, to every soldier a part, and also His coat. Now the coat was without seam, woven from the top throughout.
24 They said therefore among themselves, “Let us not rend it, but cast lots for it, whose it shall be,” that the Scripture might be fulfilled which saith, “They parted My raiment among them, and for My vesture did they cast lots.” These things therefore the soldiers did.

Mark 15:25 And it was the third hour (9 AM) when they crucified Him.
29 And those who passed by railed at Him, wagging their heads and saying, “Ah, thou that destroyest the temple and buildest it in three days,
30 save thyself and come down from the cross!”
31 Likewise also the chief priests, mocking, said among themselves with the scribes, “He saved others; himself he cannot save!
32 Let Christ, the King of Israel, descend now from the cross, that we may see and believe.” And those who were crucified with Him reviled Him.

25 Now there stood by the cross of Jesus His mother and His mother’s sister, Mary the wife of Clopas, and Mary Magdalene.
26 When Jesus therefore saw His mother and the disciple standing by whom He loved, He said unto His mother, “Woman, behold thy son!”
27 Then said He to the disciple, “Behold thy mother!” And from that hour, that disciple took her unto his own home.

Mark 15:33 And when the sixth hour (12 NOON) had come, there was darkness over the whole land until the ninth hour (3 PM).

28 After this Jesus, knowing that all things were now accomplished, that the Scripture might be fulfilled, said, “I thirst.”
29 Now there was set there a vessel full of vinegar; and they filled a sponge with vinegar and put it upon a hyssop, and put it to His mouth.

Mark 15:34 And at the ninth hour (3 PM) Jesus cried out with a loud voice, saying, “Eloi, Eloi, lama sabachthani?” which is, being interpreted, “My God, My God, why hast Thou forsaken Me?”
35 And some of those who stood by, when they heard it, said, “Behold, he calleth Elijah.”
36 And one ran and filled a sponge full of vinegar, and put it on a reed and gave it to Him to drink, saying, “Let him alone. Let us see whether Elijah will come to take him down.”
37 And Jesus cried out with a loud voice, and gave up the ghost.
30 When Jesus therefore had received the vinegar, He said, “It is finished.” And He bowed His head and gave up the ghost.

Earthquakes and graves opened (3:00 PM) Wednesday, 9th hour, 14th Nisan
Matthew 27:51 And behold, the veil of the temple was rent in two from the top to the bottom, and the earth quaked and the rocks rent.
52 And the graves were opened; and many bodies of the saints who slept arose,
53 and came out of the graves after His resurrection, and went into the Holy City and appeared unto many.
54 Now when the centurion, and those who were with him watching Jesus, saw the earthquake and those things that were done, they feared greatly, saying, “Truly, this was the Son of God!”

Preparation for the Passover (4:00 PM) Wednesday, 10th hour, 14th Nisan
John 19:31 The Jews therefore, because it was the Preparation, and so that the bodies should not remain upon the cross on the Sabbath day (for that Sabbath day was a high day), besought Pilate that their legs might be broken and that they might be taken away.
32 Then came the soldiers and broke the legs of the first and of the other who was crucified with Him.
33 But when they came to Jesus and saw that He was dead already, they broke not His legs,
34 but one of the soldiers with a spear pierced His side, and forthwith there came out blood and water.
35 And he that saw it bore record, and his record is true, and he knoweth that he saith truly, that ye might believe.
36 For these things were done, that the Scripture should be fulfilled: “A bone of Him shall not be broken.”
37 And again another Scripture saith, “They shall look on Him whom they pierced.”

The women watched (4:30 PM) Wednesday, 10th hour, 14th Nisan
Mark 15:40 There were also women looking on afar off, among whom were Mary Magdalene, and Mary the mother of James the Less and of Joses, and Salome
41 (who also, when He was in Galilee, had followed Him and ministered unto Him), and many other women who came up with Him unto Jerusalem.

Joseph of Arimathea (5:00 PM) Wednesday, 11th hour, 14th Nisan
Mark 15:42 And now when the evening had come, because it was the Preparation (that is, the day before the Sabbath), — that Sabbath was a High Day, the beginning of the Feast of Unleavened Bread.
43 Joseph of Arimathea, an honorable council member who also was waiting for the Kingdom of God, came and went in boldly unto Pilate and asked for the body of Jesus.
44 And Pilate wondered if He were already dead; and calling unto him the centurion, he asked him whether He had been any while dead.
45 And when he learned it from the centurion, he gave the body to Joseph.
46 And Joseph bought fine linen, and took Him down and wrapped Him in the linen. And he laid Him in a sepulcher which was hewn out of a rock, and rolled a stone unto the door of the sepulcher.
47 And Mary Magdalene and Mary the mother of Joses beheld where He was laid.

~~~

End note: Luke 22:15-6. Here Jesus said to the disciples:

“With fervent desire I have desired to eat this Passover with you before I suffer; for I say to you, I will no longer eat of it until it is fulfilled in the kingdom of God.”

What did He mean by saying “THIS Passover”?

There are only two possibilities:

1) He meant the upcoming Passover that very year, which had not yet arrived, as this statement was made “before the feast of the Passover” (John 13:1).

2) He meant that very meal that evening which they were partaking of – even though it was served with regular “bread,” makes no mention of lamb, or bitter herbs, which were required for a Passover meal. Second, if that meal was the Passover, Jesus and His disciples would have broken one of the Passover ordinances specified in Numbers 9:12 — moving the bones out of the house and burned them in the morning.

Fred Coulter, whose book The Christian Passover is his flagship and endorsed by most of the CoG Communities, specifies it this way:

God’s commands to Moses in Exodus 12 show us the step-by-step procedures required for keeping the Old Testament Passover. It is clear that the act of slaying the lambs was only one part of keeping the Passover. The nine steps for keeping the Old Testament Passover were as follows:

1) Select an unblemished male lamb less than one year old on the 10th day of the first month (Ex. 12:3).
2) Kill the lamb on the 14th day of the first month at dusk [Hebrew ben ha arbayim, “between the two evenings”]. Share the lamb with a neighbor if one’s own family was too small to eat it. Do not break a bone of the lamb (Ex. 12:4, 6, 46).
3) Strike the side posts and lintel of the door of the house with some of the blood (Ex. 12:7).
4) Roast the whole lamb — head and legs and edible entrails — with fire (Ex. 12:9).
5) Do not boil the meat in water or eat it raw (Ex. 12:9).
6) Eat the flesh in that night with bitter herbs and unleavened bread (Ex. 12:8).
7) Allow no alien to eat it unless circumcised (Ex. 12:43-44).
8) Eat it in the same house where it was slain. Do not carry any of it out of the house (Ex. 12:46).
9) Burn any remains, such as the bones and fat, the skin and guts, with fire by morning (Ex. 12:10). (The Christian Passover, pg 19)

These were the commands of God for Israel’s first Passover. If the children of Israel had not observed all nine steps for the Passover exactly as God commanded, the Passover would not have been fully “kept,” and the Lord would not have spared the firstborn of Israel.

At their next Passover, the first one in the wilderness after the tabernacle was set up and dedicated, the nine rules for “keeping” the Passover are called statutes and ordinances: “Let the children of Israel also keep the Passover at its appointed time. In the fourteenth day of this month, between the two evenings, you shall keep it in its appointed time. You shall keep it according to ALL ITS STATUTES, and according to ALL THE ORDINANCES of it” (Num. 9:2-3).

This Scripture shows that the nine rules for the Passover, here called statutes and ordinances, were to be observed in all the years that followed. All nine ordinances were to be observed on the 14th day of the month! It is quite clear in Numbers 9 that all the statutes and all the ordinances that were established at the first Passover were to be observed by the children of Israel. We find no later instructions given in Scripture that in any way alter or modify the manner in which the Passover was originally commanded to be observed. (The Christian Passover, pg 19-20)

And Fred’s statements are reemphasised further:

“And none of you shall go out of the door of his house until morning [sunrise]” (Ex. 12:21-22),” (pg 58).
And none of you shall go out of the door of his house until sunrise [Hebrew boqer]’ ” (Ex. 12:21-22). (Pg 71)
“…And none of you shall go out of the door of his house UNTIL SUNRISE….And the children of Israel went away and did as the LORD had commanded Moses and Aaron, SO THEY DID” (Ex. 12:22, 28).
“If any of the children of Israel had left their houses before morning, it would be recorded in the Scriptures that some of the people had disobeyed the command of God and had left their houses too soon, and therefore they had died in the plague of the firstborn.” (The Christian Passover, Pg 72)

If that night had been the Passover, that would make Jesus and His disciples break a Passover ordinance since they were only allowed to burn the bones and left their house after morning, BUT THEY DIDN’T!  If that night had been the Passover’s night, Christians’ hopes and dreams would be just ready to be flushed down the toilet!

What, then, did Jesus mean when He said, “With fervent desire I have desired to eat this Passover with you before I suffer”? The word for “desire” in this verse is an unusual word, epithumia in the Greek, and means “a longing, especially for that which is forbidden” (see Strong’s Exhaustive Concordance, #1939).

The word for “desire” in this verse is very important to understanding the context of Jesus’ words. Says Thayer’s Greek-English Lexicon, “desire, craving, longing,” “specifically for what is forbidden.” This is the “strongest expression of intense desire,” whether good or bad, says the Jamieson, Fausset, Brown Critical-Experimental Commentary.

In other words, Jesus here was saying He desired to eat the traditional Passover with His disciples that year, but He knew that such a thing will be impossible — that it was forbidden — that for Him to fulfill God’s PLAN He must be dead and in the grave the evening the Passover would be eaten, and therefore it was forbidden and impossible for Him to eat that Passover with them!

Perhaps Luke 22:15-6 should be translated as:

“With fervent desire I have desired to eat this Passover with you before I suffer; but I’m saying to you now, I am forbidden and denied this privilege, and I will no longer eat with you until we’re all in the kingdom of God.”

Conclusion: despite all the huffings and puffings arguing otherwise by the various CoG Communities, that night when Jesus and His disciples had their last supper, the same night He was betrayed, it wasn’t the Passover; it wasn’t on the Fourteenth night. It was just a supper as the Scriptures say, and that night was on the THIRTEENTH!

~~~~~

Iran has the Strait of Hormuz choked off

•May 25, 2026 • Leave a Comment
Assassination attempt failed, divine hand believed, thus President Trump believing a Second Coming and Ushering a new divine mission; and even threatening he’s ‘going to be’ in office in 2028 — and ‘maybe in 2032’ too

From President Trump’s Point of View

Briefly, as President Trump claimed Iran has being “totally obliterated” and demands total unconditional surrounder, and that Iran fulfilled three other a highly aggressive, maximalist conditions:

(1) That Iran surrounder it nuclear material; insisting on an affirmative commitment to “zero enrichment.” Under this condition, Iran must completely dismantle its uranium enrichment program and allow the United States to physically recover and remove past nuclear material remaining within the country;

(2) That Iran dismantle its ballistic missile infrastructure; these includes the Shahab-3, Ghadr, and Emad series, which have ranges between 1,000 to 2,000 kilometers; and solid-fuel missile production facilities (like those housing the Sajjil or Kheibar Shekan), which could be stored in underground silos fully fueled and launched with virtually no warning, making them highly resilient against pre-emptive strikes. The US insists these must be destroyed because they directly threaten Israel and US bases in the Persian Gulf;

(3) that Iran should stop supporting its allies: Hamas, Hezbollah, and the Houthis; that is, the dismantling of Iran’s “Axis of Resistance” is the absolute centerpiece of the geopolitical architecture og President Trump’s demand; as degrading Iran’s nuclear and missile facilities would be pointless if Tehran can still use its regional proxy network to project asymmetric power across the Middle East.

In practice, Iran’s IRGC allows a limited number of tankers to pass the Strait of Hormuz if the ships are Chinese owned, or that its oil or LPG cargo have been bought by using Yuan.

Paralysed, President Trump, beliving in his divine calling, has already sent USS Tripoli to the Gulf from the Western Pacific. Together, the United States military is preparing a Ground Invasion requiring 200,000 Marines and foot soldiers, with potential casualties estimated at 15,000.

Pastors gather at White House, praying for divine wind for President Trump, one who believes he’s ‘going to be’ in office in 2028 — and ‘maybe in 2032’ too

From Iran’s Point of View

Briefly, immediately after President Trump claimed Iran has being “totally obliterated” and demands unconditional surrounder, Iran counters with closing the Strait of Hormuz and would only agree to a ceasefire if three major conditions are met:

(1) That the United States withdraw all military forces, weapons and personnel from Saudi Arabia, Iraq, Kuwait, UAE, Qatar, Bahrain, Jordan, Oman and Syria within 30 days;

(2) That all trade; oil and financial sanctions against Iran must all be lifted since 1979 within 60 days;

(3) That the United States pay $800 billion in reparations for the damage they suffered over the last 40 years of sanctions; $500 billion within the next ten years.

And from the start, following the murder of children as a result of the American Tomahawk strike at a girls’ school in southern Iran, and as its Supreme Leader, the Ayatollah Ali Khamenei, had also offered himself as a martyr on the first day of the Gulf War, such sacrifice and martyrdom would be expected to continue.

The shrine of Ali in Najaf, the shrine of Husayn in Karbala
Prayers are also offered at the shrine of Ali in Najaf, and the shrine of Husayn in Karbala, that the divine wind would blow the other way . . .

Shia Islam places strong emphasis on sacrifice for the nation and thrives on martyrdom. Iran 90 percent strong Shias believe Ali ibn Abi Talib, the successor to prophet Muhammad, was the first martyr.

Such martyrdom continued through Ali’s sons, Hasan and Husayn, after which Shia holy sites include the shrine of Ali in Najaf, the shrine of Husayn in Karbala, and other mausoleums of the ahl al-bayt.

Later events, such as Husayn’s martyrdom in the Battle of Karbala, further influenced the development of Shia Islam, contributing to the formation of a distinct religious sect with its own rituals and shared collective memory.

Today, Shia Muslims form a majority of the population in Iran, Iraq, and Azerbaijan, as well as about half of the citizen population of Bahrain. Islamic apocalyptic traditions describe major conflicts happening before this era, including the Malhama al-Kubra – a great battle sometimes interpreted as a confrontation with Western powers.

And as Iran has stated that US and Israeli forces have bombed nearly 10,000 civilian sites in the country and killed more than 1,300 civilians since the war began on February 28, Shia Islam galvanises strong emphasis on sacrifice and thrives on martyrdom for the nation.

Iran’s IRGC has claimed the whole Strait of Hormuz under its Control, so now the Battle of Waterloo is fought here; but who is the new Napoleon?

With such deep-rooted beliefs on both sides, it’s clear the conflict will keep on going.

Leviticus (17-18)

•May 25, 2026 • Leave a Comment

13 US Bases in Middle East Destroyed After Iran Missile Strikes 

Missile and drone attacks by Iran and pro-Iran groups damage key US installations across Kuwait, Qatar, Bahrain and Saudi Arabia, forcing troop relocation and remote operations during the escalating 2026 US–Israel–Iran war.

“And if you pollute the land, it will vomit you up just as it vomited up the nations that preceded you” Leviticus 18:28

Leviticus 17

1 And the Lord spoke unto Moses, saying,

“Speak unto Aaron and unto his sons and unto all the children of Israel, and say unto them: ‘This is the thing which the Lord hath commanded, saying: — this is the thing which the Lord hath commanded; ordered to be observed as his will and pleasure by everyone of them: saying; namely, what follows.

Whatsoever man there be of the house of Israel who killeth an ox or lamb or goat in the camp, or who killeth it out of the camp, — that killeth; not for common use, for such beasts might be killed by any person or in any place; but for sacrifice, as the sense is limited, Leviticus 17:5;

and bringeth it not unto the door of the tabernacle of the congregation to offer an offering unto the Lord before the tabernacle of the Lord, blood shall be imputed unto that man: he hath shed blood. And that man shall be cut off from among his people,

— he shall be cut off by death, either by the hand of God, in case men do not know it or neglect to punish it, or by men, if the fact was public and evident;

to the end that the children of Israel may bring their sacrifices which they offer in the open field, even that they may bring them unto the Lord unto the door of the tabernacle of the congregation, unto the priest, and offer them for peace offerings unto the Lord.

— whoever of the house of Israel slaughtered an ox, sheep, or goat, either within or outside the camp, without bringing the animal to the tabernacle, to offer a sacrifice therefrom to the Lord, “blood was to be reckoned to him.”

And the priest shall sprinkle the blood upon the altar of the Lord at the door of the tabernacle of the congregation, and burn the fat for a sweet savor unto the Lord. — and burn the fat for a sweet savour to the Lord; the fat includes the inwards, the kidneys, the flanks and caul of the liver; Leviticus 3:3.

And they shall no more offer their sacrifices unto devils, after whom they have gone a whoring. This shall be a statute for ever unto them throughout their generations.’ — and they shall no more offer their sacrifices unto devils; the word, sēirim here translated “devils,” literally indicates hairy or shaggy goats, and then goat-like deities, or demons.

“And thou shalt say unto them: ‘Whatsoever man there be of the house of Israel, or of the strangers who sojourn among you, who offereth a burnt offering or sacrifice,

and bringeth it not unto the door of the tabernacle of the congregation to offer it unto the Lord, even that man shall be cut off from among his people.

— even that man shall be cut off from his people; from being one of them, and having communion with them, and sharing in their privileges; or by death, either by the hand of the civil magistrate, or rather by the hand of God.

10 “‘And whatsoever man there be of the house of Israel, or of the strangers who sojourn among you, who eateth any manner of blood, I will even set My face against that soul who eateth blood and will cut him off from among his people.

— owing to its great importance, the law is enacted here separately, where it naturally follows the order that the blood of all animals sacrificed in the sanctuary is to be offered to the Lord upon the altar.

11 For the life of the flesh is in the blood, and I have given it to you upon the altar to make an atonement for your souls; for it is the blood that maketh an atonement for the soul.

— and I have given it unto you to make an atonement for your souls: that being the life of the creature, was given for theirs to preserve them alive, and secure them from death their sins deserved.

12 Therefore I said unto the children of Israel, “No soul of you shall eat blood, neither shall any stranger that sojourneth among you eat blood.” — neither shall any stranger that sojourneth among you eat blood; including any proselyte of righteousness.

13 And whatsoever man there be of the children of Israel or of the strangers who sojourn among you, who hunteth and catcheth any beast or fowl that may be eaten, he shall even pour out the blood thereof and cover it with dust.

— he shall even pour out the blood; and cover it with dust; upon the earth, from which all animals came forth at their creation.

14 For it is the life of all flesh: the blood of it is for the life thereof. Therefore I said unto the children of Israel, “Ye shall eat the blood of no manner of flesh, for the life of all flesh is the blood thereof. Whosoever eateth it shall be cut off.”

— whosoever eateth it shall be cut off; by death, whether he be an Israelite or a proselyte of righteousness.

15 And every soul that eateth that which died of itself or that which was torn by beasts, whether it be one of your own country or a stranger, he shall both wash his clothes and bathe himself in water, and be unclean until the evening; then shall he be clean.

— that which died of itself; the law enacted here is a natural sequel to the one immediately preceding, since it is still based upon the sacredness of blood;

— then shall he be clean; when he has washed his garments, and bathed himself, and the evening is come, and then shall be admitted to society as before.

16 But if he wash them not nor bathe his flesh, then he shall bear his iniquity.’” — then he shall bear his iniquity; his guilt shall remain on him;

— and he shall suffer the punishment the law exposes him to, either by the hand of God, or the civil magistrate, which is due to persons that enter into the sanctuary in their uncleanness, or eat of holy things.

Leviticus 18

And the Lord spoke unto Moses, saying,

“Speak unto the children of Israel and say unto them: ‘I am the Lord your God. — I am the Lord your God; the Lord, Yehovah, is their recognised and sole sovereign, the children of Israel are therefore bound to obey His precepts, and not be led astray by the customs or statutes which prevailed among the people whose country they are to possess.

According to the doings of the land of Egypt wherein ye dwelt, shall ye not do; and according to the doings of the land of Canaan whither I bring you, shall ye not do; neither shall ye walk in their ordinances.

— after the doings of the land of Egypt, wherein ye dwelt, shall ye not do; where they had dwelt many years, and were just come out from thence, and where they had learned many of their evil practices; not only their idolatrous ones referred to in the preceding chapter.

Ye shall do My judgments and keep Mine ordinances to walk therein; I am the Lord your God. — ye shall do my judgments; the expression “my judgments and mine ordinances” is here used emphatically, in opposition to “their ordinances,” and has here the force of Mine only.

Ye shall therefore keep My statutes and My judgments, which if a man do, he shall live in them: I am the Lord. — he shall live in them; not only happily here, but also eternally hereafter.

“‘None of you shall approach any who is near of kin to him to uncover their nakedness: I am the Lord. — to illicit incestuous relation is illegal.

The nakedness of thy father or the nakedness of thy mother shalt thou not uncover: she is thy mother; thou shalt not uncover her nakedness. — by uncovering a father’s nakedness is not meant anything similar to what befell Noah,

— which Ham beheld with either neglect or with pleasure, and the other two sons of Noah studiously and with reverence to their father covered;

— she is thy mother, thou shalt not uncover her nakedness; that is, not lie with her, nor marry her, because she is his mother that bore him, of whom he was born, and therefore ought not to become his wife, or be taken into his bed; such a marriage must be incestuous and shocking.

The nakedness of thy father’s wife shalt thou not uncover: it is thy father’s nakedness. — a man’s father’s wife is for ever prohibited, whether she be simply betrothed or married to his father, whether she be divorced or not, whether she be a widow or not; all connection with her on the part of the father’s son is forbidden;

— this, therefore, includes the sin of Reuben with Bilhah, his father’s concubine (Genesis 35:22), and of Absalom with the wives of his father (II Samuel 16:20-23; I Kings 2:17); which was not incestuous marriage but adultery, since their husbands were alive and the wives were not divorced from them.

The nakedness of thy sister, the daughter of thy father or daughter of thy mother, whether she be born at home or born abroad, even their nakedness thou shalt not uncover.

— the nakedness of thy sister; to lie with one in so near a relation is exceeding criminal, and for which the law curses a man, Deuteronomy 27:22; and to marry her is not lawful; for though it was necessary for the propagation of mankind that a man should marry his sister, for who else could Cain and Abel marry?

— yet afterwards, when there was an increase of mankind, and there were people enough remote from each other, it became unlawful for persons in such near ties of consanguinity to marry with each other.

10 The nakedness of thy son’s daughter or of thy daughter’s daughter, even their nakedness thou shalt not uncover; for theirs is thine own nakedness.

— for theirs is thine own nakedness; which sprung from his, being the descendants either of his son or daughter; the Targum of Jonathan says,” for they are as thy own nakedness,” his own flesh and blood.

11 The nakedness of thy father’s wife’s daughter, begotten of thy father, she is thy sister; thou shalt not uncover her nakedness. — thy father’s wife’s daughter; if this clause stood alone it would denote the daughter of a man’s stepmother by another or previous husband.

12 Thou shalt not uncover the nakedness of thy father’s sister: she is thy father’s near kinswoman. — thou shalt not uncover the nakedness of thy father’s sister; his aunt by his father’s side.

13 Thou shalt not uncover the nakedness of thy mother’s sister, for she is thy mother’s near kinswoman.

— thou shalt not uncover the nakedness of thy mother’s sister; which is the same relation as before, an aunt by the mother’s side; wherefore, if such a marriage was unlawful, this must also, and for the same reason.

14 Thou shalt not uncover the nakedness of thy father’s brother. Thou shalt not approach his wife: she is thine aunt.

— thou shalt not uncover the nakedness of thy father’s brother; which some understand this of committing sodomy with him, on which account he was doubly guilty, partly because of lying with a male, and partly because of uncovering the nakedness of his father’s brother.

15 Thou shalt not uncover the nakedness of thy daughter-in-law: she is thy son’s wife; thou shalt not uncover her nakedness.

— she is that son’s wife; and so one flesh with him, and who is of the same flesh and blood with his father, and therefore the nearness of the relation forbids such incestuous copulation or marriage.

16 Thou shalt not uncover the nakedness of thy brother’s wife: it is thy brother’s nakedness. — taken strictly literally, this would mean a man could never, under any circumstance, marry his brother’s widow;

— the Targum of Jonathan says

“The nakedness of your brother’s wife you shall not uncover during your brother’s lifetime; and after his death, [even] if he has no children, she is the one whose nakedness belongs to your brother.”

— but in Deuteronomy 25:5, the law states that if a married man dies without children, his brother is actually commanded to marry the widow to carry on the deceased brother’s name.

17 Thou shalt not uncover the nakedness of a woman and her daughter, neither shalt thou take her son’s daughter or her daughter’s daughter to uncover her nakedness: for they are her near kinswomen; it is wickedness.

— a woman and her daughter; that is, if a man marries a widow who has a daughter by a former husband, or if he forms an alliance with a woman who has a daughter out of wedlock, he is forbidden to marry also the daughter.

18 Neither shalt thou take a wife to her sister to vex her, to uncover her nakedness beside the other in her life time.

— to vex her; that is, by marrying also the younger sister, the first, who is already the wife, would be roused to jealousy, and the natural love of sisters would thus be converted into enmity, thus precluding the occurrence of a case like that of Jacob with Leah and Rachel.

19 “‘Also thou shalt not approach unto a woman to uncover her nakedness as long as she is put apart for her uncleanness. — to uncover her nakedness, as long as she is put apart for her uncleanness; in her monthly courses; and the time of her separation from her husband on that account was seven days.

20 Moreover thou shalt not lie carnally with thy neighbor’s wife, to defile thyself with her. — thy neighbour’s wife; for committing adultery, which is here branded as a defilement, whether with a betrothed or married woman, both guilty parties incurred the penalty of death by stoning.

21 And thou shalt not let any of thy seed pass through the fire to Molech, neither shalt thou profane the name of thy God: I am the Lord.

— pass through the fire to Molech; literally, to let it pass to Molech, that is, to put the child into the hands of the figure of Molech, when it fell into the fire which was kindled in the hollow statue of this idol.

22 Thou shalt not lie with mankind as with womankind: it is abomination. — as with womankind; this was the sin of Sodom (Genesis 19:5), whence it derived its name, and in spite of the penalty of death enacted by the Law against those who were found guilty of it.

23 Neither shalt thou lie with any beast to defile thyself therewith, neither shall any woman stand before a beast to lie down thereto: it is confusion. — any beast; the necessity for the prohibition of this shocking crime, for which the Mosaic law enacts the penalty of death.

24 “‘Defile not ye yourselves in any of these things, for in all these the nations are defiled which I cast out before you, — defile not ye yourselves in any of these things; in incestuous copulations and marriages, in adultery, sodomy and bestiality;

— the Targum of Jonathan says:

Defile not yourselves by any one of all these; for by all these have the peoples defiled themselves whom I am about to drive away from before you. Leviticus 18:24 Targum

— for these nations I cast out before you; that is, the seven nations of Canaan: the Kenites, the Kenizzites, the Kadmonites, the Hittites, the Perizzites, the Rephaim, the Amorites, the Canaanites, the Girgashites and the Jebusites. Genesis 15:19-21

25 and the land is defiled. Therefore I do visit the iniquity thereof upon it, and the land itself vomiteth out her inhabitants.

— therefore I do visit the iniquity thereof; and the land itself vomiteth out her inhabitants: the Canaanites collectively, as enormous and incorrigible sinners, were to be exterminated; and this extermination was manifestly a judicial punishment inflicted by a ruler whose laws had been grossly and perseveringly outraged;

— and the land itself vomiteth out her inhabitants; as a stomach loaded with corrupt and bad food it has taken in, nauseates it, and cannot bear and retain it, but casts it up; so the land of Canaan being as nauseous and as useless as the cast of a man’s stomach.

26 Ye shall therefore keep My statutes and My judgments, and shall not commit any of these abominations, neither any of your own nation nor any stranger who sojourneth among you

— ye shall therefore keep my statutes; as the perpetration of the above named abominations entailed such disastrous consequences both to the land and to its inhabitants,

And if you pollute it, the land will vomit you up just as it vomited up the nations that preceded you Leviticus 18:28

27 (for all these abominations have the men of the land done, who were before you, and the land is defiled), — the repetition as those in Leviticus 18:24-25, is of the same sentiments in diiferent words, as is frequently the case in the Scriptures, is designed to impart emphasis. The parentheses are unnecessary;

28 that the land spew not you out also when ye defile it, as it spewed out the nations that were before you. — that the land spue not you out also; better, Lest the land vomit you out; that is, as it spewed out the nations that were before you;

— the judgement is expulsion; hence the Targum says

“For these abominable things have been done by the men of the land who have been before you, so that the land hath been polluted:

“lest, when you pollute the land, it cast you forth, as it will have delivered itself of the people that were before you. Leviticus 18:27-28 Jonathan

— same thing, the judgement is expulsion; and here from the MSG

“Don’t pollute yourself in any of these ways. This is how the nations became polluted, the ones that I am going to drive out of the land before you. Even the land itself became polluted and I punished it for its iniquities—the land vomited up its inhabitants.

“You must keep my decrees and laws—natives and foreigners both. You must not do any of these abhorrent things. The people who lived in this land before you arrived did all these things and polluted the land.

“And if you pollute it, the land will vomit you up just as it vomited up the nations that preceded you. Leviticus 18:24-28 MSG

And below a parallel Scripture from Jeremiah:

“Therefore behold, the days come,” saith the Lord, “that it shall no more be said, ‘The Lord liveth who brought up the children of Israel out of the land of Egypt,’

“but, ‘the Lord liveth who brought up the children of Israel from the land of the north, and from all the lands whither He had driven them.’ And I will bring them back into their land that I gave unto their fathers. Jeremiah 16:14-15

29 For whosoever shall commit any of these abominations, even the souls who commit them shall be cut off from among their people.

— the souls that commit them shall be cut off; this strong denunciatory language is applied to all the crimes specified in this chapter without distinction: from incest as truly as to Sodomy to bestiality, and to other cases of affinity.

30 Therefore shall ye keep Mine ordinance, that ye commit not any one of these abominable customs, which were committed before you, and that ye defile not yourselves therein: I am the Lord your God.’”

— and that ye defile not yourselves therein; for though the land is so often said to be defiled, yet, properly speaking, and chiefly, it was the inhabitants that were defiled by their abominable customs;

— and so should the Israelites do so also, should they observe the same, and thereby become abominable in the sight of God, and incur his same displeasure, and be liable to his vengeance:

— from MSG

“Those who do any of these abhorrent things will be cut off from their people. Keep to what I tell you; don’t engage in any of the abhorrent acts that were practiced before you came.

“Don’t pollute yourselves with them. I am God, your God.” Leviticus 18:29-30 MSG

JESUS’ Life After Resurrection

•May 24, 2026 • Leave a Comment

THE LAST HOURS of CHRIST on EARTH

The CoG Communities have been trumpeting that after resurrection, Christ went to heaven to present Himself to His Father to be accepted as a sacrifice. They base their “evidence” on the waving of the mistranslation of “omar” as “wave sheaf” in Leviticus 23:11 “And he shall wave the sheaf before the Lord to be accepted for you; on the morrow after the Sabbath the priest shall wave it.” 

But where are the evidence? The timeline below shows that Jesus was hour-by-hour on the earth after being resurrected.

They led Him to be crucified — 14th Nisan, Wednesday (7:00 AM)
John 19:16 Then he delivered Him therefore unto them to be crucified. And they took Jesus and led Him away.
17 And He, bearing His cross, went forth into a place called the Place of a Skull (which is called in the Hebrew, Golgotha)

The Third hour — 14th Nisan, Wednesday (9:00 AM) — 3rd hour
John 19:18 where they crucified Him and two others with Him, one on either side and Jesus in the midst. — here, Jesus was nailed to the cross, with two others besides Him
19 And Pilate wrote a title and put it on the cross. And the writing was: Jesus Of Nazareth The King Of The Jews.
20 Then many of the Jews read this title, for the place where Jesus was crucified was nigh to the city, and it was written in Hebrew and Greek and Latin.
21 Then said the chief priests of the Jews to Pilate, “Write not ‘The King of the Jews,’ but, ‘He said, I am King of the Jews.’”
22 Pilate answered, “What I have written, I have written.”
23 Then the soldiers, when they had crucified Jesus, took His garments and made four parts, to every soldier a part, and also His coat. Now the coat was without seam, woven from the top throughout.
24 They said therefore among themselves, “Let us not rend it, but cast lots for it, whose it shall be,” that the Scripture might be fulfilled which saith, “They parted My raiment among them, and for My vesture did they cast lots.” These things therefore the soldiers did.

Mark 15:25 And it was the third hour (9 AM) when they crucified Him.

29 And those who passed by railed at Him, wagging their heads and saying, “Ah, thou that destroyest the temple and buildest it in three days,
30 save thyself and come down from the cross!”
31 Likewise also the chief priests, mocking, said among themselves with the scribes, “He saved others; himself he cannot save!
32 Let Christ, the King of Israel, descend now from the cross, that we may see and believe.” And those who were crucified with Him reviled Him.
25 Now there stood by the cross of Jesus His mother and His mother’s sister, Mary the wife of Clopas, and Mary Magdalene.
26 When Jesus therefore saw His mother and the disciple standing by whom He loved, He said unto His mother, “Woman, behold thy son!”
27 Then said He to the disciple, “Behold thy mother!” And from that hour, that disciple took her unto his own home.

Mark 15:33 And when the sixth hour (12 NOON) had come, there was darkness over the whole land until the ninth hour (3 PM).
Luke 23:44 And it was about the sixth hour (12 NOON), and there was a darkness over all the earth until the ninth hour (3 PM). 45 And the sun was darkened, and the veil of the temple was rent in the midst.

28 After this Jesus, knowing that all things were now accomplished, that the Scripture might be fulfilled, said, “I thirst.”
29 Now there was set there a vessel full of vinegar; and they filled a sponge with vinegar and put it upon a hyssop, and put it to His mouth.

Mark 15:34 And at the ninth hour (3 PM) Jesus cried out with a loud voice, saying, “Eloi, Eloi, lama sabachthani?” which is, being interpreted, “My God, My God, why hast Thou forsaken Me?”
35 And some of those who stood by, when they heard it, said, “Behold, he calleth Elijah.”
36 And one ran and filled a sponge full of vinegar, and put it on a reed and gave it to Him to drink, saying, “Let him alone. Let us see whether Elijah will come to take him down.”
37 And Jesus cried out with a loud voice, and gave up the ghost.

30 When Jesus therefore had received the vinegar, He said, “It is finished.” And He bowed His head and gave up the ghost.

Earthquakes and graves opened — 14th Nisan, Wednesday (3.00 PM) — 9th hour
Matthew 27:51 And behold, the veil of the temple was rented in two from the top to the bottom, and the earth quaked and the rocks rent.
52 And the graves were opened; and many bodies of the saints who slept arose,
53 and came out of the graves after His resurrection, and went into the Holy City and appeared unto many.
54 Now when the centurion, and those who were with him watching Jesus, saw the earthquake and those things that were done, they feared greatly, saying, “Truly, this was the Son of God!”

Preparation for the Passover — 14th Nisan, Wednesday (4:00 PM) — 10th hour
John 19:31 The Jews therefore, because it was the Preparation, and so that the bodies should not remain upon the cross on the Sabbath day (for that Sabbath day was a high day), besought Pilate that their legs might be broken and that they might be taken away.
32 Then came the soldiers and broke the legs of the first and of the other who was crucified with Him.
33 But when they came to Jesus and saw that He was dead already, they broke not His legs,
34 but one of the soldiers with a spear pierced His side, and forthwith there came out blood and water.
35 And he that saw it bore record, and his record is true, and he knoweth that he saith truly, that ye might believe.
36 For these things were done, that the Scripture should be fulfilled: “A bone of Him shall not be broken.”
37 And again another Scripture saith, “They shall look on Him whom they pierced.”

The women watched — 14th Nisan, Wednesday (4:30 PM)
Mark 15:40 There were also women looking on afar off, among whom were Mary Magdalene, and Mary the mother of James the Less and of Joses, and Salome
41 (who also, when He was in Galilee, had followed Him and ministered unto Him), and many other women who came up with Him unto Jerusalem.

Joseph of Arimathea — 14th Nisan, Wednesday (5:00 PM) — 11th hour
Mark 15:42 And now when the evening had come, because it was the Preparation (that is, the day before the Sabbath), — that Sabbath was a High Day, the beginning of the Feast of Unleavened Bread.
43 Joseph of Arimathea, an honorable council member who also was waiting for the Kingdom of God, came and went in boldly unto Pilate and asked for the body of Jesus.
44 And Pilate wondered if He were already dead; and calling unto him the centurion, he asked him whether He had been any while dead.
45 And when he learned it from the centurion, he gave the body to Joseph.
46 And Joseph bought fine linen, and took Him down and wrapped Him in the linen. And he laid Him in a sepulcher which was hewn out of a rock, and rolled a stone unto the door of the sepulcher.
47 And Mary Magdalene and Mary the mother of Joses beheld where He was laid.

~~~

First Day of Unleavened Bread — 15th Nisan, Thursday (9:00 AM) — 3rd hour
Matthew 27:62 Now the next day, that following the Day of the Preparation, the chief priests and Pharisees came together unto Pilate,
63 saying, “Sir, we remember that that deceiver said while he was yet alive, ‘After three days I will rise again.’
64 Command therefore that the sepulcher be made secure until the third day, lest his disciples come by night and steal him away, and say unto the people, ‘He is risen from the dead,’ so that the last error shall be worse than the first.”
65 Pilate said unto them, “Ye have a watch. Go your way, make it as secure as ye can.”
66 So they went and made the sepulcher secure, sealing the stone and setting up a watch.

Thursday Evening — Beginning of 16th Nisan (7:00 PM) — 1st watch
Mark 16:1 And when the Sabbath was past, Mary Magdalene and Mary the mother of James, and Salome bought sweet spices, so that they might come and anoint Him.

Friday Afternoon — Afternoon of 16th (1-5 PM) to Beginning of 17th (6 PM)
Luke 23:56 And they returned and prepared spices and ointments, and rested the Sabbath day according to the commandment. — resting on the weekly Sabbath

Saturday Evenings — End of 17th (5-6 PM) to the Dawn of 18th (6-7 PM)
Matthew 28:1 At the end of the Sabbath (G4521, sab’-bat-on), as it began to dawn toward the first day of the week (G4521, sab’-bat-on), came Mary Magdalene and the other Mary to see the sepulcher. — Dawn is the beginning (of the 24-hr day), so that the three days and nights remain intact.

The correct translation should be: At the end of the Sabbath, as it began to dawn toward the beginning of [a new] week (G4521, sab’-bat-on), came Mary Magdalene and the other Mary to see the sepulcher.

2 And behold, there was a great earthquake, for the angel of the Lord descended from Heaven, and came and rolled back the stone from the door, and sat upon it.
3 His countenance was like lightning, and his raiment white as snow.
4 And for fear of him the guards shook and became as dead men.
5 And the angel answered and said unto the women, “Fear ye not, for I know that ye seek Jesus, who was crucified.
6 He is not here, for He is risen, as He said. Come, see the place where the Lord lay.
7 And go quickly and tell His disciples that He is risen from the dead, and behold, He goeth before you into Galilee. There shall ye see Him. Lo, I have told you.”

Sunday Morning — Dawn of 18th of Nisan (4-5 AM)
Mark 16:2 And very early in the morning on the first day of the week (beginning of a new week G4521, sab’-bat-on), they came unto the sepulcher at the rising of the sun.
3 And they said among themselves, “Who shall roll us away the stone from the door of the sepulcher?”
4 And when they looked, they saw that the stone was rolled away, for it was very large.
5 And entering into the sepulcher, they saw a young man sitting on the right side, clothed in a long white garment; and they were frightened. — no mentioning that his countenance was like lightning. Also, Luke account (Luke 24:4) says they saw two men stood by them, not one sitting; John account of two angels both sitting, one at each end of Christ tomb:

Luke 24:4 And it came to pass, as they were much perplexed about this, behold, two men stood by them in shining garments.
5 And as they were afraid and bowed down their faces to the earth, they said unto them, “Why seek ye the living among the dead?
6 He is not here, but has risen! Remember how He spoke unto you when He was yet in Galilee,
7 saying, ‘The Son of Man must be delivered into the hands of sinful men and be crucified, and the third day rise again.’”
8 And they remembered His words,

6 And he said unto them, “Be not afraid. Ye seek Jesus of Nazareth, who was crucified. He is risen! He is not here. Behold the place where they laid Him.
7 But go your way. Tell His disciples and Peter that He goeth before you into Galilee. There shall ye see Him, as He said unto you.”

Luke 24:9 and returned from the sepulcher and told all these things unto the eleven and to all the rest.
10 It was Mary Magdalene and Joanna and Mary the mother of James, and other women who were with them, who told these things unto the apostles.
11 And their words seemed to them as idle tales, and they believed them not.

Sunday Morning — Morning of 18th Nisan (7-8 AM)
John 20:2 Then she ran and came to Simon Peter and to the other disciple (Most guessed this other disciple as John), whom Jesus loved, and said unto them, “They have taken away the Lord out of the sepulcher, and we know not where they have laid Him!”
3 Peter therefore went forth, and that other disciple, and came to the sepulcher.
4 And they both ran together, and the other disciple outran Peter and came first to the sepulcher.
5 And stooping down and looking in, he saw the linen cloth lying, yet he went not in.
6 Then came Simon Peter following him, and went into the sepulcher and saw the linen cloths as they lay
7 and the napkin that had been about His head, not lying with the linen cloths, but wrapped together in a place by itself.
8 Then the other disciple, who came first to the sepulcher, went in also; and he saw, and believed.
9 For as yet they knew not the Scripture, that He must rise again from the dead. — none of the angels appeared to the men.
10 Then the disciples went away again unto their own home (went back to where they were staying in Jerusalem).

Sunday Morning — Morning of 18th Nisan (9-10 AM)
John 20:11 But Mary stood outside at the sepulcher weeping, and as she wept she stooped down and looked into the sepulcher,
12 and saw two angels in white, sitting one at the head and the other at the feet where the body of Jesus had lain.
13 And they said unto her, “Woman, why weepest thou?” She said unto them, “Because they have taken away my Lord, and I know not where they have laid Him.”
14 And when she had thus said, she turned around and saw Jesus standing, and knew not that it was Jesus.
15 Jesus said unto her, “Woman, why weepest thou? Whom seekest thou?” She, supposing Him to be the gardener, said unto Him, “Sir, if thou have borne Him hence, tell me where thou hast laid Him, and I will take Him away.”
16 Jesus said unto her, “Mary!” She turned herself and said unto Him, “Rabboni!” (which is to say, “Master”).
17 Jesus said unto her, “Touch Me not, for I am not yet ascended to My Father; but go to My brethren and say unto them, ‘I ascend unto My Father and your Father, and to My God and your God.’” — Do not cling to Me

MEV Jesus said to her, “Stop holding on to Me, for I have not yet ascended to My Father. But go to My brothers and tell them, ‘I am ascending to My Father and your Father, to My God and your God.’ ”
to them, I am ascending to my Father and your Father, to my God and your God.”
NASB Jesus said to her, “Stop clinging to Me, for I have not yet ascended to the Father; but go to My brothers and say to them, ‘I am ascending to My Father and your Father, and My God and your God.’”
CJB “Stop holding onto me,” Yeshua said to her, “because I haven’t yet gone back to the Father. But go to my brothers, and tell them that I am going back to my Father and your Father, to my God and your God.”

9 And when He had spoken these things, while they beheld, He was taken up, and a cloud received Him out of their sight.
10 And while they looked steadfastly toward heaven as He went up, behold, two men stood by them in white apparel,
11 who also said, “Ye men of Galilee, why stand ye gazing up into heaven? This same Jesus, who is taken up from you into Heaven, shall so come in like manner as ye have seen Him go into Heaven.”
Acts 1:9-11

— later, around the Sea of Galilee probably, as Matthew 28:10 testifies, a region where Jesus had spent much of His time with His disciples and others, a resurrected Christ appeared before a crowd of 500; “and that He was seen by over five hundred brethren at once” 1 Corinthians 15:6

18 Mary Magdalene came and told the disciples that she had seen the Lord, and that He had spoken these things unto her.

Sunday Morning — Morning of 18th Nisan (10-11 AM)
Matthew 28:8 And they departed quickly from the sepulcher with fear and great joy, and ran to bring His disciples word. — “Great joy” because they had seen the resurrected Jesus.
9 And as they went to tell His disciples, behold, Jesus met them, saying, “All hail.” And they came, and held Him by the feet, and worshiped Him. — see, they held Him by the feet a few moments later! And it must be emphasized, “as they went to tell His disciples, behold, Jesus met them;” which would be shortly after; “and held Him by the feet, and worshiped Him.”
10 Then said Jesus unto them, “Be not afraid. Go tell My brethren to go into Galilee, and there shall they see Me.” — Note the different terms: Disciples don’t necessarily include brethren, which is a larger group, the 120 and others (perhaps including the ladies and the 500), but brethern would certainly include His disciples.

Sunday Noon — Noon of 18th Nisan (12:00 Noon)
Matthew 28:11 Now when they were going, behold, some of the guards came into the city and reported unto the chief priests all the things that were done.
12 And when they were assembled with the elders and had taken counsel, they gave a large sum of money unto the soldiers,
13 saying, “Say ye, ‘His disciples came by night and stole him away while we slept.’
14 And if this come to the governor’s ears, we will persuade him and secure you.”
15 So they took the money, and did as they were taught; and this account is commonly reported among the Jews until this day.

Sunday Afternoon — Afternoon of 18th Nisan (2:00 – 5:30 PM)
Luke 24:13 And behold, two of them were going that same day to a village called Emmaus, which was from Jerusalem about seven miles. — from Jerusalem to Emmaus, were hilly and on tough terrain, typically, adults walk at a speed of 3 to 4 miles per hour, and therefore seven miles would be about 2 to 3 hours, but they were talking and when taking other breaks it could even slow down the pace. Hence a round trip of about 14 miles (22 km) would be roughly 4½ to 6 hours total with terrain considerations.

14 And they talked together of all these things which had happened.
15 And it came to pass that while they communed and reasoned together, Jesus Himself drew near and went with them.
16 But their eyes were held, that they should not know Him.
17 And He said unto them, “What manner of communications are these that ye have one to another as ye walk and are sad?”
18 And one of them, whose name was Cleopas, answering said unto Him, “Art thou only a stranger in Jerusalem, and hast not known the things which have come to pass there in these days?”
19 And He said unto them, “What things?” And they said unto Him, “Concerning Jesus of Nazareth, who was a prophet mighty in deed and word before God and all the people;
20 and how the chief priests and our rulers delivered Him to be condemned to death and have crucified Him.
21 But we trusted that it had been He who should have redeemed Israel. And besides all this, today is the third day since these things were done.
22 Yea, and certain women also of our company, who were early at the sepulcher, made us astonished.
23 And when they found not His body, they came saying that they had also seen a vision of angels, who said that He was alive.
24 And certain of those who were with us went to the sepulcher and found it even so as the women had said, but Him they saw not.”
25 Then He said unto them, “O fools, and slow of heart to believe all that the prophets have spoken!
26 Ought not Christ to have suffered these things and to enter into His glory?”
27 And beginning with Moses and all the prophets, He expounded unto them in all the Scriptures the things concerning Himself.
28 And they drew nigh unto the village whither they were going, and He made as though He would have gone further.
29 But they constrained Him, saying, “Abide with us, for it is toward evening and the day is far spent.” And He went in to tarry with them. — this is likely to be getting dark 5:30 PM
30 And it came to pass, as He sat at meat with them, He took bread and blessed it, and broke and gave it to them.
31 And their eyes were opened and they knew Him. And He vanished out of their sight.
32 And they said to one another, “Did not our hearts burn within us while He talked with us on the way and while He opened to us the Scriptures?”

Sunday Evening — Evening of 19th Nisan (6:00 – 7:30 PM)
Luke 24:33 And they rose up that same hour and returned to Jerusalem, and found the eleven gathered together and those who were with them,
34 saying, “The Lord is risen indeed and hath appeared to Simon!” — and John perhaps
35 And they told what things were done on the way, and how He was known to them in the breaking of bread.

Sunday Evening — Evening of 19th Nisan (10:00 – 11:00 PM)
Luke 24:36 And as they thus spoke, Jesus Himself stood in the midst of them and said unto them, “Peace be unto you.”
37 But they were terrified and afraid, and supposed that they had seen a spirit.
38 And He said unto them, “Why are ye troubled, and why do thoughts arise in your hearts?
39 Behold My hands and My feet, that it is I Myself. Handle Me and see, for a spirit hath not flesh and bones, as ye see Me to have.”
40 And when He had thus spoken, He showed them His hands and His feet.
John 20:20 And when He had so said, He showed unto them His hands and His side. Then were the disciples glad when they saw the Lord.
21 Then said Jesus to them again, “Peace be unto you. As My Father hath sent Me, even so send I you.”
22 And when He had said this, He breathed on them and said unto them, “Receive ye the Holy Ghost.

41 And while they yet believed not for joy, and wondered, He said unto them, “Have ye here any meat?”
42 And they gave Him a piece of a broiled fish and of a honeycomb.
43 And He took it and ate before them. — If Christ had gone to heaven and been accepted by the Father, they didn’t even give Him a meal, poor thing! Moses’ face turned white radiating with the glory of God, making the Israelites afraid to come near him, but nothing about Jesus’ face radiating white after He had returned if He had appeared before the glory of His Father. Perhaps His sacrifice wasn’t accepted, lol!

This journey likely began fairly early, perhaps sometime after 9 am, with Jesus wanting the women clinging to His feet to let Him go so He could reveal Himself to the travelers from Jerusalem to Emmaus.


44 And He said unto them, “These are the words which I spoke unto you while I was yet with you, that all things must be fulfilled which were written in the Law of Moses and in the Prophets and in the Psalms concerning Me.”
45 Then opened He their understanding, that they might understand the Scriptures,
46 and said unto them, “Thus it is written, and thus it behooved Christ to suffer and to rise from the dead the third day,
47 and that repentance and remission of sins should be preached in His name among all nations, beginning at Jerusalem.
48 And ye are witnesses of these things. — Jesus told them many things, but He didn’t tell them that He had gone to heaven and had been accepted by the Father. Perhaps He forgot!

Conclusion: The hour-by-hour timeline above doesn’t support that the resurrected Christ had gone up to heaven and be accepted by the Father. Second, the Lamb in Leviticus 23:12 wasn’t waved! Weird! Why wasn’t this Lamb waved if it were to represent Christ? Third, if waving means going up to heaven and back, then why the 3000 new converts on Pentecost (Acts 2) didn’t similarly go up to heaven as they were also waved (Lev 23:20), each should be giving warning the others “don’t touch me” along the way up and back from heaven on that day of Pentecost, wouldn’t they?

This timeline above is conclusive. The end-time CoG Communities have had their share of nonsensical interpretations which have caused great delusions among themselves. Most of these Blind Guides didn’t even notice the Lamb in Leviticus 23:12! It is nice to believe that Christ was waved and accepted by the Father before the Throne in heaven, but where are the evidence? Not a single one is given. 

Instead the CoG Communities have been infiltrated by the long arms of the sun-worshipping Samaritans to pin down Shavuot on Sundays as they have succeeded in pinning the weekly Sabbath on Sundays with the same success. Now this Samaritan-inspired “White Sunday Pentecost” or “Whitsunday Pentecost” doctrine is a well-entrenched ideology within the CoG Communities!

~~~~~

Leviticus (15-16)

•May 23, 2026 • Leave a Comment

Chapter 15 deals with law of purity for both man and woman; and from verses 29 to 33, it prescribed how to be cleansed.

Indications are strong that these purity laws are only meant for citizens who lives around Jerusalem, so that the Sanctuary may not be defiled; and as the penalty could be death, so serious, it strengthens further that the law are only meant for those living close to the Sanctuary.

Leviticus 15

1 And the Lord spoke unto Moses and to Aaron, saying,

“Speak unto the children of Israel, and say unto them, ‘When any man hath a running issue out of his flesh, because of his issue he is unclean.

— clearer from the MSG

God spoke to Moses and Aaron: “Speak to the People of Israel. Tell them, When a man has a discharge from his genitals, the discharge is unclean. Whether it comes from a seepage or an obstruction he is unclean. He is unclean all the days his body has a seepage or an obstruction. Leviticus 15:1-3

And this shall be his uncleanness in his issue: whether his flesh run with his issue or his flesh be stopped from running with his issue, it is his uncleanness.

Every bed whereon he lieth who hath the issue is unclean, and every thing whereon he sitteth shall be unclean. — every thing; Heb. vessel, by which the Hebrews understand all sorts of household stuff.

And whosoever toucheth his bed shall wash his clothes and bathe himself in water, and be unclean until the evening.

— every bed, whereon he lieth; so severely did the canonical law deal with these cases that any defilement communicated to the bed, and hence also to his seat and saddle, by the patient in five different ways: by standing, sitting, lying, hanging, or leaning on it;

— and be unclean until the even; be unfit for conversation with other men till the even, though both his body and clothes are washed.

And he that sitteth on any thing whereon he sat who hath the issue shall wash his clothes and bathe himself in water, and be unclean until the evening. — and he that sitteth on any thing whereon he sat that hath the issue; shall be unclean, even though he does not touch it.

And he that toucheth the flesh of him that hath the issue shall wash his clothes and bathe himself in water, and is unclean until the evening.

And if he that hath the issue spit upon him that is clean, then he shall wash his clothes and bathe himself in water, and be unclean until the evening.

— and if he that hath the issue spit upon him that is clean; not purposely, which is not usual for a man to do, and whenever it is done, nothing is more affronting; but accidentally;

— whatever is brought up by coughing, as phlegm, or flows from the nose, or is pressed out of it.

And what saddle soever he rideth upon who hath the issue shall be unclean. — and what saddle soever he sitteth upon that hath the issue; when he rides upon any beast, horse, ass, or camel, whatever is put upon the creature, and he sits upon it, the saddle, and whatever appertains to it, the housing and girdle.

10 And whosoever toucheth any thing that was under him shall be unclean until the evening; and he that beareth any of those things shall wash his clothes and bathe himself in water, and be unclean until the evening.

— and whosoever toucheth anything that was under him shall be unclean until the even; either when lying along, or sitting, or riding.

11 And whomsoever he toucheth who hath the issue and hath not rinsed his hands in water, he shall wash his clothes and bathe himself in water, and be unclean until the evening.

12 And the vessel of earth that he toucheth who hath the issue shall be broken, and every vessel of wood shall be rinsed in water. — and the vessel of earth shall be broken; for the reason why vessels of a porous clay must be destroyed when contaminated by defilement.

13 “‘And when he that hath an issue is cleansed of his issue, then he shall number to himself seven days for his cleansing, and wash his clothes, and bathe his flesh in running water, and shall be clean. — man’s “ritual” impurity;

— from the Chabad Bible for this verse:

When the man with the discharge is cleansed of his discharge, he shall count seven days for himself for his purification, and then immerse his garments and immerse his flesh in spring water, and he shall be clean.

14 And on the eighth day he shall take for himself two turtledoves or two young pigeons, and come before the Lord unto the door of the tabernacle of the congregation, and give them unto the priest.

— from the MSG

“When a person with a discharge is cleansed from it, he is to count off seven days for his cleansing, wash his clothes, and bathe in running water. Then he is clean. On the eighth day he is to take two doves or two pigeons and come before God at the entrance of the Tent of Meeting and give them to the priest.

“The priest then offers one as an Absolution-Offering and one as a Whole-Burnt-Offering and makes atonement for him in the presence of God because of his discharge” Leviticus 15:13-15

15 And the priest shall offer them, the one for a sin offering and the other for a burnt offering; and the priest shall make an atonement for him before the Lord for his issue.

16 “‘And if any man’s seed of copulation go out from him, then he shall wash all his flesh in water and be unclean until the evening.

17 And every garment and every skin whereon is the seed of copulation, shall be washed with water and be unclean until the evening.

— from MSG

“When a man has an emission of semen, he must bathe his entire body in water; he remains unclean until evening. Every piece of clothing and everything made of leather which gets semen on it must be washed with water; it remains unclean until evening. When a man sleeps with a woman and has an emission of semen, both are to wash in water; they remain unclean until evening. Leviticus 15:16-18

18 The woman also with whom a man shall lie with seed of copulation, they shall both bathe themselves in water and be unclean until the evening.

19 “‘And if a woman have an issue and her issue from her flesh be blood, she shall be put apart seven days; and whosoever toucheth her shall be unclean until the evening.

20 And every thing that she lieth upon in her separation shall be unclean; every thing also that she sitteth upon shall be unclean.

21 And whosoever toucheth her bed shall wash his clothes and bathe himself in water, and be unclean until the evening.

22 And whosoever toucheth any thing that she sat upon shall wash his clothes and bathe himself in water, and be unclean until the evening.

— from MSG

“When a woman has a discharge of blood, the impurity of her menstrual period lasts seven days. Anyone who touches her is unclean until evening. Everything on which she lies or sits during her period is unclean. Anyone who touches her bed or anything on which she sits must wash his clothes and bathe in water; he remains unclean until evening. Leviticus 15:19-23

23 And if it be on her bed or on any thing whereon she sitteth, when he toucheth it, he shall be unclean until the evening.

24 And if any man lie with her at all and her monthly discharge be upon him, he shall be unclean seven days; and all the bed whereon he lieth shall be unclean.

25 “‘And if a woman have an issue of her blood many days out of the time of her separation, or if it run beyond the time of her separation, all the days of the issue of her uncleanness shall be as the days of her separation; she shall be unclean.

26 Every bed whereon she lieth all the days of her issue shall be unto her as the bed of her separation; and whatsoever she sitteth upon shall be unclean, as the uncleanness of her separation.

— from MSG

“If a woman has a discharge of blood for many days, but not at the time of her monthly period, or has a discharge that continues beyond the time of her period, she is unclean the same as during the time of her period.

“Every bed on which she lies during the time of the discharge and everything on which she sits becomes unclean the same as in her monthly period. Anyone who touches these things becomes unclean and must wash his clothes and bathe in water; he remains unclean until evening” Leviticus 15:25-27

27 And whosoever toucheth those things shall be unclean, and shall wash his clothes and bathe himself in water, and be unclean until the evening.

28 But if she be cleansed of her issue, then she shall number to herself seven days, and after that she shall be clean.

29 And on the eighth day she shall take unto her two turtledoves or two young pigeons, and bring them unto the priest to the door of the tabernacle of the congregation.

— Levites might live around the cities throughout all the tribes of Israel; but priests are normally only found in Jerusalem, centering around their work in the Sanctuary.

30 And the priest shall offer one for a sin offering and the other for a burnt offering; and the priest shall make an atonement for her before the Lord for the issue of her uncleanness.

— maybe these purity laws are only meant for citizens who lives around Jerusalem where the Sanctuary could be defiled because of its close proximity;

— from MSG

“When she is cleansed from her discharge, she is to count off seven days; then she is clean. On the eighth day she is to take two doves or two pigeons and bring them to the priest at the entrance to the Tent of Meeting.

“The priest will offer one for an Absolution-Offering and the other for a Whole-Burnt-Offering. The priest will make atonement for her in the presence of God because of the discharge that made her unclean” Leviticus 15:28-30

31 “‘Thus shall ye separate the children of Israel from their uncleanness, that they die not in their uncleanness when they defile My tabernacle that is among them.’”

— another indication that these purity laws are only meant for citizens who lives around Jerusalem, so that the Sanctuary may not be defiled; as the penalty is death, so it strengthens further that the law are only meant for those living close to the Sanctuary.

32 This is the law of him that hath an issue, and of him whose seed goeth from him and is defiled therewith,

33 and of her that is sick with her monthly discharge, and of him that hath an issue, of the man and of the woman, and of him that lieth with her that is unclean.

— from MSG

“These are the procedures to follow for a man with a discharge or an emission of semen that makes him unclean, and for a woman in her menstrual period—any man or woman with a discharge and also for a man who sleeps with a woman who is unclean.”

Leviticus 16

1 And the Lord spoke unto Moses after the death of the two sons of Aaron, when they offered before the Lord, and died;

— after the death of Nadab and Abihu, the two sons of Aaron; that is, after his two eldest sons had died, in consequence of having presumptuously entered the sanctuary in a profane manner, and playing with strange fire; they died by a flaming fire; or lightning?

and the Lord said unto Moses, “Speak unto Aaron thy brother, that he come not at all times into the Holy Place within the veil before the mercy seat which is upon the ark, that he die not; for I will appear in the cloud upon the mercy seat.

— that he come not at all times; Moses is therefore to warn his brother Aaron, the high priest, that if he wishes to escape a similar fate, he is not to presume to enter the Holy of Holies except on one day of the year, the Day of Atonement;

— as Aaron here stands for all those who in future are to succeed him in the pontificate, so Moses, who teaches him his duty, stands for his successors who are hereafter to impart instruction to the high priests on these most solemn occasions;

— he was to go into the holy of holies four times on the Day of Atoneme; first to offer incense, a second time to sprinkle the blood of the bullock, a third time to sprinkle the blood of the goat, and a fourth time to fetch out the censer; and if he entered a fifth time, he was worthy of death; yet Moses might at any time, and consult the Lord upon the mercy seat, Exodus 25:22;

— during the second Temple the instruction and preparation of the high priest for his functions devolved upon the Sanhedrin, who prescribed most minute rules for his guidance. Seven days before the Day of Atonement he was separated from his wife, and lodged in a chamber in the Temple, lest he should contract defilement, which might unfit him for the performance of his pontifical duties;

— the elders or the representatives of the Sanhedrin read and expounded to him the ordinances contained in this chapter; which he had to practise in their [presence, so as to make sure that he could rightly perform all the ceremonies. This continued during the whole night previous to the Day of Atonement, where he was to be kept awake, so as to prevent any pollution arising from a dream or accident by night.

Thus shall Aaron come into the Holy Place: with a young bullock for a sin offering and a ram for a burnt offering. — thus shall Aaron come; preparatory to his entering on this solemn service the high-priest was to offer two sacrifices in behalf of himself and his family.

He shall put on the holy linen coat, and he shall have the linen breeches upon his flesh and shall be girded with a linen girdle, and with the linen miter shall he be attired. These are holy garments. Therefore shall he wash his flesh in water, and so put them on.

— and he shall wash; he had to bathe his body every time when he changed his vestments, which were no less than five times on this day, and washes his hands and feet ten times on that day, and all are done in the holy place.

And he shall take from the congregation of the children of Israel two kids of the goats for a sin offering and one ram for a burnt offering. — and make atonement for himself and his house; for his own personal sins and for his family’s sins, those of his wife and children; and it may be extended to all the priests of the house of Aaron.

And Aaron shall offer his bullock of the sin offering which is for himself, and make an atonement for himself and for his house.

Two goats: one for the Lord, the other for ‘Azazel’

On the Day of Atonement

And he shall take the two goats and present them before the Lord at the door of the tabernacle of the congregation. — both goats were presented for the Day of Atonement before the Lord at the door of the Sanctuary; they should be alike in colour, height, and quality,

— which may represent the two natures in Christ; his divine nature, as the Son of God, in which he is impassable, and lives for ever, which may be signified by the goat in which he suffered and died at the hand of the high-priest;

— and the second goat, and may be fitly represented by the goat that was alive, when it too was offered to the Lord, but let go; and in his human nature, as the Son of Man, in which he also suffered in the wilderness called Azazel, and died;

— or, perhaps another explanation is that the second goat is connected to the angel Azazel, who, in the Book of Enoch, repented and asked Enoch to intercede on his behalf?

And Aaron shall cast lots upon the two goats — one lot for the Lord and the other lot for Azazel. — after the lot had been chosen, the two goats were distinguished from each other by having a piece of scarlet cloth tied;

— the first round its neck, the second round its horn. One lot for the Lord, and the other lot for Azazel, which is a wilderness about 12 miles from Jerusalem.

And Aaron shall bring the goat upon which the Lord’S lot fell, and offer him for a sin offering.

10 But the goat on which the lot fell to be for Azazel shall be presented alive before the Lord, to make an atonement with him and to let him go into the wilderness to Azazel. — Jonathan says “by sending him to die in a place rough and hard in the rocky desert which is Beth-hadurey,”

— both goats were presented before the Lord; perhaps one to atone for human’s sin, the goat destined for Azazel to represent Azazel and the angel’s sin, to be the same as the angels in the Book of Enoch 8:1; 10:10; 13:1; while others as Satan; but Satan or any of his demons have never known to have repented, is it?

11 “And Aaron shall bring the bullock of the sin offering which is for himself, and shall make an atonement for himself and for his house, and shall kill the bullock of the sin offering which is for himself.

— and came to offer his bullock, to make atonement for himself and for his house: as the second confession; and in the same words as before.

12 And he shall take a censer full of burning coals of fire from off the altar before the Lord, and his hands full of sweet incense beaten small, and bring it inside the veil. — inside the veil, that is, into the holy of holies before the Lord Leviticus 16:2.

13 And he shall put the incense upon the fire before the Lord, that the cloud of the incense may cover the mercy seat that is upon the testimony, that he die not.

— that he die not for so gross an error committed in the highest acts of worship, and that by a high priest, whose knowledge and function was a great aggravation to his sin.

14 And he shall take of the blood of the bullock and sprinkle it with his finger upon the mercy seat eastward; and before the mercy seat shall he sprinkle of the blood with his finger seven times.

— and sprinkle it with his finger upon the mercy seat, eastward; with his right finger; and the blood sprinkled with it did not fall upon the mercy seat.

15 Then shall he kill the goat of the sin offering that is for the people, and bring his blood within the veil, and do with that blood as he did with the blood of the bullock, and sprinkle it upon the mercy seat and before the mercy seat.

— having completed the atonement in the holy of holies on behalf of the priests, the high priest had now to do the same thing on behalf of the people.

16 And he shall make an atonement for the Holy Place, because of the uncleanness of the children of Israel and because of their transgressions in all their sins; and so shall he do for the tabernacle of the congregation that remaineth among them in the midst of their uncleanness.

— next he cleansed the tent of meeting, or the court of the sanctuary, where the Israelites were usually admitted; that is, the high priest sprinkled the court and the altar of burnt offering which was in it eight times with the mingled blood of the bullock and goat.

17 And there shall be no man in the tabernacle of the congregation when he goeth in to make an atonement in the Holy Place until he come out, and has made an atonement for himself and for his household and for all the congregation of Israel.

— and there shall be no man; whilst the high priest was performing this process of cleansing, no one, whether priest or Israelite, was permitted to be present.

18 And he shall go out unto the altar that is before the Lord and make an atonement for it, and shall take of the blood of the bullock and of the blood of the goat, and put it upon the horns of the altar round about.

— the order of the ceremony required that atonement should first be made for the most holy place with the mercy-seat, then for the holy place with the golden altar, and then for the altar in the court;

— the horns of the brazen altar were touched with the blood, as they were in the ordinary sin-offerings.

19 And he shall sprinkle of the blood upon it with his finger seven times, and cleanse it and hallow it from the uncleanness of the children of Israel.

— and he shall sprinkle of the blood upon it with his finger seven times; this was done with his right finger, or forefinger, and seven times, to denote the perfect cleansing of the altar with it.

20 “And when he hath made an end of reconciling the Holy Place and the tabernacle of the congregation and the altar, he shall bring the live goat. — he shall bring the live goat; having already been presented before the Lord (Lev 16:10), it was now brought forward to the high priest.

21 And Aaron shall lay both his hands upon the head of the live goat, and confess over him all the iniquities of the children of Israel and all their transgressions in all their sins, putting them upon the head of the goat, and shall send him away by the hand of a fit man into the wilderness.

— this is the ‘Azazel’ goat; but the confession is still upon the children of Israel; so this defeat the theme that the ‘Azazel’ goat is to atone the sins of the angels led by Azazel;

— the high priest, who, placing his hands upon its head, and “having confessed over it all the iniquities of the people of Israel, and all their transgressions in all their sins,” transferred them by this act to the goat as their substitute.

22 And the goat shall bear upon him all their iniquities unto a land not inhabited; and he shall let go the goat in the wilderness.

— it was then delivered into the hands of a person, who was appointed to lead him away into a distant, solitary, and desert place, “Azazel,” where he was led to a high rocky twelve miles from Jerusalem, and there, being thrust over the precipice, he was killed.

23 “And Aaron shall come into the tabernacle of the congregation, and shall put off the linen garments which he put on when he went into the Holy Place and shall leave them there;

— and shall put off the linen garments which he put on when he went into the holy place; the holy of holies, that is, after he had brought it (the censer) out, then he clothed himself with the golden garments for the daily evening sacrifice;

— and this was the order of the services (on the day of atonement); the daily morning sacrifice (was performed) in the golden garments; the service of the bullock and of the goat, and the incense of the censer, in the white garments; and his ram, and the ram of the people, and some of the additions, in the golden garments;

24 and he shall wash his flesh with water in the Holy Place and put on his garments, and come forth and offer his burnt offering and the burnt offering of the people, and make an atonement for himself and for the people. — he shall wash in the holy place; that is, in the court of the tabernacle, where stood the altar of burnt-offering, and the sacred laver.

25 And the fat of the sin offering shall he burn upon the altar.

26 And he that let go the goat for Azazel shall wash his clothes and bathe his flesh in water, and afterward come into the camp. — Jonathan: “And he who led away the goat to Azazel shall wash his clothes, and bathe his flesh in forty seahs of water, and afterward he may enter the camp.”

27 And the bullock for the sin offering and the goat for the sin offering, whose blood was brought in to make atonement in the Holy Place, shall one carry forth outside the camp; and they shall burn in the fire their skins and their flesh and their dung.

— shall one carry forth; shall be carried forth; during the second Temple four men carried the carcases upon two poles to the place set aside outside Jerusalem for burning.

28 And he that burneth them shall wash his clothes and bathe his flesh in water, and afterward he shall come into the camp. — because they had been defiled by the animals laden with sin.

29 “And this shall be a statute for ever unto you: that in the seventh month on the tenth day of the month, ye shall afflict your souls and do no work at all, whether it be one of your own country or a stranger who sojourneth among you;

— seventh month, on the tenth day; the month of Tisri, as being the seventh in the Sacred year; on the first day was celebrated the Feast of Trumpets, the tenth day was the Day of Atonement, and on the fourteenth day the Feast of tabernacles commenced;

— a stranger that sojourneth among you; rather, the foreigner who dwelleth among you; meaning is, one of foreign blood, who dwelt with the Israelites, and had become familiarly known to his neighbors: the Kenites (Judges 4:11, etc.); the Gibeonites Joshua 9; and a considerable portion of the “mixed multitude” (compare Exodus 12:38Exodus 12:48);

30 for on that day shall the priest make an atonement for you to cleanse you, that ye may be clean from all your sins before the Lord.

31 It shall be a sabbath of rest unto you and ye shall afflict your souls, by a statute for ever. — it shall be a Sabbath of rest unto you; literally, a resting day of solemn resting, a Sabbath of Sabbaths, ithat is, a day of complete and perfect rest.

32 And the priest, whom he shall anoint and whom he shall consecrate to minister in the priest’s office in his father’s stead, shall make the atonement, and shall put on the linen clothes, even the holy garments;

— and shall put on the linen clothes, even the holy garments: that is, on the Day of Atonement; in which clothes all the service peculiar to that day, as it was done by Aaron, so it was to be done by all his successors;

33 and he shall make an atonement for the Holy Sanctuary, and he shall make an atonement for the tabernacle of the congregation and for the altar, and he shall make an atonement for the priests and for all the people of the congregation.

34 And this shall be an everlasting statute unto you: to make an atonement for the children of Israel for all their sins once a year.” And he did as the Lord commanded Moses. — these several atonements, for his family, and for all the priests, were separate and distinct, and did not hinder one another, or interfere with one another.

Pentecost, when to start Counting

•May 22, 2026 • Leave a Comment

The Masoretic Text provides little clarity on when to begin the count, as the instruction to ‘count from the Sabbath’ fails to specify which Sabbath is intended. For an English-speaking person, this ambiguity fuels a major never ending debate between two possibilities: a) the annual holy day Sabbath, or b) the weekly Sabbath.

But just in case you insist on studying the Masoretic Text with some Hebrew, here is a gist of it:

Deuteronomy 16:9 “Seven weeks H7620 shalt thou number unto thee: begin to number the seven weeks H7620 from such time as thou beginnest to put the sickle to the corn.

— according to Strong, this shabbat H7620 could be translated as:

  • seven, period of seven (days or years), heptad, week
  • period of seven days, a week
  • Feast of Weeks
  • heptad, seven (of years)

Hence this shabbat could be translated as a period of seven days, or a block of seven days; totally 49 days

For a more detailed Study, see A Critique of Frank Nelte’s Pentecost

For a more straightforward process, we’ll turn to the Septuagint and the Targum of Jonathan for some clues.

(1) From the Septuagint, Pentecost is to be counted from the morrow after the first day (Leviticus 23:11 Septuagint), but what day is the first Day?

“and he shall lift up the sheaf before the Lord, to be accepted for you. On the morrow of the first day the priest shall lift it up.” Lev 23:11 LXX

Leviticus 23:5 gives the context that this takes place in the first month, Nisan, starting on the fourteenth day with Passover and the Days of Unleavened Bread, which last seven days. The first day, the fifteenth, is to be a holy gathering. On the following day, the sixteenth, the priest is to present the wave sheaf offering.

From the day you present the sheaf of the offering, count seven full weeks, which is forty-nine days, until the day after the seventh week—the fiftieth day—which will be Pentecost.

(2) And from another testimony from the Targum, the day is the day after they ate the Pascha, or Passover, is the same sixteenth of Nisan

And on the fifteenth day of this month the feast of unleavened cakes to the Name of the Lord. Seven days you shall eat unleavened bread.

On the first day of the feast a holy convocation shall be to you; ye shall do no work of labour,

but offer the oblation to the Name of the Lord seven days; in the seventh day of the feast shall be a holy convocation; you shall do no work of labour.

And the Lord spake with Mosheh, saying:

Speak with the sons of Israel, and say to them: When you have entered into the land which I give you, and you reap the harvest, you shall bring the sheaf of the first fruits of your harvest unto the priest;

and he shall uplift the sheaf before the Lord to be accepted for you. After the first festal day of Pascha (or, the day after the feast-day of Pascha) Leviticus 23:7-11 Jonathan

So the clear and obvious conclusion is that Pentecost is to be counted from the annual Sabbath, the fifteenth, that is, counting from the morrow, the sixteenth of Nisan.

For more about critics of the Septuagint, see Lies about the Septuagint

And for further Study, see Archive for the ‘Pentecost’ Category

Leviticus (13-14)

•May 22, 2026 • Leave a Comment

“And if the family of Egypt go not up and come not, upon whom there is no rain, there shall be the plague (leprosy during biblical times, but today, it could be Covid-19, Hantavirus or Ebola; or a new disease we have not heard before) wherewith the Lord will smite the nations who come not up to keep the Feast of Tabernacles” Zechariah 14:18.

Leviticus 13

1 And the Lord spoke unto Moses and Aaron, saying,

“When a man shall have in the skin of his flesh a rising, a scab, or bright spot, and it be in the skin of his flesh like the plague of leprosy, then he shall be brought unto Aaron the priest or unto one of his sons the priests.

— the plague of leprosy was a disease of uncleanness during ancient times; Miriam’s leprosy, and king Uzziah’s, were punishments of particular sins;

— as cleansing, a pollution as well as a disease; it was the duty of the priest to cleanse him, and therefore to search and discover whether he was defiled and needed cleansing.

And the priest shall look on the plague in the skin of the flesh; and when the hair in the plague has turned white and the plague in appearance be deeper than the skin of his flesh, it is a plague of leprosy; and the priest shall look on him and pronounce him unclean.

— when the hair in the plague is turned white; this is the first symptom, and the most noticeable as the commencement of the disease; the hair around the spot loses its colour and becomes thin and weak, the separate hairs being hardly stronger or individually thicker than down;

— the second symptom is when the plague in sight be deeper than the skin of his flesh; that is, below the upper skin, or cuticle, and in the real cutis. These two symptoms distinguish real leprosy from other affections which at first bear a similar appearance.

If the bright spot be white in the skin of his flesh and in appearance be not deeper than the skin and the hair thereof be not turned white, then the priest shall shut up him that hath the plague seven days.

— then the priest shall shut up him that hath the plague; the individual thus suspected was to be separated from the rest of the community for seven days, during which time it would be seen whether it actually developed itself into this disorder.

And the priest shall look on him the seventh day; and behold, if the plague in its appearance is stayed and the plague spread not in the skin, then the priest shall shut him up seven days more.

— if the plague in his sight be at a stay; better, if the plagued spot remain the same in its colour, that is, if the suspicious spot which caused the individual to be shut up had not altered its complexion;

— then the priest shall shut him up seven days more; such abundant care was taken, lest after all it should prove a leprosy.

And the priest shall look on him again the seventh day; and behold, if the plague be somewhat dark and the plague spread not in the skin, the priest shall pronounce him clean. It is but a scab, and he shall wash his clothes and be clean.

— and if, on further examination upon the seventh day, he found that the mole had become paler, had lost its brilliant whiteness, and had not spread, he was to declare him clean, for it was a scurf, i.e., a mere skin eruption, and not true leprosy.

But if the scab spread much abroad in the skin, after he hath been seen by the priest for his cleansing, he shall be seen by the priest again.

And if the priest see that, behold, the scab spreadeth in the skin, then the priest shall pronounce him unclean; it is leprosy. — it is a leprosy: it is a clear and plain case that it was one, and no doubt is to be made of it, it is a spreading leprosy.

“When the plague of leprosy is in a man, then he shall be brought unto the priest. — then he shall be brought unto the priest; by his friends and neighbours, if he is not willing to come of himself.

10 And the priest shall see him; and behold, if the rising be white in the skin and it has turned the hair white and there be living raw flesh in the rising,

11 it is an old leprosy in the skin of his flesh; and the priest shall pronounce him unclean and shall not shut him up, for he is unclean.

— and the priest shall pronounce him unclean, and shall not shut him up; there being no doubt at all of it being a leprosy, and of his uncleanness, and therefore no need to shut him up for further examination, but to turn him out of the camp till his purification was over.

12 And if leprosy break out abroad in the skin and the leprosy cover all the skin of him that hath the plague from his head even to his foot, wheresoever the priest looketh,

— and the leprosy cover all the skin of him that hath the plague, from his head even to his foot; such an one as the leper was that came to Christ for healing, said to be full of leprosy, Luke 5:12

13 then the priest shall consider; and behold, if the leprosy have covered all his flesh, he shall pronounce him clean that hath the plague. It has all turned white; he is clean.

14 But when raw flesh appeareth in him, he shall be unclean.

15 And the priest shall see the raw flesh and pronounce him to be unclean, for the raw flesh is unclean; it is leprosy.

16 Or if the raw flesh turn again and be changed unto white, he shall come unto the priest,

17 and the priest shall see him; and behold, if the plague be turned into white, then the priest shall pronounce him clean that hath the plague; he is clean.

18 “The flesh also in which, even in the skin thereof, was a boil and it is healed,

19 and in the place of the boil there be a white rising or a bright spot, white and somewhat reddish, and it be shown to the priest,

20 and if, when the priest seeth it, behold, it is in appearance lower than the skin and the hair thereof is turned white, the priest shall pronounce him unclean; it is a plague of leprosy broken out of the boil.

21 But if the priest look on it, and behold, there are no white hairs therein and if it is not lower than the skin, but is somewhat dark, then the priest shall shut him up seven days.

22 And if it spread much abroad in the skin, then the priest shall pronounce him unclean; it is a plague.

23 But if the bright spot stay in his place and spread not, it is a burning boil; and the priest shall pronounce him clean.

24 “Or if there be any flesh in the skin whereof there is a hot burning, and the living flesh that burneth have a white bright spot, somewhat reddish or white,

25 then the priest shall look upon it; and behold, if the hair in the bright spot is turned white and it is in appearance deeper than the skin, it is a leprosy broken out of the burning. Therefore the priest shall pronounce him unclean; it is the plague of leprosy.

26 But if the priest look on it, and behold, there is no white hair in the bright spot and it is no lower than the other skin, but is somewhat dark, then the priest shall shut him up seven days.

27 And the priest shall look upon him the seventh day; and if it is spread much abroad in the skin, then the priest shall pronounce him unclean; it is the plague of leprosy.

28 And if the bright spot stay in his place and spread not in the skin, but it is somewhat dark, it is a rising from the burning; and the priest shall pronounce him clean, for it is an inflammation from the burning.

29 “If a man or woman have a plague upon the head or the beard, — the treatment is similar to that in the preceding cases, but two periods of confinement are prescribed, and the hair is to be shaven after the first seven days;

30 then the priest shall see the plague; and behold, if it be in appearance deeper than the skin and there is in it a yellow thin hair, then the priest shall pronounce him unclean; it is a dry scall, even a leprosy upon the head or beard.

— even a leprosy upon the head or beard; as the head is the seat of knowledge, and the beard a sign of manhood, and of a man’s being arrived to years of discretion; when wisdom and prudence are expected in him; this sort of leprosy may be an emblem of errors in judgment;

— of false doctrines and heresies imbibed by persons, which eat as doth a canker, and are in themselves damnable, and bring ruin and destruction on teachers and hearers, unless recovered from them by the true teachings of God.

31 And if the priest look on the plague of the scall, and behold, it is not in appearance deeper than the skin and there is no black hair in it, then the priest shall shut up him that hath the plague of the scall seven days.

32 And on the seventh day the priest shall look on the plague; and behold, if the scall spread not and there is in it no yellow hair and the scall is not in appearance deeper than the skin,

33 he shall be shaved, but the scall shall he not shave; and the priest shall shut up him that hath the scall seven days more.

34 And on the seventh day the priest shall look on the scall; and behold, if the scall is not spread in the skin nor is in appearance deeper than the skin, then the priest shall pronounce him clean; and he shall wash his clothes and be clean.

35 But if the scall spread much in the skin after his cleansing,

36 then the priest shall look on him; and behold, if the scall is spread in the skin, the priest shall not seek for yellow hair; he is unclean.

37 But if the scall is in appearance stayed and there is black hair grown up therein, the scall is healed; he is clean, and the priest shall pronounce him clean.

38 “If a man also or a woman have in the skin of their flesh bright spots, even white bright spots,

39 then the priest shall look; and behold, if the bright spots in the skin of their flesh be darkish white, it is a freckled spot that groweth in the skin; he is clean.

— he is clean; from leprosy; this is observed, lest a person that is freckled should be mistaken for a leprous person; as every man that has some spots, failings, and infirmities, is not to be reckoned as unclean.

40 “And the man whose hair has fallen off his head, he is bald, yet is he clean. — he is bald; yet is he clean; the baldness mentioned in the first part of the verse in general terms is now more minutely specified as consisting of two kinds of baldness.

41 And he that hath his hair fallen off from the part of his head toward his face, his forehead is bald, yet is he clean.

42 And if there be in the bald head or bald forehead a white reddish sore, it is leprosy sprung up in his bald head or his bald forehead.

43 Then the priest shall look upon it; and behold, if the rising of the sore is reddish white in his bald head or in his bald forehead, as the leprosy appeareth in the skin of the flesh,

44 he is a leprous man; he is unclean. The priest shall pronounce him utterly unclean; his plague is on his head.

45 “And the leper in whom the plague is, his clothes shall be rent and his head bare, and he shall put a covering upon his upper lip and shall cry, ‘Unclean, unclean.’

— and shall cry, Unclean; as leprosy was most defiling, and as the very entrance of a leper into a house rendered everything in it unclean, the person thus afflicted had to warn off the passers by, lest they should approach him, and by contact with him become defiled.

46 All the days wherein the plague shall be in him he shall be defiled; he is unclean. He shall dwell alone; outside the camp shall his habitation be. — he shall dwell alone; in consequence of his extreme defilement, the leper had to live in seclusion outside the camp or city.

47 “The garment also that the plague of leprosy is in, whether it be a woolen garment or a linen garment,

48 whether it be in the warp or woof, of linen or of wool, whether in a skin or in any thing made of skin,

49 and if the plague is greenish or reddish in the garment or in the skin, either in the warp or in the woof or in any thing of skin, it is a plague of leprosy and shall be shown unto the priest.

50 And the priest shall look upon the plague and shut up it that hath the plague seven days.

51 And he shall look on the plague on the seventh day; if the plague is spread in the garment, either in the warp or in the woof, or in a skin or in any work that is made of skin, the plague is a consuming leprosy; it is unclean.

52 He shall therefore burn that garment, whether warp or woof, in wool or in linen, or any thing of skin wherein the plague is, for it is a consuming leprosy; it shall be burned in the fire.

53 “And if the priest shall look, and behold, the plague is not spread in the garment, either in the warp or in the woof, or in any thing of skin,

54 then the priest shall command that they wash the thing wherein the plague is, and he shall shut it up seven days more.

55 And the priest shall look on the plague after it is washed; and behold, if the plague has not changed his color and the plague is not spread, it is unclean; thou shalt burn it in the fire. It has eaten inward, whether it be bare within or without.

56 And if the priest look, and behold, the plague is somewhat dark after the washing of it, then he shall rend it out of the garment, or out of the skin, or out of the warp, or out of the woof.

57 And if it appear still in the garment, either in the warp or in the woof or in any thing of skin, it is a spreading plague; thou shalt burn that wherein the plague is with fire.

58 And the garment, either warp or woof or whatsoever thing of skin it is which thou shalt wash, if the plague is departed from them, then it shall be washed the second time and shall be clean.”

59 This is the law of the plague of leprosy in a garment of wool or linen, either in the warp or woof, or any thing of skins, to pronounce it clean or to pronounce it unclean.

Leviticus 14

1 And the Lord spoke unto Moses, saying,

“This shall be the law of the leper in the day of his cleansing: He shall be brought unto the priest. — this shall be the law of the leper; that is, the manner in which an Israelite cured of his leprosy shall be purified and restored to the communion of the sanctuary on the day when he is pronounced clean.

And the priest shall go forth out of the camp, and the priest shall look; and behold, if the plague of leprosy be healed in the leper,

then shall the priest command to take for him that is to be cleansed two birds alive and clean, and cedar wood, and scarlet, and hyssop. — two birds; literally, “sparrows,” but any sort of birds, 

— and the cedar wood, and scarlet, and hyssop; a stick of cedar; are also to be burnt with the red heifer for the ashes for the water of separation (Numbers 19:6), and they appear to have been commonly employed in purifications.

And the priest shall command that one of the birds be killed in an earthen vessel over running water.

As for the living bird, he shall take it, and the cedar wood, and the scarlet, and the hyssop, and shall dip them and the living bird in the blood of the bird that was killed over the running water.

And he shall sprinkle upon him that is to be cleansed from the leprosy seven times, and shall pronounce him clean and shall let the living bird loose into the open field.

And he that is to be cleansed shall wash his clothes, and shave off all his hair, and wash himself in water, that he may be clean; and after that he shall come into the camp, and shall tarry abroad out of his tent seven days.

— and shall tarry abroad out of his tent; but though permitted to return to the camp, yet he had to live the first week out of his own house.

But it shall be on the seventh day that he shall shave all his hair off his head and his beard and his eyebrows, even all his hair he shall shave off, and he shall wash his clothes; also he shall wash his flesh in water, and he shall be clean.

10 “And on the eighth day he shall take two helambs without blemish and one ewe lamb of the first year without blemish, and threetenths part of fine flour for a meat offering mingled with oil, and one log of oil.

11 And the priest who maketh him clean shall present the man that is to be made clean, and those things, before the Lord at the door of the tabernacle of the congregation.

12 And the priest shall take one helamb and offer him for a trespass offering, and the log of oil, and wave them for a wave offering before the Lord.

13 And he shall slay the lamb in the place where he shall kill the sin offering and the burnt offering, in the holy place; for as the sin offering is the priest’s, so is the trespass offering; it is most holy.

14 And the priest shall take some of the blood of the trespass offering, and the priest shall put it upon the tip of the right ear of him that is to be cleansed and upon the thumb of his right hand and upon the great toe of his right foot.

15 And the priest shall take some of the log of oil and pour it into the palm of his own left hand.

16 And the priest shall dip his right finger in the oil that is in his left hand and shall sprinkle of the oil with his finger seven times before the Lord;

17 and of the rest of the oil that is in his hand shall the priest put upon the tip of the right ear of him that is to be cleansed, and upon the thumb of his right hand and upon the great toe of his right foot, upon the blood of the trespass offering.

18 And the remnant of the oil that is in the priest’s hand he shall pour upon the head of him that is to be cleansed; and the priest shall make an atonement for him before the Lord.

19 And the priest shall offer the sin offering, and make an atonement for him that is to be cleansed from his uncleanness; and afterward he shall kill the burnt offering.

20 And the priest shall offer the burnt offering and the meat offering upon the altar; and the priest shall make an atonement for him, and he shall be clean.

21 “And if he be poor and cannot get so much, then he shall take one lamb for a trespass offering to be waved to make an atonement for him, and onetenth part of fine flour mingled with oil for a meat offering, and a log of oil,

— if he be poor, and cannot get so much; then he shall take one lamb—a kind and considerate provision for an extension of the privilege to lepers of the poorer class;

22 and two turtledoves or two young pigeons, such as he is able to get; and the one shall be a sin offering and the other a burnt offering.

— and two turtledoves, or two young pigeons, such as he is able to get; as good as he can get for his money, or his money he is possessed of will purchase; so that the poor man had as many offerings for his atonement and cleansing as the rich, and his expiation and purgation were as complete as theirs.

23 And he shall bring them on the eighth day for his cleansing unto the priest unto the door of the tabernacle of the congregation, before the Lord.

24 And the priest shall take the lamb of the trespass offering and the log of oil, and the priest shall wave them for a wave offering before the Lord.

25 And he shall kill the lamb of the trespass offering, and the priest shall take some of the blood of the trespass offering and put it upon the tip of the right ear of him that is to be cleansed, and upon the thumb of his right hand and upon the great toe of his right foot;

26 and the priest shall pour of the oil into the palm of his own left hand.

27 And the priest shall sprinkle with his right finger some of the oil that is in his left hand seven times before the Lord;

28 and the priest shall put of the oil that is in his hand upon the tip of the right ear of him that is to be cleansed, and upon the thumb of his right hand and upon the great toe of his right foot, upon the place of the blood of the trespass offering.

29 And the rest of the oil that is in the priest’s hand he shall put upon the head of him that is to be cleansed, to make an atonement for him before the Lord.

30 And he shall offer one of the turtledoves or of the young pigeons, such as he can get—

31 even such as he is able to get — the one for a sin offering and the other for a burnt offering, with the meat offering; and the priest shall make an atonement for him that is to be cleansed before the Lord.

32 This is the law for him in whom is the plague of leprosy, whose hand is not able to get that which pertaineth to his cleansing.”

33 And the Lord spoke unto Moses and unto Aaron, saying,

34 “When ye have come into the land of Canaan, which I give to you for a possession, and I put the plague of leprosy in a house of the land of your possession,

— when ye be come into the land of Canaan; which as yet they were not come to, being in the wilderness, and so the following law concerning the leprosy in houses could not yet take place, they now dwelling in tents, and not in houses;

35 and he that owneth the house shall come and tell the priest, saying, ‘It seemeth to me there is, as it were, a plague in the house,’ — leprosy in a house; this law was prospective, not to come into operation till the settlement of the Israelites in Canaan;

36 then the priest shall command that they empty the house before the priest go into it to see the plague, that all that is in the house be not made unclean; and afterward the priest shall go in to see the house.

37 And he shall look on the plague, and behold, if the plague be in the walls of the house with hollow streaks, greenish or reddish, which in appearance are lower than the wall,

38 then the priest shall go out of the house to the door of the house and shut up the house seven days.

39 And the priest shall come again the seventh day and shall look; and behold, if the plague is spread in the walls of the house,

40 then the priest shall command that they take away the stones in which the plague is, and they shall cast them into an unclean place outside the city.

41 And he shall cause the house to be scraped within round about, and they shall pour out the dust that they scrape off outside the city into an unclean place.

42 And they shall take other stones and put them in the place of those stones, and he shall take other mortar and shall plaster the house.

43 “And if the plague come again and break out in the house, after he hath taken away the stones and after he hath scraped the house and after it is plastered,

44 then the priest shall come and look; and behold, if the plague is spread in the house, it is a consuming leprosy in the house; it is unclean.

45 And he shall break down the house — the stones of it and the timber thereof and all the mortar of the house; and he shall carry them forth out of the city into an unclean place.

— and he shall break down the house; order it to be pulled down, and demolished entirely, that is, the priest shall give such orders; but this was to be done by the owner of the house, and that he was to do it himself, and have no associate with him in it;

46 Moreover he that goeth into the house all the while that it is shut up shall be unclean until the evening.

47 And he that lieth in the house shall wash his clothes, and he that eateth in the house shall wash his clothes.

48 “And if the priest shall come in and look upon it, and behold, the plague hath not spread in the house after the house was plastered, then the priest shall pronounce the house clean, because the plague is healed.

49 And he shall take to cleanse the house two birds, and cedar wood, and scarlet, and hyssop.

50 And he shall kill one of the birds in an earthen vessel over running water;

51 and he shall take the cedar wood and the hyssop and the scarlet and the living bird, and dip them in the blood of the slain bird and in the running water, and sprinkle the house seven times.

52 And he shall cleanse the house with the blood of the bird and with the running water and with the living bird, and with the cedar wood and with the hyssop and with the scarlet;

53 but he shall let go the living bird out of the city into the open fields, and make an atonement for the house; and it shall be clean.”

54 This is the law for all manner of plague of leprosy and scall,

55 and for the leprosy of a garment and of a house,

56 and for a rising and for a scab and for a bright spot,

57 to teach when it is unclean and when it is clean. This is the law of leprosy. — this is the law of leprosy; respecting every sort of it, and which is very remarkably enlarged upon; that is, to give directions for the time when they would have to do with the clean and unclean.

Leviticus (11-12)

•May 21, 2026 • Leave a Comment

Leviticus 11

1 And the Lord spoke unto Moses and to Aaron, saying unto them, — Moses and Aaron, this charge is given to them jointly; to one as governor, and to the other as high-priest; the priest was to direct the people about the things forbidden, and the magistrate was to see the direction followed.

“Speak unto the children of Israel, saying, ‘These are the beasts which ye shall eat among all the beasts that are on the earth. — in accordance with the division of the animal kingdom are into four principal classes:

— (1) the land animals, (2) the water animals, (3) the birds of the air, and (4) the swarming animals, or insects.

The foot of the ox, sheep and goat, the hoof is wholly divided below and above

Whatsoever parteth the hoof and is cloven-footed and cheweth the cud among the beasts, that shall ye eat. — whatsoever parteth the hoof, and is cloven-footed, and cheweth the cud; ruminating animals by the peculiar structure of their stomachs digest their food more fully than others.

Nevertheless these shall ye not eat, of those that chew the cud or of those that divide the hoof: the camel, because he cheweth the cud but divideth not the hoof, he is unclean unto you; 

and the coney, because he cheweth the cud but divideth not the hoof, he is unclean unto you; — the coney; that is the old name for the rabbits;

and the hare, because he cheweth the cud but divideth not the hoof, he is unclean unto you; 

and the swine, though he divide the hoof and is cloven-footed, yet he cheweth not the cud, he is unclean to you. — and the swine; this animal is remarkable for filthiness, and for feeding on all manner of ordure, even carrion if it falls in its way.

Of their flesh shall ye not eat, and their carcass shall ye not touch; they are unclean to you. 

“‘These shall ye eat of all that are in the waters: whatsoever hath fins and scales in the waters, in the seas, and in the rivers, them shall ye eat. — any fish, either from salt water or fresh, might be eaten if it had both scales and fins. but no other creature that lives in the waters.

10 And all that have not fins and scales in the seas and in the rivers, of all that move in the waters and of any living thing which is in the waters, they shall be an abomination unto you. 

— shellfish of all kinds, whether mollusks or crustaceans, and cetaceous animals were therefore prohibited, as well as fish which appear to have no scales, like the eel; probably because they were considered unwholesome.

11 They shall be even an abomination unto you: ye shall not eat of their flesh, but ye shall hold their carcasses in abomination. 

— an abomination unto you, for food; this clause is added to show that they were neither abominable in their own nature, nor for the food of other nations; as Noah was asked to eat anything that moves, “Every moving thing that liveth shall be food for you;” Genesis 9:3; and Noah was an righteous man.

12 Whatsoever hath no fins nor scales in the waters, that shall be an abomination unto you. — whatsoever hath no fins nor scales; frogs, eels, shellfish of all descriptions, were included as unclean; but locusts are clean and should be consumed.

13 “‘And these are they which ye shall hold in abomination among the fowls; they shall not be eaten, they are an abomination: the eagle, and the ossifrage, and the osprey, 

— all such fowls and birds as are rapacious, and live upon prey, as the eagle, and its several kinds, hawks, kites, vultures, ravens, and more, are forbidden;

14 and the vulture, and the kite after his kind, 

15 every raven after his kind, 

16 and the owl, and the night hawk, and the cuckoo, and the hawk after his kind, 

17 and the little owl, and the cormorant, and the great owl, 

18 and the swan, and the pelican, and the gier eagle, — and the swan; other translations as “white owl” or “barn owls” or “water hen,”

The swan as bustard in the Targum Jonathan
pedican

19 and the stork, the heron after her kind, and the lapwing, and the bat. 

20 “‘All fowls that creep, going upon all fours, shall be an abomination unto you. — all the fowls that creep, better, all creeping things which have wings; the swarming animals or insects, especially of the reptile or insect kind, which constitute the fourth class of the Hebrew division of the animal kingdom.

21 Yet these may ye eat of every flying creeping thing that goeth upon all fours, which have legs above their feet with which to leap upon the earth; — yet these may ye eat of every flying creeping thing that goeth upon all four, which have legs above their feet;

22 even these of them ye may eat: the locust after his kind, and the bald locust after his kind, and the beetle after his kind, and the grasshopper after his kind. — and the bald locust, the beetle, or rather, the hopping locust.

23 But all other flying creeping things which have four feet shall be an abomination unto you. 

24 “‘And by these ye shall be unclean. Whosoever toucheth the carcass of them shall be unclean until the evening, 

— shall be unclean until the even; for coming in contact with the dead body of the animals contracts defilement for the rest of the day, and till the beginning of a new day, which took place after sunset;

25 and whosoever beareth aught of the carcass of them shall wash his clothes and be unclean until the evening. 

— and whosoever beareth; but he who removed the carcase out of the camp or city, or from one place to another, not only contracted defilement for the rest of the day, but had to wash the clothes which he had on.

26 The carcasses of every beast which divideth the hoof, and is not cloven-footed nor cheweth the cud, are unclean unto you; every one who toucheth them shall be unclean. 

— they were prohibited from touching their dead bodies, but not their bodies when alive: for they are used as camels, horses, asses, and others, for necessary service.

27 And whatsoever goeth upon his paws, among all manner of beasts that go on all fours, those are unclean unto you; whoso toucheth their carcass shall be unclean until the evening.

28 And he that beareth the carcass of them shall wash his clothes and be unclean until the evening; they are unclean unto you. 

the weasel

29 “‘These also shall be unclean unto you among the creeping things that creep upon the earth: the weasel, and the mouse, and the tortoise after his kind, 

30 and the ferret, and the chameleon, and the lizard, and the snail, and the mole. 

31 These are unclean to you among all that creep; whosoever doth touch them when they are dead shall be unclean until the evening. 

32 And upon whatsoever any of them when they are dead doth fall, it shall be unclean. Whether it be any vessel of wood or raiment or skin or sack, whatsoever vessel it be wherein any work is done, it must be put into water, and it shall be unclean until the evening; so it shall be cleansed. 

33 And every earthen vessel whereinto any of them falleth, whatsoever is in it shall be unclean, and ye shall break it. 

34 Of all meat which may be eaten, that on which such water cometh shall be unclean; and all drink that may be drunk in every such vessel shall be unclean. 

35 And every thing whereupon any part of their carcass falleth shall be unclean. Whether it be an oven or ranges for pots, they shall be broken down; for they are unclean and shall be unclean unto you. 

36 Nevertheless a fountain or pit, wherein there is plenty of water, shall be clean; but that which toucheth their carcass shall be unclean. 

37 And if any part of their carcass fall upon any sowing seed which is to be sown, it shall be clean. 

38 But if any water be put upon the seed and any part of their carcass fall thereon, it shall be unclean unto you. 

39 “‘And if any beast of which ye may eat die, he that toucheth the carcass thereof shall be unclean until the evening. 

— and if any beast; that is, a clean animal, but which has not been properly slaughtered, having died from any disease or accident; the carcase, in this case, is to be regarded as the dead body of an unclean animal.

40 And he that eateth of the carcass of it shall wash his clothes and be unclean until the evening. He also that beareth the carcass of it shall wash his clothes and be unclean until the evening. 

41 “‘And every creeping thing that creepeth upon the earth shall be an abomination; it shall not be eaten.

42 Whatsoever goeth upon the belly, and whatsoever goeth upon all fours, or whatsoever hath more feet among all creeping things that creep upon the earth, them ye shall not eat, for they are an abomination.

43 Ye shall not make yourselves abominable with any creeping thing that creepeth, neither shall ye make yourselves unclean with them, that ye should be defiled thereby.

44 For I am the Lord your God. Ye shall therefore sanctify yourselves, and ye shall be holy, for I am holy; neither shall ye defile yourselves with any manner of creeping thing that creepeth upon the earth. 

— ye shall therefore sanctify yourselves, and ye shall be holy, for I am holy; that is, separate themselves from all other people, and be distinct from them, by using a different diet from theirs, as their Lord and God was different from all others;

— neither shall ye defile yourselves with any manner of creeping thing that creepeth upon the earth; which is repeated to keep them at the utmost distance from these things, and to fill them with an aversion to them, that they might be careful to avoid them.

45 For I am the Lord who bringeth you up out of the land of Egypt, to be your God. Ye shall therefore be holy, for I am holy. 

— ye shall therefore be holy, for I am holy; separate from all others as he was, living holy lives and conversations, agreeably to his will made known to them, in imitation or him who had chosen and called them to be his people; for, since holiness is his nature, it becomes them who are his house and family, his subjects and people.

46 “‘This is the law of the beasts, and of the fowl, and of every living creature that moveth in the waters, and of every creature that creepeth upon the earth, — this is the law of the beasts: clean and unclean, what were to be eaten, and what not.

47 to make a difference between the unclean and the clean, and between the beast that may be eaten and the beast that may not be eaten.’” — make a difference between the unclean and the clean—that is, between animals used and not used for food. 

but the locusts, the beetle and the grasshopper after his kind, you may eat, v22

Leviticus 12

1 And the Lord spoke unto Moses, saying,

“Speak unto the children of Israel, saying, ‘If a woman have conceived seed and borne a manchild, then she shall be unclean seven days; according to the days of the separation for her infirmity shall she be unclean. 

— she shall be unclean seven days; though the issue of blood which succeeds child-birth generally only lasts three or four days, yet the period of uncleanness is extended to seven days to include exceptional cases.

And on the eighth day the flesh of his foreskin shall be circumcised. — and in the eighth day the flesh of his foreskin shall be circumcised; or the foreskin of his flesh, that is, of the man child born according to the law.

And she shall then continue in the blood of her purifying three and thirty days. She shall touch no hallowed thing, nor come into the sanctuary until the days of her purifying are fulfilled. — the Levitical law ascribed impurity exclusively to the mother, but in no degree to the child; why?

But if she bear a maidchild, then she shall be unclean two weeks, as in her separation; and she shall continue in the blood of her purifying threescore and six days. 

— threescore and six days; the time in both particulars is double to that of the male, the former; the law, as some think, being adapted to an opinion that women are sooner purified after the birth of males than of females;

— perhaps, that a male infant circumcised on the eighth day, by the profusion of its own blood, bears part of the purgation; wherefore the mother, for the birth of a female, must suffer twice the time of separation; the separation is finished within two weeks, but the purgation continues sixty six days.

“‘And when the days of her purifying are fulfilled, for a son or for a daughter, she shall bring a lamb of the first year for a burnt offering, and a young pigeon or a turtledove for a sin offering, unto the door of the tabernacle of the congregation unto the priest, 

— but in cases of great poverty a pigeon might be substituted for the lamb (Leviticus 12:8, cf. Leviticus 5:7, 11);

— for a burnt offering; in gratitude, and by way of thanksgiving for the love she had received in childbearing;

who shall offer it before the Lord and make an atonement for her; and she shall be cleansed from the issue of her blood. This is the law for her that hath borne a male or a female. — and make an atonement for her; for whatsoever sin in connection with or that attended childbearing.

And if she be not able to bring a lamb, then she shall bring two turtledoves or two young pigeons, the one for the burnt offering and the other for a sin offering, and the priest shall make an atonement for her, and she shall be clean.’”

 — then she shall bring two turtles, or two young pigeons; which was a kind and merciful provision for the poorer sort;

— and the priest shall make an atonement for her, and she shall be clean; equally the same as if she had brought a lamb, instead of young pigeons, or turtledoves.

Leviticus (9-10)

•May 20, 2026 • Leave a Comment
~~~

Leviticus 9

1 And it came to pass on the eighth day that Moses called Aaron and his sons and the elders of Israel, — the consecration was to last seven days, during which time the persons to be consecrated were not to go away from the door of the tabernacle, and now is the eighth day.

and he said unto Aaron, “Take thee a young calf for a sin offering and a ram for a burnt offering, without blemish, and offer them before the Lord. 

— and Moses said unto Aaron; take thee a young calf for a sin offering; the directions in these sacred things were still given by Moses, the circumstances being extraordinary; and offer them before the Lord; on the altar of burnt offering, which stood in the court of the tabernacle;

— the Targum of Jonathan says

“And he [Moses] said to Aaron: Take for yourself a young calf for a sin offering, so that the Accuser (Satan) may not speak with a ‘triple tongue’ (slander) against you regarding the business of the Calf you made at Horeb.

“And however, take a ram for a burnt offering, so that the merit of Isaac—whom his father bound like a ram on the Mountain of Worship—may be remembered for you. Let both of them be unblemished, and offer them before the Lord.”

And unto the children of Israel thou shalt speak, saying, ‘Take ye a kid of the goats for a sin offering, and a calf and a lamb, both of the first year, without blemish, for a burnt offering, 

— and unto the children of Israel thou shalt speak; that is, Aaron, who was now constituted high priest, was to give the orders about the sacrifices;

— the Targum of Jonathan says

“And with the children of Israel you shall speak, saying: Take for yourselves a he-goat—because the Accuser (Satan) is compared to it—so that he may not speak with a ‘triple tongue’ (slander) against you regarding the business of the he-goat that the tribes of Jacob slaughtered [to dip Joseph’s coat in blood]; bring it as a sin offering.

“And a calf, because you enslaved yourselves to the [Golden] Calf.

“And a lamb in its first year, so that the merit of Isaac may be remembered for you—whom his father bound like a lamb. Let both of them be unblemished for a burnt offering.”

also a bullock and a ram for peace offerings to sacrifice before the Lord, and a meat offering mingled with oil; for today the Lord will appear unto you.’” 

— for to-day the Lord will appear unto you; that is, prepare and sanctify yourselves with these sacrifices, for the Lord is to manifest himself in an especial manner to signify his approval of the inauguration of Aaron and his family to the priesthood.

And they brought that which Moses commanded before the tabernacle of the congregation, and all the congregation drew near and stood before the Lord. 

— and all the congregation; that is, the elders who represented the people, whom Moses summoned (see Leviticus 9:1), and as many of the people as could find room assembled before the sanctuary in the court-yard to witness the newly-installed priests officiating for the first time.

And Moses said, “This is the thing which the Lord commanded that ye should do, and the glory of the Lord shall appear unto you.” 

— and the glory of the Lord shall appear unto you; the fire that should go out from him, and consume the sacrifice, which would be a demonstration of his presence with them, and of his acceptance of the sacrifice.

And Moses said unto Aaron, “Go unto the altar, and offer thy sin offering and thy burnt offering, and make an atonement for thyself and for the people; and offer the offering of the people and make an atonement for them, as the Lord commanded.” 

— and Moses said unto Aaron; though he was now the duly-installed high priest, yet he did not approach the altar till he was solemnly called upon by Moses to do it;

— the Targum of Jonathan says

“And it happened, that when Aaron saw the altar, its horns appeared to him like the horns of a calf. He became afraid to approach it.

“Therefore, Moses said to him: ‘Strengthen your resolve (literally: “Enforce your mind/knowledge”) and draw near to the altar; do not be afraid. Perform your sin offering and your burnt offering, and atone for yourself and for the people; and perform the offering of the people and atone for them, just as the Lord has commanded.'”

— the Targum explains that Aaron was suffering from a guilty conscience: he saw the Golden Calf he had helped create at Sinai. To him, the altar looked like the very idol that had nearly led to the nation’s destruction;

— perhaps it was a Paralysis of Shame: Aaron felt unworthy; he felt that by approaching the altar, he was reminding God of his greatest failure. His fear wasn’t of the fire or the ritual, but of his own past;

— the Question is, why was the four corners embedded with four horns of a calf? Could the horns be that of a ram?

Could the horns of the altars be that of a ram?

Aaron therefore went unto the altar and slew the calf of the sin offering, which was for himself. — and slew the calf; as the sacrificer Aaron, like every ordinary offerer, slaughtered the calf himself; and for himself.

And the sons of Aaron brought the blood unto him, and he dipped his finger in the blood and put it upon the horns of the altar, and poured out the blood at the bottom of the altar; 

— and poured out the blood at the bottom of the altar; what remained after he had put what was proper on the horns of it;

— the Targum of Jonathan says

“And the sons of Aaron brought the blood to him, and he dipped his finger in the blood of the bull and placed it upon the horns of the altar; and the rest of the blood he poured out at the foundation of the altar, and he sanctified it to make atonement upon it.”

10 but the fat, and the kidneys and the caul above the liver of the sin offering, he burned upon the altar, as the Lord commanded Moses.

11 And the flesh and the hide he burned with fire outside the camp. — and the flesh and the hide he burnt with fire outside the camp; with common fire, for the fire from the Lord came only upon the altar.

12 And he slew the burnt offering; and Aaron’s sons presented unto him the blood, which he sprinkled round about upon the altar. — and Aaron’s sons presented unto him the blood: which they had received into a basin, when it was slain.

13 And they presented the burnt offering unto him, with the pieces thereof and the head; and he burned them upon the altar. 

14 And he washed the inwards and the legs, and burned them upon the burnt offering on the altar.

15 And he brought the people’s offering, and took the goat, which was the sin offering for the people, and slew it and offered it for sin, as the first.

16 And he brought the burnt offering and offered it according to the ordinance.

17 And he brought the meat offering, and took a handful thereof and burned it upon the altar beside the burnt sacrifice of the morning.

18 He slew also the bullock and the ram for a sacrifice of peace offerings, which was for the people; and Aaron’s sons presented unto him the blood, which he sprinkled upon the altar round about, 

19 and the fat of the bullock and of the ram, the rump, and that which covereth the inwards, and the kidneys, and the caul above the liver. 

20 And they put the fat upon the breasts, and he burned the fat upon the altar.

21 And the breasts and the right shoulder Aaron waved for a wave offering before the Lord, as Moses commanded.

22 And Aaron lifted up his hand toward the people and blessed them, and came down from offering the sin offering and the burnt offering and peace offerings.

23 And Moses and Aaron went into the tabernacle of the congregation, and came out and blessed the people; and the glory of the Lord appeared unto all the people.

— the Targum of Jonathan says

“And when the sacrifices had been performed, but the Shekhinah (Divine Presence) had not yet revealed itself, Aaron was ashamed and afraid. He said to Moses: ‘Perhaps the Word of the Lord has not been pleased with the work of my hands?’

“Therefore, Moses and Aaron entered the Tabernacle of Appointment and prayed for the people of the House of Israel. Then they came out and blessed the people, saying: ‘May the Word of the Lord receive your sacrifice with favor, and may He dwell among you and forgive your sins.'”

24 And there came a fire out from before the Lord and consumed upon the altar the burnt offering and the fat, which when all the people saw, they shouted and fell on their faces. 

— there came a fire out from the Lord; a flame emanating from that resplendent light that filled the holy place flashed upon the brazen altar and kindled the sacrifices;

— this miraculous fire; for the descent of which the people had probably been prepared, was a sign, not only of the acceptance of the offerings and of the establishment of Aaron’s authority, but of God’s actual residence in that chosen dwelling-place;

— which when all the people saw, they shouted, and fell on their faces; Aaron blessing them, and the appearance of the glory of God unto them, no doubt, gave themfear, mixed with joy and pleasure, as the presence of God do to his people.

And fire from before the Lord came to consume the burnt offering upon the altar

Leviticus 10

1 And Nadab and Abihu, the sons of Aaron, took each of them his censer and put fire therein, and put incense thereon and offered strange fire before the Lord, which He commanded them not. — offered “strange fire” is likely an idiom for rebellion;

— and Nadab and Abihu, the sons of Aaron; his two eldest sons, as seems from Exodus 6:23; they took either of them his censer; their sin was of a complicated nature, and involved and consisted of several transgressions:

— (a) they each took his own censer, and not the sacred utensil of the sanctuary; (b) they both offered it together, whereas the incense was only to be offered by one; (c) they presumptuously encroached upon the functions of the high priest; for according to the Law the high priest alone burnt incense in a censer: see Lev 16:12-13; Num 17:11;

— the ordinary priests only burnt it on the golden altar in the holy place (Ex 30:7-8), or on the brazen altar as a part of the memorial, (see Lev 2:2-3,16) The case of Korah and his company was an exception, since it was ordered by Moses for an especial purpose (Num 16:6-25); (d) they offered the incense at an unauthorised time, since it was apart from the morning and evening sacrifice;

— and offered strange fire; they filled their vessels with common fire instead of taking it from the holy fire of the altar, which was always to be used in burning incense; (Lev 9:24; Lev 16:12);

— which he commanded them not; according to a figure of speech frequently used in Hebrew, where the negative form is used for the emphatic affirmative, this phrase is better rendered, “which he had strongly forbidden them.”

And there went out fire from the Lord and devoured them, and they died before the Lord. — they died before the Lord; that is, in the court of the sanctuary (Lev 10:1), or from the most holy place, where the Lord dwelt between the cherubim; on the very spot where the sin was committed;

— and devoured them; not reduced them to ashes, for neither their bodies nor their clothes were burnt with this fire; and so the Targum says of these, “without destroying their bodies,” their bodies were not burnt;

— the Targum of Jonathan says

“And a flame of fire went out from before the Lord in anger, and it split into four threads (streams) of fire. It entered into their nostrils and burned their souls, but their bodies were not scorched; and so they died before the Lord.”

And Nadab and Abihu, the sons of Aaron, met their Death

Then Moses said unto Aaron, “This is that which the Lord spoke, saying, ‘I will be sanctified in them that come nigh Me, and before all the people I will be glorified.’” And Aaron held his peace. 

— and Aaron held his peace; he was in a stupor, as the Septuagint, quite amazed, thunderstruck, but silently submitted to the righteous judgment which bereft him of his two sons;

— the Targum of Jonathan says

“And Moses said: ‘This is what the Lord spoke with me at Sinai, saying: By those who are close to Me, I will sanctify the Tabernacle. For if they are not careful in the service of the sacrifices, I will burn them with a flame of fire from before Me; so that in the sight of all the people, I shall be honored.’

And Aaron heard, and he remained silent; and he received a good reward for his silence.

And Moses called Mishael and Elzaphan, the sons of Uzziel the uncle of Aaron, and said unto them, “Come near; carry your brethren from before the sanctuary out of the camp.” 

— the first cousins of Aaron Exodus 6:22 are selected by Moses to convey the bodies of Nadab and Abihu out of the camp and bury them, probably because they were the nearest relations who were not priests.

So they went near and carried them in their coats out of the camp, as Moses had said. — the Targum of Jonathan says “and carried them with hooks of iron in their garments, and buried them outside the camp.”

And Moses said unto Aaron and unto Eleazar and unto Ithamar, his sons, “Uncover not your heads, neither rend your clothes, lest ye die, and lest wrath come upon all the people; but let your brethren, the whole house of Israel, bewail the burning which the Lord hath kindled. 

— Aaron and his two surviving sons are forbidden to show any signs of mourning, or to leave the court of the tabernacle in order to attend the funeral; lest ye die, and lest wrath come upon all the people; so very provoking to God would be any signs of mourning in Aaron and his sons;

— but let your brethren, the house of Israel, bewail the burning which the Lord hath kindled: though Aaron and his sons might not mourn, the whole body of the people might; were allowed to mourn over the great calamity which had thus befallen them.

And ye shall not go out from the door of the tabernacle of the congregation, lest ye die; for the anointing oil of the Lord is upon you.” And they did according to the word of Moses. 

— and ye shall not go out from the door of the tabernacle of the congregation, lest ye die; that is, they were not to relinquish the service of the sanctuary, on the account of the death of these relations of theirs, and through grief for it.

And the Lord spoke unto Aaron, saying,

“Do not drink wine nor strong drink, thou, nor thy sons with thee, when ye go into the tabernacle of the congregation, lest ye die. It shall be a statute for ever throughout your generations, 

— do not drink strong drink; this law following upon the affair of Nadab and Abihu has caused some to think, and not without some reason, that they were drunk with wine or strong drink, when they offered strange fire; 

— the Targum of Jonathan says

“Wine or anything that intoxicates you shall not drink—neither you nor your sons with you—at the time of your entry into the Tabernacle of Appointment, just as your sons did, who died by the burning of fire. This is an eternal statute for your generations.”

10 that ye may put difference between holy and unholy, and between unclean and clean, — and that ye may put difference between holy and unholy; that being sober they might be able to distinguish between the one and the other; which a drunken man, having his mind and senses disturbed, is not capable of;

11 and that ye may teach the children of Israel all the statutes which the Lord hath spoken unto them by the hand of Moses.” — and that ye may teach the children of Israel all the statutes: laws, precepts, ordinances, which was the business of the priests to do.

12 And Moses spoke unto Aaron and unto Eleazar and unto Ithamar, his sons who were left: “Take the meat offering that remaineth of the offerings of the Lord made by fire, and eat it without leaven beside the altar; for it is most holy. 

— for it is most holy; hence it could only be eaten by the male members of the families of the priests within the court of the sanctuary.

13 And ye shall eat it in the holy place, because it is thy due and thy sons’ due of the sacrifices of the Lord made by fire; for so I am commanded. — because it is thy due, and thy sons’ due, of the offerings of the Lord made by fire;

— and not any others; neither their wives nor daughters, nor any other related to him, or whom he might invite, as in other cases, might eat of it; this none but he and his sons might eat of, and nowhere else but in the sanctuary.

14 And the wave breast and heave shoulder shall ye eat in a clean place, thou, and thy sons, and thy daughters with thee; for they are thy due and thy sons’ due, which are given out of the sacrifices of peace offerings of the children of Israel. 

— and the wave breast and heave shoulder; that is, of the peace offering which was offered by the nation; thou and thy sons, and thy daughters with thee; these were not restrained to him and his sons only, as the meat offerings, and the flesh of the sin offerings were, but were common to the whole family; and how about their wives?

15 The heave shoulder and the wave breast shall they bring with the offerings made by fire of the fat, to wave it for a wave offering before the Lord; and it shall be thine and thy sons’ with thee by a statute for ever, as the Lord hath commanded.” 

— the heave shoulder and the wave breast shall they bring; that is, the offerers who devoted these portions of the peace offering to the Lord, are to bring them to the officiating priests.

16 And Moses diligently sought the goat of the sin offering, and behold, it was burned; and he was angry with Eleazar and Ithamar, the sons of Aaron who were left alive, saying, — and Moses diligently sought the goat; that is, the flesh of the goat of the sin offering which was offered by the nation on the eighth day;

— and, behold, it was burnt, being overwhelmed with grief at the loss of their brothers, Eleazar and Ithamar could not eat, and as none but priests were allowed to partake of the flesh of the sin offering, they burnt it on the altar; they did this all the more readily since the flesh of Aaron’s sin offering was just before burnt outside the camp;

— and he was angry with Eleazar and Ithamar; when their two elder brothers were killed with lightning for doing what was not commanded, which should have made them more observant of the laws of God, to do that which was commanded them: and though they were spared, and survived their brethren;

— yet they transgressed, in burning the sin offering of the people, when they should have eaten it. Moses expressed his anger not to Aaron, but to his sons, which he did for the honour of Aaron, laying the blame not on him, who was overwhelmed with grief, but on his sons;

— the Targum of Jonathan says

“And the three he-goats that were offered on that day—the goat of the New Moon, the sin offering of the people, and the sin offering brought by Nahshon son of Amminadab for the dedication of the altar—Aaron and his sons went and burned all three of them.

“Moses came and sought the he-goat of the sin offering of the people; he searched for it, and behold, it had been burned! And he was angry with Eleazar and Ithamar, the remaining sons of Aaron, saying…”

17 “Why have ye not eaten the sin offering in the holy place, seeing it is most holy, and God hath given it to you to bear the iniquity of the congregation, to make atonement for them before the Lord? 

— ye not eaten of the sin offering in the holy place, seeing it is most holy; the sin offering was one of the most holy things, and therefore to be eaten only in the sanctuary; though this was not the fault they are here charged with that they had eat it, but not in the holy place; for they had not eaten it at all, but burnt it;

— they are reminded of the whole law concerning it, that it was to he eaten by them, that it was to be eaten in the holy place, the reason of which is given; but they had not eaten it but burnt it.

18 Behold, the blood of it was not brought in within the holy place; ye should indeed have eaten it in the holy place, as I commanded.” 

— Moses diligently sought the goat of the sin offering, and, behold, it was burnt; in a sacrifice presented on behalf of the people, it was the duty of the priests, as typically representing them and bearing their sins, to have eaten the flesh after the blood had been sprinkled upon the altar;

— the blood that was not brought in within the holy place; the reason was because Aaron was not yet admitted into the holy place, whither that blood should have been brought, till he had prepared the way by the sacrifices which were to be offered in the court.

19 And Aaron said unto Moses, “Behold, this day have they offered their sin offering and their burnt offering before the Lord, and such things have befallen me. And if I had eaten the sin offering today, should it have been accepted in the sight of the Lord?” 

— and such things, such calamity, have befallen me; but whilst he, Eleazar, and Ithamar were thus duly performing the sacrificial rites, Nadab and Abihu, his other two sons, transgressed, and were suddenly struck down dead, thus overwhelming the survivors with sorrow, and rendering them unfit to partake of the sacrifices;

— and if I had eaten the sin offering today, should it have been accepted in the sight of the Lord? Aaron being a mourner; the high priest may offer, being a mourner, but not eat; but today, he might eat with rejoicing and thanksgiving as appears from Deu 12:7, 26:14; so should this be accepted?

— the Targum of Jonathan says

“And Aaron spoke with Moses: ‘Behold, this very day the children of Israel offered their sin offering and their burnt offering before the Lord; and yet a disaster such as this befell me with [the death of] my two sons!

“Now, is it not commanded regarding the Second Tithe (Ma’aser Sheni) that a mourner (Ovel) may not eat from it? How much more so, then, should this apply to a Sin Offering?

“And what if I had been negligent and eaten from the sin offering today? Surely my two remaining sons would also have deserved to be burned [by Divine fire], for it is impossible that such a thing would be right before the Lord!'”

20 And when Moses heard that, he was content. — and when Moses heard that, he was content; he said no more, he did not proceed in blaming Aaron nor his sons, but was satisfied with the answer received.

Leviticus (7-8)

•May 19, 2026 • Leave a Comment
~~~

Leviticus 7

1 “‘Likewise this is the law of the trespass offering (it is most holy): — trespass offering is most holy;

— wholly devoted for sacred use, either to the Lord, or to his priests; there were some things call light holy things, and others most holy in the highest degree, of this sort was the trespass offering.

In the place where they kill the burnt offering shall they kill the trespass offering; and the blood thereof shall he sprinkle round about upon the altar. 

— and the blood shall he sprinkle round the altar; on the upper part of it. There was a scarlet thread that was drawn around the altar in the middle, the blood of some of the sacrifices was sprinkled below it; and some above it, as was the blood of the trespass offering.

And he shall offer from it all the fat thereof: the rump, and the fat that covereth the inwards, — the fat portions only were to be burned upon the altar, viz., the same as in the sin and peace-offerings; but the flesh was to be eaten by the priests, as in the sin-offering.

and the two kidneys and the fat that is on them which is by the flanks, and the caul that is above the liver, with the kidneys; it shall he take away. 

— with the kidneys, it shall he take away; all the fat before mentioned, together with the kidneys, were to be taken away from the ram of the trespass offering, and burnt.

And the priest shall burn them upon the altar for an offering made by fire unto the Lord: it is a trespass offering. — and the priest shall burn; these fat pieces he shall burn, as in the case of the sin offering and peace offering.

Every male among the priests shall eat thereof. It shall be eaten in the holy place; it is most holy. — every male among the priests shall eat of the flesh;

— after the fat was taken off and burnt, the rest belonged to the priests and their sons, and to them only, leaving their wives and daughters who would be bewildered.

As the sin offering is, so is the trespass offering; there is one law for them: the priest who maketh atonement therewith shall have it. — the priest that maketh atonement therewith shall have it; who by offering it made atonement for the trespass of the person that brings it.

And the priest who offereth any man’s burnt offering, even the priest shall have to himself the skin of the burnt offering which he hath offered. — the priest shall have to himself the skin; as the skin was the only part not consumed by the fire, in the case of the burnt offering, it fell to the share of the officiating priest.

And all the meat offering that is baked in the oven, and all that is dressed in the frying pan and in the pan, shall be the priest’s who offereth it. — shall be the priest’s; with the exception of the memorial part, which was burnt upon the altar.

10 And every meat offering mingled with oil, or dry, shall all the sons of Aaron have, one as much as another. — shall all the sons of Aaron have; that is, whether with or without oil, the remainder of this kind of raw offering is to be equally shared by all the priests.

11 “‘And this is the law of the sacrifice of peace offerings which he shall offer unto the Lord: — the Peace-Offering may be brought for any of three reasons:

— a. for thanksgiving (Leviticus 7:12), to commemorate deliverance from sickness or danger; b. in fulfilment of a vow (Leviticus 7:16); c. as a freewill offering (Leviticus 7:16) when the heart is moved by the remembrance of God’s kindness and mercies.

12 If he offer it for a thanksgiving, then he shall offer with the sacrifice of thanksgiving unleavened cakes mingled with oil, and unleavened wafers anointed with oil, and cakes mingled with oil of fine flour, fried. 

13 Besides the cakes, he shall offer for his offering leavened bread with the sacrifice of thanksgiving of his peace offerings.

14 And of it he shall offer one out of the whole oblation for a heave offering unto the Lord, and it shall be the priest’s who sprinkleth the blood of the peace offerings. 

— and it shall be the priest’s that sprinkleth the blood of the peace offerings; that is, that part of the cakes and bread, which is offered as an heave offering to the Lord, was the portion of the priests.

15 And the flesh of the sacrifice of his peace offerings for thanksgiving shall be eaten the same day that it is offered; he shall not leave any of it until the morning. 

— shall be eaten the same day that it is offered; partly by him that brought them; and what about his family? Wives and daughters?

16 But if the sacrifice of his offering be a vow or a voluntary offering, it shall be eaten the same day that he offereth his sacrifice; and on the morrow also the remainder of it shall be eaten. 

— and on the morrow also the remainder of it shall be eaten; some of it, if thought fit, might be kept till the day after the sacrifice, but no longer.

17 But the remainder of the flesh of the sacrifice on the third day shall be burned with fire. — shall be burnt with fire; that it might neither corrupt, nor be put to superstitious uses, nor be of any profit in any respect.

18 And if any of the flesh of the sacrifice of his peace offerings is eaten at all on the third day, it shall not be accepted, neither shall it be imputed unto him that offereth it; it shall be an abomination, and the soul that eateth of it shall bear his iniquity. 

— it shall be an abomination; to God, the flesh being kept so long, through a sordid and stubborn disposition: and the soul that eateth of it shall bear his iniquity; it shall not be forgiven him; he shall bear the punishment of it.

19 “‘And the flesh that toucheth any unclean thing shall not be eaten; it shall be burned with fire; and as for the flesh, all who are clean shall eat thereof. — and the flesh that toucheth any unclean thing shall not be eaten; that is, the flesh of the peace offerings.

20 But the soul that eateth of the flesh of the sacrifice of peace offerings that pertain unto the Lord, having his uncleanness upon him, even that soul shall be cut off from his people. 

— even that soul shall be cut off from his people; be disfranchised as an Israelite, be debarred the privileges of the sanctuary, or be cut off by death before the usual time and term of man’s life.

21 Moreover the soul that shall touch any unclean thing, as the uncleanness of man or any unclean beast or any abominable unclean thing, and eat of the flesh of the sacrifice of peace offerings which pertain unto the Lord, even that soul shall be cut off from his people.’”

22 And the Lord spoke unto Moses, saying,

23 “Speak unto the children of Israel, saying, ‘Ye shall eat no manner of fat, of ox or of sheep or of goat. — of ox, or of sheep, or of goats: creatures used in sacrifice;

— though this is not to be restrained to such of them, and the fat of them that were sacrificed, whose fat was claimed by the Lord as his, and was burnt on his altar.

24 And the fat of the beast that dieth of itself and the fat of that which is torn by beasts may be used in any other use, but ye shall in no wise eat of it. — and the fat of the beast that dieth of itself; of any disease, and is not regularly killed: and the fat of that which is torn with beasts.

25 For whosoever eateth the fat of the beast of which men offer an offering made by fire unto the Lord, even the soul that eateth it shall be cut off from his people. — even the soul that eateth it shall be cut off from his people; if he did it presumptuously he incurred the penalty of excision.

26 Moreover ye shall eat no manner of blood in any of your dwellings, whether it be of fowl or of beast.

27 Whatsoever soul it be that eateth any manner of blood, even that soul shall be cut off from his people.’”

28 And the Lord spoke unto Moses, saying,

29 “Speak unto the children of Israel, saying, ‘He that offereth the sacrifice of his peace offerings unto the Lord shall bring his oblation unto the Lord from the sacrifice of his peace offerings.

30 His own hands shall bring the offerings of the Lord made by fire; the fat with the breast it shall he bring, that the breast may be waved as a wave offering before the Lord. — his own hands shall bring; this act the owner himself was to perform, and it was not to be deputed to any one else.

31 And the priest shall burn the fat upon the altar, but the breast shall be Aaron’s and his sons’. — but the breast shall be Aaron’s and his sons; which being waved before the Lord for a wave offering, was the Lord’s, and so was given to his priests to eat of, for the service done by them.

32 And the right shoulder shall ye give unto the priest for a heave offering of the sacrifices of your peace offerings. — and the right shoulder shall ye give unto the priest for an heave offering; whether of an ox or a cow, a lamb or a goat.

33 He among the sons of Aaron who offereth the blood of the peace offerings and the fat, shall have the right shoulder for his part. — shall have the right shoulder for his part; that the right shoulder was given to him that sprinkled the blood, and the breast to all the priests;

34 For the wave breast and the heave shoulder have I taken from the children of Israel from the sacrifices of their peace offerings, and have given them unto Aaron the priest and unto his sons by a statute for ever, from among the children of Israel.’”

35 This is the portion of the anointing of Aaron and of the anointing of his sons out of the offerings to the Lord made by fire, on the day when he presented them to minister unto the Lord in the priest’s office, — this is the portion of the anointing of Aaron; of his being anointed to the priestly office.

36 which the Lord commanded to be given them by the children of Israel on the day that He anointed them, by a statute for ever throughout their generations. — in the day that he anointed them; or from the day they were anointed of Moses, by the direction of the Lord;

37 This is the law of the burnt offering, of the meat offering, and of the sin offering, and of the trespass offering, and of the consecrations, and of the sacrifice of the peace offerings, 

38 which the Lord commanded Moses on Mount Sinai on the day that He commanded the children of Israel to offer their oblations unto the Lord in the Wilderness of Sinai.

Leviticus 8

1 And the Lord spoke unto Moses, saying,

“Take Aaron and his sons with him, and the garments, and the anointing oil, and a bullock for the sin offering, and two rams, and a basket of unleavened bread; 

and gather thou all the congregation together unto the door of the tabernacle of the congregation.”

And Moses did as the Lord commanded him, and the assembly was gathered together unto the door of the tabernacle of the congregation.

And Moses said unto the congregation: “This is the thing which the Lord commanded to be done.”

And Moses brought Aaron and his sons, and washed them with water. — and washed them with water; to show that they should be clean that bear the vessels of the Lord, and offer the sacrifices of the people.

And he put upon him the coat, and girded him with the girdle, and clothed him with the robe, and put the ephod upon him, and he girded him with the woven girdle of the ephod, and bound it unto him therewith.

And he put the breastplate upon him. Also he put in the breastplate the Urim and the Thummim. — also he put in the breastplate the Urim and Thummim: that is, Moses did it, as all the rest.

And he put the miter upon his head. Also upon the miter, even upon the front thereof, did he put the golden plate, the holy crown, as the Lord commanded Moses.

10 And Moses took the anointing oil and anointed the tabernacle and all that was therein, and sanctified them. — and sanctified them; that is, by this action Moses separated them from the laity, and dedicated them to the service of God, so that they were not to come in contact with any defilement.

11 And he sprinkled thereof upon the altar seven times, and anointed the altar and all his vessels, both the laver and his foot, to sanctify them.

12 And he poured of the anointing oil upon Aaron’s head and anointed him, to sanctify him.

13 And Moses brought Aaron’s sons and put coats upon them, and girded them with girdles, and put headdresses upon them, as the Lord commanded Moses. 

— and Moses brought Aaron’s sons; having consecrated the father as high priest, Moses now invests Aaron’s four sons, Nadab, Abihu, Eleazar and Ithamar, with the visible signs of the priestly office by robing them in the sacerdotal garments.

14 And he brought the bullock for the sin offering; and Aaron and his sons laid their hands upon the head of the bullock for the sin offering. — and Aaron and his sons laid their hands upon the head of the bullock for the sin offering; their right hands, according to the Targum of Jonathan.

15 And he slew it; and Moses took the blood, and put it upon the horns of the altar round about with his finger and purified the altar, and poured the blood at the bottom of the altar and sanctified it, to make reconciliation upon it. 

— and he slew it; in ordinary cases the offerer himself slaughtered the victim but in the case Moses performed this act;

— the Targum of Jonathan says

“And Moses slaughtered the bull, and Moses took the blood and placed it upon the horns of the altar all around with his finger; and he purified the altar from any doubt of compulsion or robbery.

“For he thought in his heart: Perhaps the officers of the children of Israel took the contributions from their brothers by force and brought them to the work of the Tabernacle? Or perhaps there was someone among the children of Israel who did not have the heart to bring [a donation] for the work, but heard the voice of the herald and was afraid, and so brought it against his will?

“For this reason, he purified it with the blood of the bull; and the rest of the blood he poured at the foundation of the altar and sanctified it to make atonement upon it.”

16 And he took all the fat that was upon the inwards, and the caul above the liver, and the two kidneys, and their fat, and Moses burned it upon the altar. — and Moses took all the acts here.

17 But the bullock and his hide, his flesh, and his dung he burned with fire outside the camp, as the Lord commanded Moses. 

18 And he brought the ram for the burnt offering; and Aaron and his sons laid their hands upon the head of the ram. — and Moses acting like the officiating priest.

19 And he killed it; and Moses sprinkled the blood upon the altar round about.

20 And he cut the ram into pieces; and Moses burned the head and the pieces and the fat. — and Moses burnt the head, and the pieces, and the fat; even all of it, as the following verse shows.

21 And he washed the inwards and the legs in water; and Moses burned the whole ram upon the altar. It was a burnt sacrifice for a sweet savor, and an offering made by fire unto the Lord, as the Lord commanded Moses. 

22 And he brought the other ram, the ram of consecration; and Aaron and his sons laid their hands upon the head of the ram. — and he brought the other ram; that is, the second of the two rams mentioned in Leviticus 8:2.

23 And he slew it; and Moses took of the blood of it and put it upon the tip of Aaron’s right ear and upon the thumb of his right hand and upon the great toe of his right foot. 

24 And he brought Aaron’s sons, and Moses put of the blood upon the tip of their right ear and upon the thumbs of their right hands and upon the great toes of their right feet; and Moses sprinkled the blood upon the altar round about. 

25 And he took the fat, and the rump, and all the fat that was upon the inwards, and the caul above the liver, and the two kidneys and their fat, and the right shoulder; 

26 and out of the basket of unleavened bread that was before the Lord he took one unleavened cake and a cake of oiled bread and one wafer, and put them on the fat and upon the right shoulder. 

27 And he put all upon Aaron’s hands and upon his sons’ hands, and waved them for a wave offering before the Lord. 

28 And Moses took them from their hands and burned them on the altar upon the burnt offering. They were consecrations for a sweet savor; it is an offering made by fire unto the Lord. 

— they were consecrated for a sweet savour; acceptable to the Lord, and so the priests, Aaron and his sons likewise, on whose account they were made.

29 And Moses took the breast and waved it for a wave offering before the Lord; for of the ram of consecration, it was Moses’ part, as the Lord commanded Moses. — for the ram of consecration it was Moses’s part; the breast of it was also his.

30 And Moses took of the anointing oil and of the blood which was upon the altar, and sprinkled it upon Aaron and upon his garments, and upon his sons and upon his sons’ garments with him, and sanctified Aaron and his garments, and his sons and his sons’ garments with him. 

— to Aaron and upon his sons, Moses was acting like the officiating priest.

31 And Moses said unto Aaron and to his sons, “Boil the flesh at the door of the tabernacle of the congregation, and there eat it with the bread that is in the basket of consecrations, as I commanded, saying, ‘Aaron and his sons shall eat it.’ 

— ‘Aaron and his sons shall eat it because this is holy: no layman or non-priest could partake of the meal; but what about Aaron’s wife and daughters?

32 And that which remaineth of the flesh and of the bread shall ye burn with fire. — ye, that is, Aaron and his sons.

33 And ye shall not go out of the door of the tabernacle of the congregation for seven days, until the days of your consecration are at an end; for seven days shall He consecrate you. 

— and ye shall not go out of the door of the tabernacle; that is, Aaron and his sons are not to go out of the court, as the consecration was not performed within but at the entrance of the tent of meeting.

34 As He hath done this day, so the Lord hath commanded to do, to make an atonement for you. — to make an atonement for you, of the day of atonement; and say, that the high priest was obliged to be separate (from his own house and family) seven days.

35 Therefore shall ye abide at the door of the tabernacle of the congregation day and night seven days, and keep the charge of the Lord, that ye die not; for so I am commanded.” 

— during the seven days of their consecration; and the penalty being death in case of failure, but are there twashroom near the Temple? But they have to be careful and cautious of transgressing; and which was the more necessary;

— for so I am commanded; that is, to declare unto them, that if they did not punctually observe the above orders, they must expect to die.

36 So Aaron and his sons did all things which the Lord commanded by the hand of Moses. — after all these preliminaries, they had still to undergo a week’s probation in the court of the tabernacle before they obtained permission to enter into the interior of the sacred building for their official duties.

Leviticus (5-6)

•May 18, 2026 • Leave a Comment

Note the Five types of Offerings in Leviticus:

Leviticus 1:2 “Speak unto the children of Israel and say unto them: ‘If any man of you bring an offering unto the Lord

Leviticus 1:3 ‘If his offering be a burnt sacrifice
Leviticus 2:1 ‘And when any will offer a meat offering
Leviticus 3:1 ‘And if his oblation be a sacrifice of peace offering
Leviticus 4:3 ‘If the priest … a young bullock … for a sin offering
Leviticus 5:6 ‘And he shall bring his trespass offering

Compare to the Five types of Offerings during the Millennium in Ezekiel:

Ezekiel 46:12 ‘Now when the prince prepares a voluntary burnt offering, or peace offerings unto the Lord
Ezekiel 44:29 ‘They shall eat the meat offering and the sin offering and the trespass offering

Leviticus 5

1 “‘And if a soul sin and hear the voice of swearing, and is a witness, whether he hath seen or known of it, if he does not utter it, then he shall bear his iniquity.

— swearing; the case appears to be that of one who has been put upon his oath as a witness by a magistrate, and fails to utter all he has seen and heard.

Or if a soul touch any unclean thing, whether it be a carcass of an unclean beast, or a carcass of unclean cattle, or the carcass of unclean creeping things, and if it be hidden from him, he also shall be unclean and guilty.

— of unclean cattle; cattle are normally clean; became unclean perhaps by being worshipped as an idols by any of the heathens.

Or if he touch the uncleanness of man, whatsoever uncleanness it be, that a man shall be defiled thereby, and it be hid from him, when he knoweth of it, then he shall be guilty. — if he touch the uncleanness of man; the dead body of a man, or the bone of a dead body, or a grave, or any profluvious person.

Or if a soul swear, pronouncing with his lips to do evil or to do good, whatsoever it be that a man shall pronounce with an oath, and it be hid from him, when he knoweth of it, then he shall be guilty in one of these.

— if a soul swear; a rash oath, without duly considering the nature and consequences of the oath, perhaps inconsiderately binding himself to do anything wrong, or neglecting to perform a vow to do something good. In all such cases a person might have transgressed one of the commandments unwittingly, and have been afterwards brought to a sense of his delinquency.

And it shall be, when he shall be guilty in one of these things, that he shall confess that he hath sinned in that thing; — it shall be, when he shall be guilty; that he shall confess that he hath sinned in that thing; make a voluntary acknowledgment of his sin from his own conscience, and before it come to the knowledge of the world. 

and he shall bring his trespass offering unto the Lord for his sin which he hath sinned, a female from the flock, a lamb or a kid of the goats for a sin offering; and the priest shall make an atonement for him concerning his sin.

— he shall bring his trespass offering unto the Lord for his sins which he hath sinned; a trespass offering differed from a sin offering in the following respects: that it was appointed for persons who had either done evil unwittingly, or were in doubt as to their own criminality;

— MSG

3 “Or if you touch human uncleanness, any sort of ritually contaminating uncleanness, and you’re not aware of it at the time, but later you realize it and you’re guilty;

4 “Or if you impulsively swear to do something, whether good or bad—some rash oath that just pops out—and you aren’t aware of what you’ve done at the time, but later you come to realize it and you’re guilty in any of these cases;

5-6 “When you are guilty, immediately confess the sin that you’ve committed and bring as your penalty to God for the sin you have committed a female lamb or goat from the flock for an Absolution-Offering.

“In this way, the priest will make atonement for your sin.

“‘And if he is not able to bring a lamb, then he shall bring for his trespass, which he hath committed, two turtledoves or two young pigeons unto the Lord: one for a sin offering and the other for a burnt offering.

— one for a sin offering, and the other for a burnt offering; one of the turtle doves or pigeons, whichsoever were brought, was offered up as a sin offering, and the other that remained was offered up as a burnt offering;

— so that the poor man had two sorts of offerings out of what he brought, when the rich had but one; and may indicate the completeness of his sacrifice, and the full atonement made by it.

And he shall bring them unto the priest, who shall offer that which is for the sin offering first, and wring off his head from his neck, but shall not divide it asunder.

And he shall sprinkle of the blood of the sin offering upon the side of the altar, and the rest of the blood shall be wrung out at the bottom of the altar: it is a sin offering.

— and he shall sprinkle; here again there is a striking difference between the ritual in the sacrifice and that in the case of the sin offering described in the previous chapters; the blood is simply to be thrown on the walls of the altar, whilst in the ordinary sin offering, the priest had not only to dip his finger seven times in the blood of the sacrifice, but had to put it on the horns of the altar.

10 And he shall offer the second for a burnt offering according to the ordinance; and the priest shall make an atonement for him for his sin which he hath sinned, and it shall be forgiven him. — a trespass offering differed from a sin offering in that it was appointed for persons who had either done evil unwittingly, or were in doubt as to their own criminality.

11 “‘But if he is not able to bring two turtledoves or two young pigeons, then he that sinned shall bring for his offering a tenth part of an ephah of fine flour for a sin offering. He shall put no oil upon it, neither shall he put any frankincense thereon, for it is a sin offering.

— the trespass offering appointed in such cases was a female lamb or kid; if unable to make such an offering, he might bring a pair of turtledoves or two young pigeons; the one to be offered for a sin offering, the other for a burnt offering; or if even that was beyond his ability, the law would be satisfied with the tenth part of an ephah of fine flour without oil or frankincense.

12 Then shall he bring it to the priest and the priest shall take his handful of it, even a memorial thereof, and burn it on the altar according to the offerings made by fire unto the Lord: it is a sin offering.

13 And the priest shall make an atonement for him for his sin that he hath sinned in one of these, and it shall be forgiven him; and the remnant shall be the priest’s as a meat offering.’”

14 And the Lord spoke unto Moses, saying,

15 “If a soul commit a trespass and sin through ignorance in the holy things of the Lord, then he shall bring for his trespass unto the Lord a ram without blemish out of the flocks, with thy valuation in shekels of silver according to the shekel of the sanctuary, for a trespass offering.

— and sin through ignorance; if at the time of its committal he did not know that it was a transgression;

16 And he shall make amends for the harm that he hath done in the holy thing, and shall add a fifth part thereto and give it unto the priest; and the priest shall make an atonement for him with the ram of the trespass offering, and it shall be forgiven him.

— and shall add the fifth part thereto; besides paying the principal, the fifth part of the value of the holy property thus restored is to be added to the original amount; for example, if he has had profited to the value of four shekels, now he should pay five shekels; for the fifth of the shekels they add the fifth part to the four shekels;

17 “And if a soul sin, and commit any of these things which are forbidden to be done by the commandments of the Lord, though he knew it not, yet is he guilty and shall bear his iniquity. — yet he is guilty, and shall bear the iniquity; be chargeable with guilt, and is liable to punishment, and must make an atonement and satisfaction for it.

18 And he shall bring a ram without blemish out of the flock, according to thy valuation for a trespass offering unto the priest; and the priest shall make an atonement for him concerning his ignorance wherein he erred and knew it not, and it shall be forgiven him.

— in the case of the trespass-offering, the animal sacrificed was usually a ram, this fact alone clearly distinguishes the trespass-offerings from the sin-offerings, for which all kinds of sacrifices were offered from an ox to a pigeon.

19 It is a trespass offering; he hath certainly trespassed against the Lord.” — it is a trespass offering; that is, though the prescribed fifth part is here dispensed with, it is still a trespass offering, for his conscience tells him that he has trespassed against the Lord.

Leviticus 6

1 And the Lord spoke unto Moses, saying,

“If a soul sin and commit a trespass against the Lord by lying unto his neighbor about that which was delivered to him to keep, or in dealings, or in a thing taken away by violence, or hath deceived his neighbor,

— or in a thing taken away by violence: without the will and knowledge of the owner; privately and secretly, but being suspected, is challenged with it, and denying it, is made to swear, which he does falsely;

or has found that which was lost and lieth concerning it, and sweareth falsely — in any of all these that a man doeth, sinning therein, — in any of all these that a man doeth, sinning therein; by unfaithfulness in a trust, cheating, defrauding, lying, and false swearing.

then it shall be, because he hath sinned and is guilty, that he shall restore that which he took violently away, or the thing which he hath deceitfully gotten, or that which was delivered him to keep, or the lost thing which he found,

— or the thing which he hath deceitfully gotten; by outwitting him, by extortion, by false accusation, or detention of wages;

or all that about which he hath sworn falsely. He shall even restore the principal thereof, and shall add a fifth part more thereto, and give it unto him to whom it appertaineth, on the day of his trespassoffering.

And he shall bring his trespass offering unto the Lord, a ram without blemish out of the flock, according to thy valuation, for a trespass offering, unto the priest.

— he shall even restore it in the principal; whatsoever he has embezzled, or cheated another of, or detained from the right owner, the whole of that was to be restored: and shall add the fifth part more thereto; to the principal.

And the priest shall make an atonement for him before the Lord; and it shall be forgiven him for any thing of all that he hath done in trespassing therein.” — and the priest shall make an atonement for him before the Lord; by offering the ram he brought, by which a typical, for atonement to be presented before the Lord.

And the Lord spoke unto Moses, saying,

“Command Aaron and his sons, saying, ‘This is the law of the burnt offering: It is the burnt offering because of the burning upon the altar all night unto the morning, and the fire of the altar shall be burning in it.

— command Aaron and his sons; having instructed the people concerning the sacrifices to be brought by them, Moses now proceeds, at God’s command, to direct the priests respecting several parts of their official services;

— better, “This, the burnt-offering, shall be upon the fire on the altar all night unto the morning,” the meaning is, the evening burnt-offering was to be so managed and laid on piece after piece, so that the fire might be constantly maintained by it; that the morning burnt-offerings were to be kept burning all the day from morning to night also.

10 And the priest shall put on his linen garment, and his linen breeches shall he put upon his flesh, and take up the ashes which the fire hath consumed with the burnt offering on the altar; and he shall put them beside the altar.

— he shall put them beside the altar; during the second Temple, a priest was appointed by lot to take off from the altar every morning at least a shovelful of ashes and carry it outside the camp, and when the ashes accumulated they were entirely removed to the same place.

11 And he shall take off his garments and put on other garments, and carry forth the ashes outside the camp unto a clean place.

— and he shall put off his garments; that is, the priest shall change the sacred robes in which he ministered at the altar; for other garments, though less holy, were not common, since the removing of the ashes was still a sacerdotal function.

12 And the fire upon the altar shall be burning in it; it shall not be put out. And the priest shall burn wood on it every morning and lay the burnt offering in order upon it; and he shall burn thereon the fat of the peace offerings. — the wood for the burnt-offering of the morning is kindled from the fire which has been kept in all night.

13 The fire shall ever be burning upon the altar; it shall never go out. — the fire shall ever be burning; this fire, which first came down from heaven (Leviticus 9:24), was to be continually fed with fuel especially provided by the congregation, and with the daily burnt offerings.

14 “‘And this is the law of the meat offering: The sons of Aaron shall offer it before the Lord, before the altar. — the sons of Aaron shall offer it; though in the chapter before us it literally means Aaron’s sons, the phrase is intended to comprise his lineal descendants who succeeded to the priestly office.

15 And he shall take from it his handful of the flour of the meat offering, and of the oil thereof and all the frankincense which is upon the meat offering, and shall burn it upon the altar for a sweet savor, even the memorial of it unto the Lord.

16 And the remainder thereof shall Aaron and his sons eat. With unleavened bread shall it be eaten in the holy place; in the court of the tabernacle of the congregation they shall eat it. — the males only might eat these, because they were most holy things; whereas the daughters of Aaron might eat other holy things, Numbers 18:11.

17 It shall not be baked with leaven. I have given it unto them for their portion of My offerings made by fire; it is most holy, as is the sin offering and as the trespass offering.

— be regarded as “most holy” and the way in which it was prepared was: on any meat offerings being presented, the priest carried them to the altar, and taking a handful from each of them as an oblation, he salted and burnt it on the altar; the residue became the property of the priests.

18 All the males among the children of Aaron shall eat of it. It shall be a statute for ever in your generations concerning the offerings of the Lord made by fire. Every one who toucheth them shall be holy.’”

— every one that toucheth them shall be holy; that is; the meaning is that any one who touches the sacrifices of the first order of holiness must be a descendant of Aaron and a male.

19 And the Lord spoke unto Moses, saying,

20 “This is the offering of Aaron and of his sons, which they shall offer unto the Lord in the day when he is anointed: a tenth part of an ephah of fine flour for a perpetual meat offering, half of it in the morning and half thereof at night.

— in the day when he is anointed; that is, when he is anointed or when his anointing ceremony is completed, and he entered upon the duties of his office.

21 In a pan it shall be made with oil; and when it is baked thou shalt bring it in, and the baked pieces of the meat offering shalt thou offer for a sweet savor unto the Lord.

— as a new law, with a special formula, and is inserted here in its proper place in the sacrificial instructions given for the priests, as it would have been altogether out of place among the general laws for the laity.

22 And the priest from among his sons, who is anointed in his stead, shall offer it. It is a statute for ever unto the Lord; it shall be wholly burned.

— and the priest of his sons; that is, any one of his descendants who succeeds to the high priesthood is to do the same in all times to come, since it is a statute to last as long as the priesthood continues;

— it shall be wholly burnt; unlike the ordinary meat offerings brought by the laity, which, with the exception of a handful, was the perquisite of the officiating priest (Lev 2:2-3), the high priest could not eat of this because he presented it himself,

— since it would be unseemly both to offer it to God and at the same time eat it himself; nor was an ordinary priest allowed to eat it, because he was subordinate in rank to the officiating high priest.

23 For every meat offering for the priest shall be wholly burned; it shall not be eaten.” — it shall not be eaten; no part of it shall be eaten by the priest, as it was when the offering was for the people.

24 And the Lord spoke unto Moses, saying,

25 “Speak unto Aaron and to his sons, saying, ‘This is the law of the sin offering: In the place where the burnt offering is killed shall the sin offering be killed before the Lord; it is most holy.

— it is most holy; sacred to the Lord, offered up to him, and accepted by him, and typical of the most pure and holy sacrifice and an offering for sin, in the room and stead of his people.

26 The priest who offereth it for sin shall eat it; in the holy place shall it be eaten, in the court of the tabernacle of the congregation. — the priest that offereth it for sin shall eat it; thereby signifying that he bore the sin of the person that brought the offering, and made atonement for it.

27 Whatsoever shall touch the flesh thereof shall be holy; and when there is sprinkled of the blood thereof upon any garment, thou shalt wash that whereon it was sprinkled in the holy place.

— whatsoever shall touch the flesh thereof shall be holy; none but holy persons, such as were devoted to holy services, even the priests and their sons, might touch and eat of the flesh of the sin offering.

28 But the earthen vessel wherein it is boiled shall be broken; and if it is boiled in a brazen pot, it shall be both scoured and rinsed in water.

— all that did so were sacred persons; and even what were the earthen vessel used in preparing and eating it, dishes and knives, were to be put to no other use, not to any common service, or for anything but holy things.

29 All the males among the priests shall eat thereof; it is most holy. — all the males among the priests; ot only did the officiating priest, whose perquisite the flesh of the sin offering became, and his male children, partake of it, and he could invite any other priests and their sons to the meal; but leaving their daughters a bit bewildered.

30 And no sin offering, from which any of the blood is brought into the tabernacle of the congregation for reconcilement thereby in the holy place, shall be eaten: it shall be burned in the fire. — it shall be burnt in the fire; none was to be eaten.

What are the percentages of each currency in global trade?

•May 18, 2026 • Leave a Comment

According to the latest data from the Bank for International Settlements (BIS) Triennial Survey and SWIFT data trackers, the US dollar maintains a massive, asymmetric dominance over both fields.

1. Global Foreign Exchange (FX) Market Share

The FX market handles an astonishing $9.6 trillion per day. In this metric, the percentages sum up to 200% because every single foreign exchange transaction requires two currencies (e.g., swapping USD for EUR).

2. Actual Global Trade Settlement (SWIFT Invoicing)

If you strip away speculative trading, investment flows, and central bank reserve management, the picture changes slightly when looking strictly at commercial trade invoicing—paying for cross-border goods like machinery, electronics, and food.

According to the SWIFT Global Currency Tracker, the breakdown of actual cross-border settlement values is roughly:

  • US Dollar (USD): ~47% to 54% The ultimate “vehicle currency.” Even if a Brazilian merchant sells coffee to a South Korean roaster, they will usually price and settle the invoice in US dollars because it has the deepest liquidity and lowest conversion fees. Furthermore, global commodities like crude oil and gold are priced exclusively in USD.
  • Euro (EUR): ~22% to 24% The Euro strongly dominates intra-European trade. Because Europe trades intensely within its own border-free economic bloc, the Euro easily locks down the number two spot.
  • Chinese Renminbi (CNY / Yuan): ~4.5% to 5.2% The Chinese Yuan has seen the fastest structural growth of any currency over the last several years. Driven by Beijing’s alternative cross-border infrastructure (CIPS) and expanding trade networks in Asia, the Middle East, and commodity markets, its share of global trade settlements has steadily climbed, though strict domestic capital controls prevent it from overtaking the Euro or Dollar.
  • British Pound (GBP): ~3.5% to 4.2% Remains incredibly relevant due to London’s status as a premier global clearing hub for legal, financial, and insurance contracts.
  • Japanese Yen (JPY): ~1.5% to 2.2% Mainly utilized for trade directly touching Japanese manufacturing exports or heavy regional Asian corporate supply chains.
  • All Other Currencies combined: ~15% This encompasses the Canadian Dollar, Australian Dollar, Swiss Franc, and dozens of emerging market currencies (like the Indian Rupee or Mexican Peso) that are heavily utilized within their own localized borders but rarely used as a generic intermediary tool by third-party countries.

The overwhelming majority of global trade still relies on the SWIFT (Society for Worldwide Interbank Financial Telecommunication) network. However, geopolitical friction and the weaponization of Western financial sanctions have accelerated the growth of parallel networks.

Roughly 10% to 15% of global trade value now takes place partially or entirely outside the primary SWIFT framework.

This non-SWIFT architecture is not a unified system, but a fragmented landscape composed of isolated nations, emerging digital ledgers, and regional sovereign networks.


1. The True Scale of Non-SWIFT Infrastructure

The push to bypass SWIFT is led predominantly by China and Russia, alongside nations seeking to insulate themselves from US dollar-denominated sanctions.

  • China’s CIPS (Cross-Border Interbank Payment System): CIPS is the most successful alternative, handling over $24 trillion in transaction volume annually. While impressive, its overall share of global trade settlements sits at roughly 4.5% to 5.2%. Furthermore, CIPS is not completely independent; it still relies on SWIFT’s messaging rails for over 80% of its international communications.
  • Russia’s SPFS (System for Transfer of Financial Messages): Developed after Russia was disconnected from SWIFT, SPFS handles nearly all of Russia’s domestic financial traffic and connects to about 24 allied nations.
  • The Russia-China Corridor: This is the most glaring example of a completely closed, non-SWIFT loop. Up to 90% of bilateral trade between China and Russia is settled directly in Yuan and Rubles via SPFS and CIPS, bypassing Western banking entirely.

2. The Rise of “De-Dollarized” Trade Contracts

A significant portion of trade bypasses SWIFT because the underlying currency is no longer the US dollar. When countries trade using local currencies, they often use direct, bilateral central bank mechanisms instead of the traditional global clearinghouses:

  • India and Russia: Settling oil shipments in Indian Rupees or UAE Dirhams.
  • China and Saudi Arabia: Initiating crude oil trades settled in Chinese Yuan.
  • Sanctioned Trade Blocks: It is estimated that 60% to 70% of Russia’s total foreign trade agreements now operate in alternative financial structures explicitly insulated from Western influence.

3. Emerging Alternatives: CBDCs and Stablecoins

The newest leak in the SWIFT ecosystem comes from digital financial engineering. Rather than just changing the message system, these networks change the railroad itself.

Project mBridge

A highly watched initiative run by the Bank for International Settlements alongside the central banks of China, Thailand, the UAE, Saudi Arabia, and Hong Kong. It utilizes a multi-central bank digital currency (CBDC) platform.

  • How it bypasses SWIFT: Instead of routing a payment through correspondent banks in New York or London over several days, mBridge allows a bank in the UAE to trade directly with a bank in China using digital tokens. The transaction completes in seconds without interacting with SWIFT or the US banking system.

Commodity Stablecoins

A small but growing fraction of international trade—particularly in sanctioned or gray-market commodities like Venezuelan oil or Iranian infrastructure components—is settled using private stablecoins like Tether (USDT). These transactions bypass the banking sector entirely, moving directly from one digital wallet to another across public blockchains.


The Structural Reality

While the alternative ecosystem is growing rapidly, SWIFT remains an entrenched utility, connecting more than 11,500 financial institutions across 200+ countries.

The 10% to 15% of trade occurring outside of it represents a “firewall” being built by the BRICS bloc and sanctioned states. They are not yet trying to destroy SWIFT; they are ensuring that if they are cut off from the global grid, their domestic economies can continue to breathe.

To figure out exactly how much global trade is being paid through China’s CIPS (Cross-Border Interbank Payment System), we have to look closely at a common point of confusion: the difference between a country’s domestic currency usage and its global market share.

CIPS has experienced massive, record-breaking growth recently, but its overall share of total global trade remains a single-digit percentage.

Here is exactly how the numbers break down:

1. The Global Percentage Share: ~4% to 5.5%

When measuring all global trade invoices and cross-border commercial settlements, CIPS processes roughly 4% to 5.5% of the global total value.

While this sounds small, it represents a monumental structural shift. A few years ago, the Renminbi (Yuan) accounted for less than 2% of global trade settlements. Driven heavily by the de-dollarization efforts of the BRICS bloc, expanding bilateral trade agreements, and energy commodities being priced in Yuan (the “Petroyuan”), it has securely locked itself into the number three spot globally, trailing only the US Dollar and the Euro.

2. The Raw Volume: ~$26.4 Trillion Annually

Instead of looking at percentages, looking at the absolute volume reveals CIPS’s massive scale.

  • In 2024, CIPS processed roughly 175.5 trillion yuan (~$24.4 trillion).
  • In 2025, that volume expanded to 180.2 trillion yuan (roughly $26.4 trillion USD).
  • The Recent Surge: In early 2026, geopolitical friction in the Middle East and renewed tariff/sanction threats pushed CIPS to all-time highs. In March 2026, the system shattered its single-day record, processing 1.22 trillion yuan ($178.5 billion) in a single 24-hour window.

3. The China Centric Reality: >54% of Internal Trade

Where CIPS is truly dominant is within China’s own border walls. For the first time, more than 54% of China’s own cross-border transactions are settled in Yuan through CIPS rather than in US dollars.

If a country is trading directly with China—whether it is Brazil selling soybeans, Russia selling oil, or African nations exporting minerals—there is a greater than 50% chance that payment is routing natively through CIPS.


The CIPS vs. SWIFT Reality Check

Despite internet narratives about the immediate “death of the dollar,” CIPS is not currently structured to completely destroy SWIFT. There are two primary technical reasons why:

  • The Footprint Disparity: SWIFT connects over 11,500 financial institutions across 200+ countries. By comparison, CIPS has roughly 193 direct participants (mostly major global clearing banks) and 1,573 indirect participants.
  • The “Invisible” Interdependence: CIPS is primarily a clearing and settlement engine (it physically moves the money), whereas SWIFT is a messaging network (it securely sends the instructions). Because CIPS does not have a completely pervasive global communication network yet, CIPS actually relies on SWIFT messaging infrastructure to execute roughly 80% of its transactions.

Right now, rather than a total replacement, CIPS functions as a highly successful “parallel rail.” It handles the vast majority of Russia-China bilateral trade, an increasing chunk of global energy deals, and serves as an ironclad financial insurance policy for nations looking to insulate themselves from Western financial sanctions.

Leviticus (3-4)

•May 17, 2026 • Leave a Comment
~~ Peace and Burnt Offerings ~~

Leviticus 3

1 “‘And if his oblation be a sacrifice of peace offering, if he offer it of the herd, whether it be a male or female, he shall offer it without blemish before the Lord. 

— a sacrifice of peace offering; which consists of two kinds, the peace offering from the herd (Leviticus 3:1-5), and the peace offering from the flock (Leviticus 3:6-15);

— as in the case of the burnt offering (Leviticus 1:3), the ox is mentioned first, because it is most costly and more important; whether it be a male; whilst in the case of the burnt offering (Leviticus 1:3,10) only the male was allowed, there is no distinction of sex here, nor of age; it should be without any defect;

— they were called peace-offering, because in them God and his people did, as it were, feast together to ireflect prosperity and happiness generally, in token of friendship, offered by way of supplication; and “thank-offering” is sometimes used as another class of peace-offering.

And he shall lay his hand upon the head of his offering, and kill it at the door of the tabernacle of the congregation; and Aaron’s sons the priests shall sprinkle the blood upon the altar round about. 

— not on the north side of the altar, where the burnt-offering was killed, as also the sin-offering, and the trespass-offering, but in the very entrance of the court where the brazen altar stood;

— and Aaron’s sons the priests shall sprinkle the blood upon the altar round about; in like manner as the blood of the burnt offering was.

And he shall offer from the sacrifice of the peace offering an offering made by fire unto the Lord: the fat that covereth the inwards and all the fat that is upon the inwards,

and the two kidneys and the fat that is on them which is by the flanks, and the caul above the liver, with the kidneys — it shall he take away. 

And Aaron’s sons shall burn it on the altar upon the burnt sacrifice, which is upon the wood that is on the fire: it is an offering made by fire, of a sweet savor unto the Lord. 

— and Aaron’s sons; after the offerer has killed the victim, taken out the choice parts and offered them to the officiating priest, the latter shall burn it, that is, the whole collection of the fat pieces, upon the ashes of the continual burnt offering, which was the daily offering of the lamb.

“‘And if his offering for a sacrifice of peace offering unto the Lord be of the flock, male or female, he shall offer it without blemish. — of the flock; that is, of sheep or goats; they might be either male or female, provided only that they were without any defect; to give to God means to give the best.

If he offer a lamb for his offering, then shall he offer it before the Lord. — if he offer a lamb for his offering; which was of the flock, it must be of the first year; this is a principle that whereever this word is used in the law, it signifies one of the first year.

And he shall lay his hand upon the head of his offering and kill it before the tabernacle of the congregation; and Aaron’s sons shall sprinkle the blood thereof round about upon the altar. — and he, the man that brought the offering, shall lay his hand upon the head of the lamb.

And he shall offer from the sacrifice of the peace offering an offering made by fire unto the Lord; the fat thereof and the whole rump, it shall he take off hard by the backbone: and the fat that covereth the inwards and all the fat that is upon the inwards,

10 and the two kidneys and the fat that is upon them which is by the flanks, and the caul above the liver, with the kidneys — it shall he take away. — as in verse 4 above, livers and kidneys are always taken away; but why?

11 And the priest shall burn it upon the altar: it is the food of the offering made by fire unto the Lord. 

12 “‘And if his offering be a goat, then he shall offer it before the Lord. — and if his offering be a goat; the directions about the goat as a peace offering are the same as those about an ox.

13 And he shall lay his hand upon the head of it and kill it before the tabernacle of the congregation; and the sons of Aaron shall sprinkle the blood thereof upon the altar round about. 

14 And he shall offer thereof his offering, even an offering made by fire unto the Lord: the fat that covereth the inwards and all the fat that is upon the inwards, 

15 and the two kidneys and the fat that is upon them which is by the flanks, and the caul above the liver, with the kidneys — it shall he take away. 

— as in verse 4 and 10 above, livers and kidneys are always taken away; but why? Maybe they were considered as delicacies, and God wants them to be returned so that the families of the offerers could enjoy in the celebration?

16 And the priest shall burn them upon the altar: it is the food of the offering made by fire for a sweet savor; all the fat is the Lord’S. 

17 It shall be a perpetual statute for your generations throughout all your dwellings, that ye eat neither fat nor blood.’” 

— that is, the law not to eat the fat or blood of sheep or goats, is to be binding upon the Israelites throughout all their future generations, and is applicable to any place wherever they may dwell.

‘If a soul shall sin through ignorance against any of the commandments

Leviticus 4

1 And the Lord spoke unto Moses, saying,

“Speak unto the children of Israel, saying, ‘If a soul shall sin through ignorance against any of the commandments of the Lord concerning things which ought not to be done, and shall do against any of them, 

— sin through ignorance; the next kind of sacrifices are therefore called sin-offerings; the first sort of these were for sins of ignorance;

— and shall do against any of them; it must be something done, and not merely said: hence the Jews say, that as the neglect of circumcision, and of the Passover, does not come under this exemption, because they ought to know;

— but what about if a man lies with a woman forbidden by the law, thinking her to be his wife; or that commits idolatry, by bowing to the idol, thinking that the law only forbids sacrifice, incense, and libation, but not bowing; or that profanes the Sabbath, thinking it is still before evening on Friday.

if the priest who is anointed shall sin, bringing the sin upon the people, then let him bring for his sin which he hath sinned a young bullock without blemish unto the Lord for a sin offering. 

— even the chief priest could be a frail being, and often does, like the rest of the people; or to which he was liable as they; or “to make the people guilty” as it could be read; “so that the people sin” or “making the people to sin.”

And he shall bring the bullock unto the door of the tabernacle of the congregation before the Lord, and shall lay his hand upon the bullock’s head and kill the bullock before the Lord. 

— and the priest shall bring the bullock; that is, the high priest himself; it is evident that God never had any infallible priest in his service upon the earth.

And the priest who is anointed shall take of the bullock’s blood and bring it to the tabernacle of the congregation; 

— and bring it to the tabernacle of the congregation; out of the court where the bullock was slain, into the holy place, where were the veil that divided between the holy of holies, and the altar of sweet incense;

and the priest shall dip his finger in the blood and sprinkle of the blood seven times before the Lord, before the veil of the sanctuary. — the treatment of the blood was special in this sin-offerings; the high priest himself sprinkled the blood seven times within the tabernacle and smeared it on the horns of the altar of incense;

— seven times; a number of completeness; and prescribed here, either to show that his sins needed more than ordinary purgation, and more exercise of his efforts and repentance; before the veil; the inner veil dividing between the holy place and the holy of holies;

— whereas the other ‘inferior’ sin-offerings, it was smeared on the horns of the altar of burnt-offering outside the tabernacle; Leviticus 4:25, Leviticus 4:30, Leviticus 4:34; and no mention of sprinkling of the blood seven times.

And the priest shall put some of the blood upon the horns of the altar of sweet incense before the Lord, which is in the tabernacle of the congregation, and shall pour all the blood of the bullock at the bottom of the altar of the burnt offering, which is at the door of the tabernacle of the congregation. 

— and the priest shall put; that is, the high priest.

And he shall take off from it all the fat of the bullock for the sin offering: the fat that covereth the inwards and all the fat that is upon the inwards, 

and the two kidneys and the fat that is upon them which is by the flanks, and the caul above the liver, with the kidneys — it shall he take away;

10 as it was taken off from the bullock of the sacrifice of peace offerings; and the priest shall burn them upon the altar of the burnt offering. — the priest was to lift off “all the fat” from the sacrifice, that is, the same fat portions as in the peace-offering, and burn it upon the altar of burnt-offering.

11 And the skin of the bullock and all his flesh, with his head, and with his legs, and his inwards, and his dung” — The skin of the bullock, and all the flesh, together with the head and the shank and the entrails (Leviticus 1:9) and the dung;

— in fact the whole bullock, was to be carried out by him (the sacrificing priest) to a clean place before the camp, to which the ashes of the sacrifices were carried from the ash-heap (Leviticus 1:16), and there burnt on the wood with fire;

12 even the whole bullock shall he carry forth outside the camp unto a clean place, where the ashes are poured out, and burn him on the wood with fire; where the ashes are poured out shall he be burned. — outside the camp; during the Second Temple this place is outside Jerusalem, called the place of ashes.

13 “‘And if the whole congregation of Israel sin through ignorance, and the thing be hid from the eyes of the assembly, and they have done something against any of the commandments of the Lord concerning things which should not be done, and are guilty,

14 when the sin which they have sinned is known, then the congregation shall offer a young bullock for the sin, and bring him before the tabernacle of the congregation.

15 And the elders of the congregation shall lay their hands upon the head of the bullock before the Lord; and the bullock shall be killed before the Lord. — the elders of the congregation represent the whole congregation.

16 And the priest who is anointed shall bring of the bullock’s blood to the tabernacle of the congregation; 

17 and the priest shall dip his finger in some of the blood and sprinkle it seven times before the Lord, even before the veil. 

— the treatment of the blood is again special in this sin-offerings; the high priest shall sprinkle the blood seven times within the tabernacle before the veil and smear it on the horns of the altar of incense.

18 And he shall put some of the blood upon the horns of the altar which is before the Lord, that is in the tabernacle of the congregation, and shall pour out all the blood at the bottom of the altar of the burnt offering, which is at the door of the tabernacle of the congregation. 

19 And he shall take all his fat from him and burn it upon the altar.

20 And he shall do with the bullock as he did with the bullock for a sin offering; so shall he do with this. And the priest shall make an atonement for them, and it shall be forgiven them.

21 And he shall carry forth the bullock outside the camp and burn him as he burned the first bullock: it is a sin offering for the congregation. — and the priest that is anointed shall bring of the bullock’s blood; that is, the high priest, as the Targums of Jonathan explain it:

— again, outside the camp; during the Second Temple this place is outside Jerusalem, called the place of ashes.

22 “‘When a ruler hath sinned, and done something through ignorance against any of the commandments of the Lord his God concerning things which should not be done, and is guilty, — when a ruler hath sinned, that is, the king, judge, or subordinate, was the party concerned in this sin;

23 or if his sin wherein he hath sinned come to his knowledge, he shall bring his offering, a kid of the goats, a male without blemish. — he shall bring his offering, a kid of the goats, a male without blemish; his offering was to be a “kid of the goats.”

24 And he shall lay his hand upon the head of the goat, and kill it in the place where they kill the burnt offering before the Lord: it is a sin offering.

25 And the priest shall take of the blood of the sin offering with his finger, and put it upon the horns of the altar of burnt offering, and shall pour out his blood at the bottom of the altar of burnt offering. — the priest shall sprinkle the blood; but no mention of seven times.

26 And he shall burn all his fat upon the altar, as the fat of the sacrifice of peace offerings; and the priest shall make an atonement for him concerning his sin, and it shall be forgiven him.

27 “‘And if any one of the common people sin through ignorance while he doeth something against any of the commandments of the Lord concerning things which ought not to be done, and be guilty,

28 or if his sin which he hath sinned come to his knowledge, then he shall bring his offering, a kid of the goats, a female without blemish, for his sin which he hath sinned.

29 And he shall lay his hand upon the head of the sin offering, and slay the sin offering in the place of the burnt offering. 

30 And the priest shall take of the blood thereof with his finger, and put it upon the horns of the altar of burnt offering, and shall pour out all the blood thereof at the bottom of the altar. — the priest shall put the blood upon the horns of the altar; but no mention of any sprinking of blood.

31 And he shall take away all the fat thereof, as the fat is taken away from off the sacrifice of peace offerings, and the priest shall burn it upon the altar for a sweet savor unto the Lord; and the priest shall make an atonement for him, and it shall be forgiven him. 

32 “‘And if he bring a lamb for a sin offering, he shall bring it a female without blemish. — and if he bring a lamb; those who were unable to bring a goat might offer a female sheep as the less valuable animal, provided it was without blemish.

33 And he shall lay his hand upon the head of the sin offering, and slay it for a sin offering in the place where they kill the burnt offering.

34 And the priest shall take of the blood of the sin offering with his finger, and put it upon the horns of the altar of burnt offering, and shall pour out all the blood thereof at the bottom of the altar. 

35 And he shall take away all the fat thereof, as the fat of the lamb is taken away from the sacrifice of the peace offerings, and the priest shall burn them upon the altar, according to the offerings made by fire unto the Lord; and the priest shall make an atonement for his sin that he hath committed, and it shall be forgiven him.

Leviticus (1-2)

•May 16, 2026 • Leave a Comment

The Targum Jonathan provides a good preamble to the book of Leviticus:

And it was when Moses had completed to erect the tabernacle that Moses reasoned and judged in his heart, and said:

“To Mount Sinai, whose excellency is the excellence only of an hour and its holiness the holiness but of three days, I could not ascend till the time that the word was spoken to me; but the excellence of this the tabernacle of ordinance is an eternal excellency, and its holiness an everlasting holiness; therefore is it right that I should not enter within it until the time that I am spoken with from before the Lord.”

“If his offering a burnt sacrifice of the herd, let him offer a male without blemish”

Leviticus 1

1 And the Lord called unto Moses, and spoke unto him out of the tabernacle of the congregation, saying, — when the Lord first communicated to Moses that He was about to deliver the Israelites from Egypt, “He called unto him” from the burning bush (Exodus 3:4);

— when the Lord was about to give to Moses the Ten Commandments for the people of Israel, “He called unto him” from the top of Sinai (Exodus 19:3; Exodus 19:20);

— and now when the Lord is about to give to His chosen people, through His servant Moses, the laws by which their Divine worship is to be regulated, “He called unto him” from the tent of meeting (Leviticus 1:1).

“Speak unto the children of Israel and say unto them: ‘If any man of you bring an offering unto the Lord, ye shall bring your offering of the cattle, even of the herd and of the flock.

— the act of offering was to be voluntary on the part of the worshipper, but the mode of doing it was in every point defined by the Law; and any member of the congregation might bring his voluntary offering if he could afford.

“‘If his offering be a burnt sacrifice of the herd, let him offer a male without blemish. He shall offer it of his own voluntary will at the door of the tabernacle of the congregation before the Lord. — without blemish; or perfect, having no part wanting, nor any part superfluous, nor any spot upon it.

And he shall put his hand upon the head of the burnt offering, and it shall be accepted for him to make atonement for him. — and he, the offer of the offering, shall put his hand upon the head of the burnt offering to make atonement for him;

— the high priest, Aaron, would be more concerned with other duties: another daily ‘burnt offering’ stands first in Leviticus for several reasons; it was offered twice daily, besides on other occasions.

And he shall kill the bullock before the Lord; and the priests, Aaron’s sons, shall bring the blood and sprinkle the blood round about upon the altar that is by the door of the tabernacle of the congregation.

— and he shall kill the bullock; the sacrificer himself, the offerer, not by the priest, slaughtered the animal on the north side of the altar, by cutting its throat, while a priest or an assistant held a bowl under the neck to receive the blood;

— in later times, however, the offering was generally performed by Levites; sprinkle the blood; this was to be done by the priests, by Aaron’s sons initially. 

And he shall flay the burnt offering and cut it into his pieces.

And the sons of Aaron the priest shall put fire upon the altar, and lay the wood in order upon the fire.

And the priests, Aaron’s sons, shall lay the parts, the head, and the fat in order upon the wood that is on the fire which is upon the altar;

but his inwards and his legs shall he wash in water. And the priest shall burn all on the altar to be a burnt sacrifice, an offering made by fire, of a sweet savor unto the Lord. — a sweet savour, or a soothing odour; the word ‘savour’ in old English is applied to the smell as well as the taste of a thing.

10 “‘And if his offering be of the flocks, namely, of the sheep or of the goats, for a burnt sacrifice, he shall bring a male without blemish.

— those who could not offer a bullock, were to bring a sheep or a goat; and those who were not able to do that, were accepted of God, if they brought a turtle-dove, or a pigeon.

If they are poor they could bring a turtle-dove or a pigeon, or a pair

11 And he shall kill it on the side of the altar northward before the Lord; and the priests, Aaron’s sons, shall sprinkle his blood round about upon the altar.

12 And he shall cut it into his pieces, with his head and his fat; and the priest shall lay them in order on the wood that is on the fire which is upon the altar,

13 but he shall wash the inwards and the legs with water. And the priest shall bring it all and burn it upon the altar: it is a burnt sacrifice, an offering made by fire, of a sweet savor unto the Lord.

14 “‘And if the burnt sacrifice for his offering to the Lord be of fowls, then he shall bring his offering of turtledoves or of young pigeons.

— those who could not offer a bullock or a sheep or a goat; they are to bring turtle-doves or pigeons; a single pigeon or turtle-dove formed a sacrifice, but they are often offered in pairs; and there are no rule in respect to sex.

15 And the priest shall bring it unto the altar, and wring off his head, and burn it on the altar; and the blood thereof shall be wrung out at the side of the altar.

16 And he shall pluck away his crop with his feathers, and cast it beside the altar on the east part, by the place of the ashes.

17 And he shall cleave it with the wings thereof, but shall not divide it asunder. And the priest shall burn it upon the altar, upon the wood that is upon the fire: it is a burnt sacrifice, an offering made by fire, of a sweet savor unto the Lord.

Leviticus 2

1 “‘And when any will offer a meat offering unto the Lord, his offering shall be of fine flour; and he shall pour oil upon it and put frankincense thereon. — the old use of the word “meat” in the sense of “food,” in contrast to “flesh,” creates some confusion of thought;

— to make a sweet odour in the court of the tabernacle, on a part of it; which otherwise would have been bad odour, by reason of the blood that was sprinkled and the flesh that was burned there daily;

— second; and put frankincense thereon; various spices: stacte, onycha and galbanum; these sweet spices with pure frankincense; are holy to the Lord, and to be used for him only; Exodus 30:34.

And he shall bring it to Aaron’s sons the priests; and he shall take from it his handful of the flour thereof and of the oil thereof, with all the frankincense thereof; and the priest shall burn the memorial of it upon the altar to be an offering made by fire, of a sweet savor unto the Lord.

— and he, the offer of the food offering, shall bring it to Aaron’s sons the priests; the high priest, Aaron, would be more concerned with other duties: involves in daily ‘burnt offering’ which was offered twice everyday;

— a sweet savour, or a soothing odour; the word ‘savour’ in old English is applied to the smell as well as the taste of the food.

Incense: stacte, onycha, galbanum; these spices with pure frankincense

And the remnant of the meat offering shall be Aaron’s and his sons’: it is a thing most holy of the offerings to the Lord made by fire. — a offering most holy; offerings consisted of two classes, the (just) holy and the most holy;

— the wave offerings (Leviticus 23:20; Numbers 6:20), the firstborn of sacrificed animals, the firstlings of oil, wine, and corn, (Numbers 18:17); and the paschal sacrifices, belonged to the holy, and might be eaten entirely or partially in any place within the holy city by the officiating priests and their families;

— the incense offering, the shew-bread (Exodus 30:26-29; Leviticus 24:9), the sin and trespass offerings (Leviticus 6:25-29; Leviticus 7:1; Leviticus 7:6; Leviticus 14:13), and the meat offerings here described, belonged to the most holy. They could be eaten in the court of the sanctuary only by the priests, (Leviticus 10:12-14).

“‘And if thou bring an oblation of a meat offering baked in the oven, it shall be unleavened cakes of fine flour mingled with oil, or unleavened wafers anointed with oil.

And if thy oblation be a meat offering baked in a pan, it shall be of fine flour, unleavened, mingled with oil.

Thou shalt part it in pieces and pour oil thereon: it is a meat offering.

And if thy oblation be a meat offering baked in the frying pan, it shall be made of fine flour with oil.

And thou shalt bring the meat offering that is made of these things unto the Lord; and when it is presented unto the priest, he shall bring it unto the altar.

And the priest shall take from the meat offering a memorial thereof and shall burn it upon the altar: it is an offering made by fire, of a sweet savor unto the Lord.

10 And that which is left of the meat offering shall be Aaron’s and his sons’: it is a thing most holy of the offerings of the Lord made by fire. — the term meat was and is properly given to any kind of provision, and the greater part of this offering was to be eaten for food, not burned; they of the most holy.

11 “‘No meat offering which ye shall bring unto the Lord shall be made with leaven; for ye shall burn no leaven nor any honey in any offering of the Lord made by fire. — leaven, in this instance, is the emblem of pride, malice, and hypocrisy, and honey of sensual pleasure.

12 As for the oblation of the firstfruits, ye shall offer them unto the Lord, but they shall not be burned on the altar for a sweet savor. — but if with bread they could be with leaven, Jonathan.

13 And every oblation of thy meat offering shalt thou season with salt; neither shalt thou allow the salt of the covenant of thy God to be lacking from thy meat offering. With all thine offerings thou shalt offer salt. — with all thine offerings thou shalt offer salt; every animal offering was to be accompanied by salt;

— salt was used in meat offerings, and in all others, because it was a symbol of the perpetuity of the covenant, which from thence is called a covenant of salt forever, Numbers 18:19 namely, the covenant of the priesthood, to which these sacrifices belonged;

— hence the Targum of Jonathan says, “because the twenty and four gifts of the priests are appointed with a covenant of salt; therefore salt shalt thou offer with all thy oblations.”

14 And if thou offer a meat offering of thy firstfruits unto the Lord, thou shalt offer for the meat offering of thy firstfruits green ears of corn dried by the fire, even corn beaten out of full ears.

15 And thou shalt put oil upon it and lay frankincense thereon: it is a meat offering.

16 And the priest shall burn the memorial of it, part of the beaten corn thereof and part of the oil thereof, with all the frankincense thereof: it is an offering made by fire unto the Lord.

— every independent meat-offering was to be prepared without leaven, and a portion given to the Lord as fire-food, for a savour of satisfaction upon the altar; and the rest was to be scrupulously kept away from being used by the offerer, as a most holy thing, and to be eaten at the holy place by the priests only;

— it is unfortunate that while the law was given the children of Israel were travelling throught the desert for the next thirty-nine years or so, with their main food, the manna, and only offerings of animal sacrifices could be offered;

— they could not practice the first-fruit offerings; but the law was provided here when the crossed the Jordan and became settled cultivators.

Iran imposes rules in Strait of Hormuz

•May 15, 2026 • Leave a Comment
Iran’s Revolutionary Guards navy has unveiled a new map to control the Strait of Hormuz. Would President Trump send in Ground Troops?

Iran to impose strict passage rules in Strait of Hormuz with a new map

  • The newly defined area stretches westward from the westernmost tip of Iran’s Qeshm Island to the United Arab Emirates’ Umm al Quwain emirate.
  • In the east, it extends from Iran’s Mount Mobarak to the UAE’s Emirate of Fujairah, a critical pathway for global oil shipments.

CNN • May 12, 2026 ~ Gulf News

Iran is moving to formalise control over the Strait of Hormuz with new legislation requiring all vessels to obtain permission, imposing tolls, and banning ships from adversary states.

The law, part of the ‘Strait of Hormuz Security Plan,’ comes amid a US-led naval blockade and heightened tensions following the US-Israel-Iran war. The move threatens to further disrupt global oil and gas flows through the strategic waterway.

Would somewhere around Tehran be the Battle of Waterloo for President Trump?

Iran formalises control over key oil route through parliament

Iranian lawmakers are advancing the ‘Strait of Hormuz Security Plan,’ a law mandating prior authorisation for all vessels, banning Israeli ships outright, and demanding war reparations from ‘enemy states.’

Fees will be collected in multiple currencies, with future payments in Iranian rials via digital systems. Officials say the measure, once passed, will be binding and enforced by both the IRGC and the national army across nearly 2,000 km of coastline.

“At present, Iran’s Islamic Revolution Guard Corps in the west and the country’s army in the east are controlling the strait with power, and no ship, friend or foe, will have the right to pass without the permission and authorization of our forces.”

Before the US and Israeli campaign against Iran began at the end of February, the strait was free for any vessel of any origin to navigate. But since the conflict began, Iran has threatened to strike any ship passing through Hormuz without permission from the Islamic Revolutionary Guard Corps (IRGC) navy.

A number of vessels have come under attack, but the vast majority of ship owners and operators have opted not to take the risk of sending their vessels through in defiance of Iran.

The move to set up an authority for the strait underscores Iran’s determination to cement control over what it sees as a spoil of war, despite repeated US and regional warnings.

Trapped in a snare, President Trump to send in half a million Ground Troops?

Dominance of the waterway, through which one-fifth of the world’s oil and liquefied natural gas flows, would hand the Islamic Republic immense leverage over its neighbors and the global economy.

“Payments to the government of Iran or the Islamic Revolutionary Guard Corps (IRGC), directly or indirectly, for safe passage through the Strait of Hormuz would not be authorized for US persons, including US financial institutions, or for US-owned or -controlled foreign entities,” it said.

Iran has previously said it would deny passage through the waterway to vessels linked to the US or Israel, while other vessels may only transit with Iranian consent. India and Pakistan are among governments that have negotiated with Iran to secure passage of their flagged vessels.

“There is growing evidence that Iran may seek to retain strategic control of the strait for as long as possible. At the same time, the US may tolerate this outcome,” according to Matt Wright at Kpler, a marine intelligence firm.

US officials have repeatedly said they wouldn’t accept Iranian control of the chokepoint.

Wright estimates that should Tehran be able to control the waterway, transits would not exceed half of the pre-war average, with profound consequences for the global oil and gas markets.

“Under a long-term Iranian control scenario, transits could rise to 40-50% of export capacity, but normalization is not achievable,” Wright added.

And lastly, who is Iran in biblical prophercies? Iran is a new name for ancient Persia. It was an empire ruling over a vast region 2700 years ago; but who are the lost house of Israel? For a detailed insight of the Lost Ten Tribes, we can dig deep into Ephraim and Manasseh:

Who are the posterity of biblical Jacob? And on the identities of Ephraim and Manasseh, see (1) The Irony of a Birthright (2) Ephraim preferred over Manasseh (3) Ephraim as the Thirteenth Tribe (4) Who is this lying Ephraim? (5) The Ox with horns of a Unicorn

A Prophecy against Iran

•May 15, 2026 • Leave a Comment

Iran is home to one of the world’s oldest continuous major civilizations, with historical and urban settlements dating back to 4000 years ago. To understand a prophecy about Iran, we first need to know who Iran is.

In ancient times, Iran was called Persia before 1935, with its ancient Capital cities at Susa (or Shushan) and Persepolis; and even further back, it was known as Elam, the first son of Shem, the firstborn of Noah.

By right, Elam, the firstborn, should have the birthright, but the line went through Arphaxad. How Elam lost that birthright wasn’t spelt out. So we are left to speculate a bit.

The Achaemenid Empire, or the First Persian Empire, after uniting all the Persian tribes and the Medes under Cyrus the Great, at its greatest extent

Here are a few Scriptures about Elam and Persia, ancient names referring to what is now modern-day Iran, along with some prophecies.

In the Past

“You yourself are the head of gold. In your place another kingdom shall arise, inferior to you [in power and authority], that is silver; … which shall have authority in all the earth.” Daniel 2:38–39

“And behold, another animal, a second one like a she-bear; one part was set up, and three ribs were in her mouth between her teeth. Thus they [the teeth] were saying to her [the beast], ‘Rise! Devour huge amounts of flesh.’” Daniel 7:5

A bear was the second beast Daniel saw emerge out of the Great Sea in great commotion. This is the Medo-Persian Empire that succeeded the Babylonian empire. This is reflective of Iran in the near future. He had three ribs in his mouth.

Daniel chapter 8. The second beast is identified in Daniel 8:20. There it is given two horns as well, and it is called Media and Persia.

Jeremiah 49:34-39

34 The word of the Lord that came to Jeremiah the prophet against Elam, in the beginning of the reign of Zedekiah king of Judah, saying,

— the word of the Lord that came unto Jeremiah the prophet against Elam; the Persians, as it is commonly understood, who descended from Elam the son of Shem, Genesis 10:22;

— according to Josephus; but rather the country of Elymais is here designed; which though in the times of Cyrus was added to and made a part of the Persian empire, yet was a country distinct both from Persia and Media; and as though as near unto Persia and bordering on Media, a country that belonged to the Assyrians; and so it seems that Elam served under Sennacherib, king of Assyria, when he besieged Jerusalem;

— the Targum of Jonathan says

“The word of prophecy that was from before the Lord with Jeremiah the prophet concerning Elam, at the beginning of the kingdom of Zedekiah, king of the tribe of the House of Judah, saying:”

35 “Thus saith the Lord of hosts: “‘Behold, I will break the bow of Elam, the chief of their might. — thus the Lord of hosts will break the bow of Elam; the inhabitants of this country were famous for their skill in archery;

— in which their great strength lay; in which they put their trust and confidence; the chief of their might; this the Lord threatens to break so that it should be useless and of no more service to them to defend themselves or annoy others; their strength;

— or may design their mighty men, the archers themselves, who should be destroyed, even Elam itself, and all their inhabitants especially their warriors, who should be slain or carried captive;

— the Targum of Jonathan says

“Thus says the Lord of Hosts: ‘Behold, I am breaking the strength of Elam, the beginning (or chief part) of their might.'”

36 And upon Elam will I bring the four winds from the four quarters of heaven, and will scatter them toward all those winds; and there shall be no nation whither the outcasts of Elam shall not come.

— and upon Elam will I bring the four winds from the four quarters of heaven; the Targum interprets it the four kingdoms; see Daniel 7:2. Some think this had its accomplishment in the times of Alexander; or else after his death in the times of his four successors;

— in the context of the current regional tensions involving the IRGC and Operation Epic Fury, this verse is often highlighted by analysts who track “Elam” as a biblical proxy for modern-day Iran; as God will scatter them towards all those winds; those four winds, east, west, north and south;

— the Targum of Jonathan says

“And I will bring against Elam four kingdoms from the four winds of the heavens, and I will scatter them to all these winds; and there shall be no nation where the outcasts of Elam shall not go.”

37 For I will cause Elam to be dismayed before their enemies and before them that seek their life; and I will bring evil upon them, even My fierce anger,’ saith the Lord; ‘and I will send the sword after them till I have consumed them.

— for I will cause Elam to be dismayed before their enemies; frightened; thrown into the utmost consternation so that they shall have no heart nor spirit to go out against them and meet them and defend themselves; but make all haste imaginable to flee from them, such a panic would seize them;

— and before them that seek their life; a further description of their enemies; they being such, who, not content with their substance sought to take away their lives; nothing less would satisfy them; being cruel and blood thirsty:

— and I will bring evil upon them even my fierce anger, saith the Lord; and a greater evil than that cannot be; signifying that the destruction that should be made among them would be the effect of the wrath of God upon them for their sins:

— and I will send the sword after them till I have consumed them; that is, those that slay with the sword, as the Targum says; these should go after those that fled and destroy them till the greater part of them were consumed; for all of them that were taken were not destroyed;

— the Targum of Jonathan says

“And I will shatter Elam before their enemies and before those who seek to kill them; and I will bring evil upon them, the strength of My anger, says the Lord; and I will stir up against them those who kill with the sword, until I have destroyed them.”

38 And I will set My throne in Elam, and will destroy from thence the king and the princes,’ saith the Lord. — my throne in Elam; this is a throne belonging to God, because God gave it to him; his dominian over Elam, and Elam’s authority over it, were from God;

— the best explanation is best understood to be Cyrus, the Lord’s servant and anointed; whose throne might well be a throne given by God. Exploring this concept further, everything on earth belongs to God, everything that are even of God’s enemies, in heaven or on the earth, are God’s;

“Thus saith Cyrus king of Persia: ‘The Lord God of heaven hath given me all the kingdoms of the earth; and He hath charged me to build Him a house at Jerusalem, which is in Judah,” Ezra 1:2

— in biblical and prophetic context, God’s throne is usually associated with the third heaven (Psalm 103:19), Isaiah 66:1) or if on earth, in Jerusalem (Ezekiel 43:7), but for God to “set His throne” in Elam or any foreign land means that God is personally executing his judgment there; as the next phrase backs it up “and I will destroy from thence their king and princes”

— sitting on his ‘throne’ in the Valley of Jehoshaphat (a Final Judgment); the prophet Joel describes a future event where God takes his seat in a specific valley to judge the surrounding nations; “For there I will sit to judge all the surrounding nations,” Joel 3:12

— the Targum of Jonathan says

“And I will set the throne of My kingdom in Elam, and I will destroy from there [their] king and princes, says the Lord.”

39 “‘But it shall come to pass in the latter days, that I will bring back the captives of Elam,’ saith the Lord.” — though that is observed in the first year of his reign, some have thought that it is best to understand it or Cyrus, the Lord’s servant and anointed;

— and whose throne might well be called the throne of God, which he gave him, and set him on in an eminent manner, not only there, but even everywhere;

— the Targum of Jonathan says

“And it shall be at the end of days, I will bring back the exile (captives) of Elam, says the Lord.”

And now into the future:

~~~~

Ezekiel 38

1 And the word of the Lord came unto me, saying,

2 “Son of man, set thy face against Gog, in the land of Magog, the chief prince of Meshech and Tubal, and prophesy against him — Gog1463 גוג (Agag 90אגג) of the land of Magog, is an abbreviated expression for “Gog from the land of Magog;”

— Magog, Meshech and Tubal, these are the sons of Japheth; Gomer, and his son, Togarmah, are mentioned later in verse 6; omitting the Japhetic tribes of Madai, Javan and Tiras; Genesis 10:2), and led by their chief, Gog, Russia; and Gog is acting as their Chief; their Prince;

The sons of Japheth: Gomer, and Magog, and Madai, and Javan, and Tubal, and Meshech, and Tiras. 3And the sons of Gomer: Ashkenaz and Riphath and Togarmah 4And the sons of Javan: Elishah and Tarshish, Kittim and Dodanim. Genesis 10:2-4

— in Revelation 20:8, after the thousand years are over, “Gog and Magog” might be a term adopted by John either as mystical names or symbolic names of rebellious nations against the eminence of those ruling from Jerusalem; or rebelling “against the mountains of Israel” with Jerusalem as its Capital;

3 and say, ‘Thus saith the Lord God: Behold, I am against thee, O Gog, the chief prince of Meshech and Tubal. — Gog is not a name among the sons of Japheth, but designated as from the land of Magog, the chief prince of Meshech and Tubal;

— some from the first opinion identify Moscow as Meshech and Tobolsk as Tubal; a country called Ros; from whence the Russians came;

4 And I will turn thee back and put hooks into thy jaws, and I will bring thee forth and all thine army, horses and horsemen, all of them clothed with all sorts of armor, even a great company with bucklers and shields, all of them handling swords;

— “Gog and Magog” seems to have a evil design for the mountains of Israel, hailing a war cry: “Come, and let us cut them off from being a nation, that the name of Israel may be no more in remembrance,” sounding like a decree from today’s Ayatollah of Iran, hence drawing God’s response;

5 Persia, Ethiopia, and Libya with them, all of them with shield and helmet; — Persia, or Elam (for more, see Jeremiah 49), today’s Iran, these, with Ethiopia, and Libya, are known to be from among the sons or grandsons of Ham (or with a mix with Shem)

— the Targum says,

Persians, Ethiopians (Kushites), and Libyans (Putites) are with them; all of them armed with round shields and helmets.”

~~~

The War against Israel may be added by other nationalities, or overlapped with other nationalities; one of who could be the Edomites, the posterity of Esau, Jacob’s brother.

And more on Esau, from Obadiah 1:20

And the captives of this host of the children of Israel shall possess that of the Canaanites, even unto Zarephath; and the captives of Jerusalem who are in Sepharad (בִּסְפָרַ֑ד Hebrew 5614) shall possess the cities of the south. Obadiah 1:20

And the exiles of this nation of the Children of Israel that is in the land of the Canaanites (shall inherit) until Zerapahath. And the exiles of Jerusalem that are in Ispamiah will inherit the villages of the south land. Obadiah 1:20 (Jonathan)

— Rashi: And this exiled host: Heb. הַחֵל. Jonathan renders: This people. הַחֵל, An expression of a host. Cf. (Isa. 36:2) “And he came to Jerusalem with an army (חֵיל) of a great multitude,” which deals with Rabshakeh, only that this one is missing a “yud.” It is also possible to explain גָלֻת הַחֵל as “the exile of this valley.”

— and the exile of Jerusalem which is in Sepharad: who are of the people of Judah who were exiled to Sepharad – they shall inherit the cities of the southland, which are in the Southern part of Eretz Israel. The exegetes [a person who interprets text, especially the Scriptures] claim that Zarephath is the kingdom called France in French;

— Jonathan renders: Spain (Rashi quoting the Targum: Sepharad shall inherit the cities of the Southland rendering it as Spain); the Targums identified Sepharad with Spain (Ispamia or Ispania), hence, Spanish Jews are called Sephardim;

— Peshitta (Lamsa): The first exiles, that is, of the children of Israel, shall possess the land from Canaan as far as Zarephath; and the exiles of Jerusalem who are in Spain shall possess the cities of the south (hard copy);

— Cambridge Bible for Schools and Colleges: Sepharad is the name of a place; the modern Jews understand it of Spain, and accordingly, “at the present day the Spanish Jews, who form the chief of the two great sections into which the Jewish nation is divided, are called by the Jews themselves the Sephardim, German Jews being known as the Ashkenazim.”

— Geneva Study Bible: by Zarephath, France; and by Sepharad, Spain;

Perhaps, another two-pronged mysterious prophecies about how the posterity of Esau could play a role with a prophecy against Iran are expounded in the book of Ezekiel

(1) Ezekiel 4 – 390/40 Years Timeline
(2) The Flaming Sword and Fire from the South!

Exodus (39-40)

•May 14, 2026 • Leave a Comment

~~~~

~~~~

Exodus 39

1 And of the blue and purple and scarlet they made clothes of service to do service in the holy place, and made the holy garments for Aaron, as the Lord commanded Moses. 

And he made the ephod of gold, blue and purple and scarlet, and finetwined linen. 

And they beat the gold into thin plates, and cut it into wires to work it in the blue and in the purple and in the scarlet and in the fine linen, with skillful work. 

They made shoulder pieces for it to couple it together; by the two edges was it coupled together. 

And the embroidered girdle of his ephod that was upon it was of the same, according to the work thereof: of gold, blue and purple and scarlet, and finetwined linen, as the Lord commanded Moses. 

And they wrought onyx stones enclosed in clasps of gold, graven as signets are graven, with the names of the children of Israel. — the names of the twelve tribes of Israel are not specified here; question remains whether Joseph has two portions? If so who gives way; Dan or Levi?

Question: If Joseph has two portions? If so who gives way; Dan or Levi?

And he put them on the shoulders of the ephod, that they should be stones for a memorial to the children of Israel, as the Lord commanded Moses. 

And he made the breastplate of skillful work, like the work of the ephod: of gold, blue and purple and scarlet, and finetwined linen. 

It was foursquare. They made the breastplate double: a span was the length thereof and a span the breadth thereof, being doubled. 

10 And they set in it four rows of stones: the first row was a sardius, a topaz and a carbuncle; this was the first row; — the Targum Jonathan adds the names of three tribes, Reuben, Shimeon, and Levi and Targum Jerusalem says the same in chapter 28:17 Reuben, Shemeon, Levi;

11 and the second row, an emerald, a sapphire, and a diamond; — there are some differences of opinions from here: the Targum Jonathan adds the names of the three tribes, Jehudah, Dan, and Naphtali; whereas Targum Jerusalem says Jehudah, Issakar, and Zebulon;

12 and the third row, a ligure, an agate, and an amethyst; — the Targum Jonathan adds the names of the three tribes, Gad, Asher, and Issakar; but Targum Jerusalem says Dan, Naphtali, and Gad;

13 and the fourth row, a beryl, an onyx, and a jasper. They were enclosed in clasps of gold in their enclosings. — the Targum Jonathan adds the names of the three tribes, Zebulon, Joseph, and Benjamin; but Targum Jerusalem says Asher, Joseph, and Benjamin;

The tribe of Dan disappears when Joseph is allocated two portions

14 And the stones were according to the names of the children of Israel — twelve, according to their names like the engravings of a signet, every one with his name according to the twelve tribes.

15 And they made upon the breastplate chains at the ends of wreathed work of pure gold. — no mention is made of the Urim and Thummim, perhaps they are incorporated inside or behind the ephod.

The Urim and Thummim, perhaps they are incorporated inside the ephod

16 And they made two clasps of gold and two gold rings, and put the two rings on the two ends of the breastplate. 

17 And they put the two wreathed chains of gold in the two rings on the ends of the breastplate; 

18 and the two ends of the two wreathed chains they fastened in the two clasps, and put them on the shoulder pieces of the ephod at the front. 

19 And they made two rings of gold and put them on the two ends of the breastplate, upon the border of it which was on the side of the ephod inward; 

20 and they made two other golden rings and put them on the two sides of the ephod underneath, toward the front of it over against the other coupling thereof, above the embroidered girdle of the ephod. 

21 And they bound the breastplate by his rings unto the rings of the ephod with a lace of blue, that it might be above the embroidered girdle of the ephod, and that the breastplate might not be loosed from the ephod, as the Lord commanded Moses. 

22 And he made the robe of the ephod of woven work, all of blue. 

23 And there was a hole in the midst of the robe, as the hole of a jacket of mail, with a band round about the hole, that it should not rend. 

24 And they made upon the hems of the robe pomegranates of blue and purple and scarlet, and twined linen. 

25 And they made bells of pure gold, and put the bells between the pomegranates upon the hem of the robe, round about between the pomegranates: 

26 a bell and a pomegranate, a bell and a pomegranate, round about the hem of the robe to minister in, as the Lord commanded Moses. 

— the Targum of Jonathan reveals the quantity needed

“A bell and a pomegranate, a bell and a pomegranate, all seventy-two of them, upon the hem of the robe’s perimeter, all around, to serve [in the Sanctuary], just as the Lord had commanded Moses.”

27 And they made coats of fine linen of woven work for Aaron and for his sons, 

28 and a miter of fine linen and goodly bonnets of fine linen, and linen breeches of finetwined linen, 

29 and a girdle of finetwined linen, and blue and purple and scarlet needlework, as the Lord commanded Moses. 

30 And they made the plate of the holy crown of pure gold, and wrote upon it a writing, like the engravings of a signet: Holiness to the Lord.

31 And they tied unto it a lace of blue to fasten it on high upon the miter, as the Lord commanded Moses.

32 Thus was all the work of the tabernacle of the tent of the congregation finished, and the children of Israel did according to all that the Lord commanded Moses; so did they.

33 And they brought the tabernacle unto Moses: the tent and all his furniture, his clasps, his boards, his bars and his pillars and his sockets; 

— the Targum of Jonathan reveals where their school of learning and instruction is

“And they brought the Tabernacle to Moses, to his House of Study (Beit Midrash); for Moses, Aaron, and his sons were sitting there, and he was explaining to them the order of the Priesthood. And the Elders of Israel were sitting there [as well]. And they showed him the Tabernacle and all its vessels: its clasps, its boards, its bars, its pillars, and its sockets.”

34 and the covering of rams’ skins dyed red, and the covering of badgers’ skins, and the veil of the covering; 

35 the ark of the Testimony and the staves thereof, and the mercy seat; 

36 the table and all the vessels thereof, and the showbread; 

37 the pure candlestick with the lamps thereof, even with the lamps to be set in order, and all the vessels thereof, and the oil for light; 

38 and the golden altar, and the anointing oil, and the sweet incense, and the hanging for the tabernacle door; 

39 the brazen altar and his grate of brass, his staves and all his vessels, the laver and his foot; 

Joseph is allocated two placements but the Levi belongs to the Lord; Ephraim has the standard of the Bull, Manasseh the Unicorn

40 the hangings of the court, his pillars and his sockets, and the hanging for the court gate, his cords and his pegs, and all the vessels of the service of the tabernacle for the tent of the congregation; 

41 the clothes of service to do service in the holy place, and the holy garments for Aaron the priest and his sons’ garments to minister in the priest’s office. 

42 According to all that the Lord commanded Moses, so the children of Israel made all the work. 

43 And Moses looked upon all the work, and behold, they had done it as the Lord had commanded; even so had they done it. And Moses blessed them. 

Exodus 40

~~~~

~~~~

1 And the Lord spoke unto Moses, saying,

“On the first day of the first month shalt thou set up the tabernacle of the tent of the congregation. — the new year was now approaching, and as it was approaching, its first day on the month of Nisan was naturally chosen as most fit for the inauguration of the new structure.

And thou shalt put therein the ark of the Testimony, and cover the ark with the veil. 

And thou shalt bring in the table and set in order the things that are to be set in order upon it; and thou shalt bring in the candlestick and light the lamps thereof. 

And thou shalt set the altar of gold for the incense before the ark of the Testimony, and put up the hanging of the door to the tabernacle. 

And thou shalt set the altar of the burnt offering before the door of the tabernacle of the tent of the congregation. 

And thou shalt set the laver between the tent of the congregation and the altar, and shalt put water therein. 

And thou shalt set up the court round about, and hang up the hanging at the court gate. 

And thou shalt take the anointing oil, and anoint the tabernacle and all that is therein, and shalt hallow it and all the vessels thereof; and it shall be holy. 

10 And thou shalt anoint the altar of the burnt offering and all his vessels, and sanctify the altar; and it shall be an altar most holy. 

11 And thou shalt anoint the laver and his foot, and sanctify it. 

12 And thou shalt bring Aaron and his sons unto the door of the tabernacle of the congregation, and wash them with water. 

13 And thou shalt put upon Aaron the holy garments, and anoint him and sanctify him, that he may minister unto Me in the priest’s office.

14 And thou shalt bring his sons and clothe them with coats; 

15 and thou shalt anoint them, as thou didst anoint their father, that they may minister unto Me in the priest’s office. For their anointing shall surely be an everlasting priesthood throughout their generations.” 

16 Thus did Moses: according to all that the Lord commanded him, so did he. 

17 And it came to pass in the first month in the second year, on the first day of the month, that the tabernacle was reared up. 

18 And Moses reared up the tabernacle, and fastened his sockets and set up the boards thereof, and put in the bars thereof and reared up his pillars. 

19 And he spread abroad the tent over the tabernacle, and put the covering of the tent above upon it, as the Lord commanded Moses. 

20 And he took and put the testimony into the ark, and set the staves on the ark, and put the mercy seat above upon the ark. 

21 And he brought the ark into the tabernacle, and set up the veil of the covering and covered the ark of the Testimony, as the Lord commanded Moses. 

22 And he put the table in the tent of the congregation upon the side of the tabernacle northward, outside the veil. 

23 And he set the bread in order upon it before the Lord, as the Lord had commanded Moses. 

24 And he put the candlestick in the tent of the congregation opposite the table, on the side of the tabernacle southward.

25 And he lighted the lamps before the Lord, as the Lord commanded Moses.

26 And he put the golden altar in the tent of the congregation before the veil;

The golden altar of sweet incense before the veil

27 and he burned sweet incense thereon, as the Lord commanded Moses.

28 And he set up the hanging at the door of the tabernacle. 

29 And he put the altar of burnt offering by the door of the tabernacle of the tent of the congregation, and offered upon it the burnt offering and the meat offering, as the Lord commanded Moses. 

30 And he set the laver between the tent of the congregation and the altar, and put water there for washing. 

31 And Moses and Aaron and his sons washed their hands and their feet thereat. 

32 When they went into the tent of the congregation and when they came near unto the altar, they washed, as the Lord commanded Moses. 

33 And he reared up the court round about the tabernacle and the altar, and set up the hanging of the court gate. So Moses finished the work. 

34 Then a cloud covered the tent of the congregation, and the glory of the Lord filled the tabernacle. 

35 And Moses was not able to enter into the tent of the congregation because the cloud abode thereon, and the glory of the Lord filled the tabernacle. 

36 And when the cloud was taken up from over the tabernacle, the children of Israel went onward in all their journeys; 

37 but if the cloud were not taken up, then they journeyed not until the day that it was taken up. 

38 For the cloud of the Lord was upon the tabernacle by day and fire was on it by night, in the sight of all the house of Israel throughout all their journeys. 

— throughout the book of Exodus the term, “Urim and Thummim” is not used; the earliest encounter is in Lev 8:8: “And he [Moses] put the breastplate upon him [Aaron]. Also he [Moses] put in the breastplate the Urim and the Thummim.” Hence the Urim and the Thummim are incorporated inside the ephod with the breastplate of twelve previous stones.

The Ox with horns of a Unicorn

•May 13, 2026 • Leave a Comment

Who is Ephraim and who is Manasseh? Both should have a significant role to play in our current world affairs, Genesis 48. But both identities are hidden in plain sunlight.

Only One Mystical Animal: the Ox with Horns not of a bull but of a Unicorn

And here, more are revealed: the firstling (strength and fortitude) of the Ox with its horns of a Unicorn

16 Let the blessing come upon the head of Joseph, and upon the top of the head of him that was separated from his brethren.

17 His glory is like the firstling of his ox (bullock), and his horns are like the horns of unicorns. With them he shall push the people together to the ends of the earth; and they are the ten thousands of Ephraim, and they are the thousands of Manasseh,” Deuteronomy 33:16-17.

On closer look, the Ox and the Unicorn as two separate animals is a misconception. First the scene: “the head of Joseph” and upon Joseph’s head is “his glory,” which is like “the firstling of his ox.” Being described as ‘firstling’ means the glory, the spendour, how majectic the Ox is; especially with its horms.

Joseph doesn’t have horns, but the Ox does. And on its horns—those of the Ox—they are described as “like the horns of unicorns.” These horns grow from the Ox and resemble those of unicorns, not of an Ox or a Bull! In other words, there’s only one animal here, the Ox; the unicorn doesn’t exist.

So what does this mean? It means there is only one mystical animal, and the horns are only auxiliaries of the Ox. Strictly speaking, the unicorn doesn’t exist. As Ephraim is known as the Ox, it carries all the horns with it.

That is, all the nations in the Manasseh camp are not truly “sovereign” states or as equals to itself, but rather as US vassals being carried on the shoulder of the United States. Together, they are the Five Eyes, and their nerve center runs through Washington DC, not London. Even the US are known for shouting down the British! (Sputnik)

Enhance lighting, sharpness, natural color balance
The Five Eyes and even the G7 move around together in a pack; its nerve center radiating from the thirteenth tribe, not twelfth

Being far more dominant, Ephraim led the pack! And this applies not just to the house of Joseph but applied equally to the full house of Jacob!

The NOG translates this well: “They will be as majestic as a firstborn bull. Their horns will be like the horns of a wild ox. They will use them to push away nations including those at the ends of the earth. The tens of thousands from the tribe of Ephraim and the thousands from the tribe of Manasseh will be like this.”

Or the Message Bible:

All this on the head of Joseph,
on the brow of the set-apart one among his brothers.
In splendor he’s like a firstborn bull,
his horns the horns of a wild ox;
He’ll gore the nations with those horns,
push them all to the ends of the Earth.

Ephraim by the ten thousands will do this,
Manasseh by the thousands will do this.”
Deuteronomy 33:16-17

That is, not just within the Five Eyes, but Ephraim at virtually every function of the world, would dominate all the other nations of the earth. Witness G7, G8 and even G20, there has always been only one elephant in the room:

“He’ll gore the nations with those horns,
push them all to the ends of the Earth.”

Since Brexit, the UK has followed US policy closer and closer until it is as if the UK is a state and mouthpiece of the United States. Same with Canada and Australia.

Both Australia and New Zealand are treaty allies of the US in the trilateral ANZUS (Australia, New Zealand and the US) Treaty as well as in Five Eyes (FVEY) intelligence alliance, the latter also comprising Canada and the UK.

Enhance lighting, sharpness, natural color
“I know, my son, I know, and he shall also be great; but his younger brother shall be greater than he, and his seed shall become a multitude of nations” Genesis 48:19

“I might be the thirteenth, the latest to arrive, but what a hegemon after I’d arrived!”

Additionally, Australia, the US and the UK also announced a trilateral AUKUS arrangement last September. Under AUKUS, the Royal Australian Navy (RAN) would get access to technology to develop advanced nuclear-powered attack submarines (SSNs).

New Zealand, who used to have a fiercely independent foreign policy, now seems to have allowed herself more and more aligned with the group. Spearheaded by the US, these five nations move around together in a pack; its nerve center radiating from Washington DC, not London.

But eventually, they, together with Joseph’s other brothers, that is, all the twelve tribes, would face a tumultuous time known as the time of Jacob’s Trouble (Jeremiah 30:7).

Alas! for that day is great, so that none is like it. That is, all the combined wars of WWI, WWII, Vietnam and Korea, would pale in comparison!

And before wrapping up this series of Five, and because of its importance, let’s recap the domains of some elements of what it meant to be the Stars of heavens and the Sands of the seashore; that is, from the dogma of Manifest Destiny and the Monroe Doctrine.

(a) Manifest Destiny, the city on a hill mimics the stars in heaven; the idea of American exceptionalism; to let the nations see the great light (Matthew 5:14), the stars of heaven that were promised to Abraham, to light the paths for the Gentiles, so they could similarly see the great way of life from God, his laws, statues and ordinances

“I, the Lord, have called Thee in righteousness, and will hold Thine hand, and will keep Thee, and give Thee for a covenant of the people, for a light to the Gentiles” Isaiah 42:6; or ‘a light to the nations’ (go-yim);

“And He said: ‘It is a light thing that Thou shouldest be My servant to raise up the tribes of Jacob and to restore the preserved of Israel. I will also give Thee for a light to the Gentiles (go-yim), that Thou mayest be My salvation unto the end of the earth’” Isaiah 49:6.

“And if the family of Egypt go not up and come not, upon whom there is no rain, there shall be the plague (leprosy during biblical times, but today, Covid-19, Ebola, Hantavirus? Or a new disease we have not heard before?) wherewith the Lord will smite the nations who come not up to keep the Feast of Tabernacles” Zechariah 14:18.

And here are a few prophecies for their failings to be shinning lights to the world!

“Ephraim shall be desolate in the day of rebuke; among the tribes of Israel have I made known that which shall surely be,” Hosea 5:9
“For I will be unto Ephraim as a lion, and as a young lion to the house of Judah; I, even I, will tear and go away; I will take away, and none shall rescue him,” Hosea 5:14

And referring to the shepherd of Israel, the Scripture says they are blind, ignorant and all like dumb dogs: “His watchmen are blind; they are all ignorant; they are all dumb dogs, they cannot bark, sleeping, lying down, loving to slumber” Isaiah 56:10.

Currently the posterity of both Ephraim and Manasseh, the United States and the United Kingdom, are filthy, pungent and toxic; they’re hypocritical and a disgrace before the nations, and they profaned the name of God wherever they go. They are not yet sanctified; they definitely need to . . .

“You only have I known… therefore I will punish you” Amos 3:2
“The crown of pride, the drunkards of Ephraim, shall be trodden under feet” Isaiah 28:3
“Ephraim shall be desolate in the day of rebuke… ” Hosea 5:9
“And I will cast you out of My sight… even the whole seed of Ephraim” Jeremiah 7:15

Certainly the two-pronged mysterious prophecies about how such sanctification and purification could occur are spelt out in the hidden passage in the book of Ezekiel

(1) Ezekiel 4 – 390/40 Years Timeline
(2) The Flaming Sword and Fire from the South!

And now 13 US Bases in Middle East Destroyed After Iran Missile Strikes. Thirteen bases destroyed! Is this same thirteen a bad omen?

~~~

And lastly, this is the fifth or last in a series on the identities of Ephraim and Manasseh, for others, see (1) The Irony of a Birthright (2) Ephraim preferred over Manasseh (3) Ephraim as the Thirteenth Tribe (4) Who is this lying Ephraim? (5) The Ox with horns of a Unicorn

PFIZER’s SIDE EFFECTS FROM ITS COVID VACCINE!!

•May 13, 2026 • Leave a Comment

PFIZER HAS FINALLY PUBLISHED THE OFFICIAL LIST OF SIDE EFFECTS FROM ITS COVID VACCINE!!

It might be true, it might not, but it was published by Pravda and it’s also spreading across many social media platforms, so it’s a caveat, worth being cautious.

PravdaNews • May 12, 2026

IT’S CRIMINAL!

1) Blood clot 2) Acute kidney injury 3) Acute flaccid myelitis
4) Positive anti-sperm antibodies 5) Brainstem embolism
6) Brainstem thrombosis 7) Cardiac arrest (hundreds of cases)
8) Heart failure 9) Cardiac ventricular thrombosis
10) Cardiogenic shock 11) Central nervous system vasculitis
12) Neonatal death 13) Deep vein thrombosis
14) Brainstem encephalitis 15) Hemorrhagic encephalitis
16) Frontal lobe epilepsy 17) Epileptic psychosis 18) Facial paralysis
19) Fetal distress syndrome 20) Gastrointestinal amyloidosis
21) Generalized tonic-clonic seizure 22) Hashimoto’s encephalopathy
23) Hepatic vascular thrombosis 24) Shingles reactivation
25) Cancer reactivation 26) Turbo cancers
27) Immune-mediated hepatitis 28) Interstitial lung disease
29) Jugular vein embolism 30) Juvenile myoclonic epilepsy
31) Liver damage 32) Low birth weight
34) Multisystem inflammatory syndrome in children 35) Myocarditis
36) Neonatal seizure 37) Pancreatitis 38) Pneumonia 39) Stillbirth
40) Tachycardia 41) Temporal lobe epilepsy
43) Testicular autoimmunity 44) Thrombotic stroke
45) Type 1 diabetes mellitus 46) Neonatal vein thrombosis
47) Vertebral artery thrombosis 48) Pericarditis
49) Sudden infant death syndrome

SEVERE CONSEQUENCES of a so-called vaccine that protects neither against the disease, nor its transmission, nor severe forms!

The Australian government bureaucrats, medical professionals, police and media personalities who were involved in pushing this genocidal death vaccine on millions of Australians should all be arrested and charged with murder!

Exodus (37-38)

•May 12, 2026 • Leave a Comment

Q. Could one unexpected day the Jews bring out the Ark of the Covenant and cause both the Dome of the Rock and the Al-Aqsa Mosque to collapse?

Exodus 37

1 And Bezaleel made the ark of shittim wood. Two cubits and a half was the length of it, and a cubit and a half the breadth of it, and a cubit and a half the height of it. 

And he overlaid it with pure gold within and without, and made a crown of gold for it round about. 

And he cast for it four rings of gold to be set in the four corners of it: even two rings upon the one side of it, and two rings upon the other side of it. 

And he made staves of shittim wood and overlaid them with gold. 

And he put the staves into the rings on the sides of the ark, to bear the ark. 

And he made the mercy seat of pure gold. Two cubits and a half was the length thereof, and one cubit and a half the breadth thereof. 

And he made two cherubims of gold. Beaten out of one piece made he them on the two ends of the mercy seat: 

Two cherubims of pure gold over the Mercy Seat also of pure gold

one cherub on the end on this side, and another cherub on the other end on that side; out of the mercy seat made he the cherubims on the two ends thereof. 

And the cherubims spread out their wings on high, and covered over the mercy seat with their wings with their faces one toward another; even toward the mercy seat were the faces of the cherubims. 

10 And he made the table of shittim wood. Two cubits was the length thereof, and a cubit the breadth thereof, and a cubit and a half the height thereof. 

11 And he overlaid it with pure gold, and made thereunto a crown of gold round about. 

12 Also he made thereunto a border of a handbreadth round about, and made a crown of gold for the border thereof round about. 

13 And he cast for it four rings of gold, and put the rings upon the four corners that were in the four feet thereof. 

14 Over against the border were the rings, the places for the staves to bear the table. 

15 And he made the staves of shittim wood to bear the table, and overlaid them with gold. 

16 And he made the vessels which were upon the table — his dishes and his spoons and his bowls and his covers for covering — of pure gold. 

Seven candlestick of pure gold, each with a bowl, buds and flowers

17 And he made the candlestick of pure gold; of beaten work made he the candlestick. His shaft, and his branch, his bowls, his buds and his flowers were of the same. 

18 And six branches came out of the sides thereof: three branches of the candlestick out of the one side thereof, and three branches of the candlestick out of the other side thereof. 

19 Three bowls were made after the fashion of almonds on one branch, with a bud and a flower, and three bowls were made like almonds on another branch, with a bud and a flower — so throughout the six branches going out of the candlestick. 

20 And on the candlestick were four bowls made like almonds, with his buds and his flowers, 

21 and a bud under two branches of the same, and a bud under two branches of the same, and a bud under two branches of the same, according to the six branches going out of it. 

22 Their buds and their branches were of the same; all of it was one beaten work of pure gold. 

Seven golden branches of candlesticks each with buds and flowers

23 And he made his seven lamps and his snuffers and his snuff dishes of pure gold. 

24 Of a talent of pure gold made he it, and all the vessels thereof. 

25 And he made the incense altar of shittim wood. The length of it was a cubit and the breadth of it a cubit; it was foursquare, and two cubits was the height of it. The horns thereof were of the same. 

26 And he overlaid it with pure gold, both the top of it and the sides thereof round about, and the horns of it; also he made for it a crown of gold round about. 

27 And he made two rings of gold for it under the crown thereof, by the two corners of it, upon the two sides thereof, to be places for the staves to bear it. 

28 And he made the staves of shittim wood and overlaid them with gold. 

29 And he made the holy anointing oil and the pure incense of sweet spices, according to the work of the perfumer. 

Exodus 38

~~~~

The altar of burnt offering; five cubits square of shittim wood; horns on each corner

1 And he made the altar of burnt offering of shittim wood; five cubits was the length thereof and five cubits the breadth thereof; it was foursquare, and three cubits the height thereof. 

— his horns shall be overlayed with brass, projections upward of the horns of an animal, at the four top comers, probably the horns of bulls, but not specified; the length of the horns is also not specified.

And he made the horns thereof on the four corners of it; the horns thereof were of the same, and he overlaid it with brass. 

And he made all the vessels of the altar: the pots and the shovels and the basins, and the fleshhooks and the firepans; all the vessels thereof made he of brass. 

And he made for the altar a brazen grate of network, under the rim thereof beneath, unto the midst of it. 

And he cast four rings for the four ends of the grate of brass, to be places for the staves. 

And he made the staves of shittim wood and overlaid them with brass. 

And he put the staves into the rings on the sides of the altar to bear it; he made the altar hollow with boards. 

And he made the laver of brass and the foot of it from brass, from the looking glasses of the women assembling, who assembled at the door of the tabernacle of the congregation. 

— the Targum of Jonathan says

“And he made the laver of bronze and its base of bronze from the bronze mirrors of the modest women; who, at the time they came to pray at the door of the Tabernacle of Appointment, would stand over the offering of their purification, praising and giving thanks. And they would return to their husbands and give birth to righteous children at the time they were purified from the impurity of their blood.”

And he made the court: on the south side southward the hangings of the court were of finetwined linen, a hundred cubits. 

10 Their pillars were twenty and their brazen sockets twenty; the hooks of the pillars and their fillets were of silver.

11 And for the north side the hangings were a hundred cubits. Their pillars were twenty and their sockets of brass twenty, the hooks of the pillars and their fillets, of silver. 

12 And for the west side were hangings of fifty cubits, their pillars ten and their sockets ten, the hooks of the pillars and their fillets, of silver. 

13 And for the east side eastward, fifty cubits. 

14 The hangings of the one side of the gate were fifteen cubits, their pillars three and their sockets three. 

15 And for the other side of the court gate, on this side and that side, were hangings of fifteen cubits, their pillars three and their sockets three. 

16 All the hangings of the court round about were of finetwined linen. 

17 And the sockets for the pillars were of brass, the hooks of the pillars and their fillets, of silver; and the overlaying of their capitals, of silver, and all the pillars of the court were filleted with silver.

18 And the hanging for the gate of the court was needlework: of blue and purple and scarlet, and finetwined linen; and twenty cubits was the length, and the height in the breadth was five cubits, corresponding to the hangings of the court.

19 And their pillars were four and their sockets of brass four; their hooks, of silver, and the overlaying of their capitals and their fillets, of silver. 

20 And all the pegs of the tabernacle and of the court round about were of brass. 

21 This is the account of the tabernacle, even of the tabernacle of testimony, as it was counted according to the commandment of Moses for the service of the Levites, by the hand of Ithamar, son of Aaron the priest. 

22 And Bezaleel the son of Uri, the son of Hur, of the tribe of Judah, made all that the Lord commanded Moses. 

23 And with him was Aholiab, son of Ahisamach, of the tribe of Dan, an engraver and a skillful workman, and an embroiderer in blue and in purple and in scarlet, and fine linen. 

24 All the gold that was used for the work in all the work of the holy place, even the gold of the offering, was twenty and nine talents, and seven hundred and thirty shekels, according to the shekel of the sanctuary. 

25 And the silver of those who were numbered in the congregation was a hundred talents, and a thousand seven hundred and threescore and fifteen shekels, according to the shekel of the sanctuary: 

26 a bekah for every man, that is, half a shekel, according to the shekel of the sanctuary, for every one who went to be numbered from twenty years old and upward, for six hundred thousand and three thousand and five hundred and fifty men. 

27 And of the hundred talents of silver were cast the sockets of the sanctuary and the sockets of the veil: a hundred sockets from the hundred talents, a talent for a socket. 

28 And of the thousand seven hundred seventy and five shekels he made hooks for the pillars, and overlaid their capitals and filleted them. 

29 And the brass from the offering was seventy talents, and two thousand and four hundred shekels. 

30 And therewith he made the sockets for the door of the tabernacle of the congregation, and the brazen altar and the brazen grate for it, and all the vessels of the altar, 

31 and the sockets of the court round about, and the sockets of the court gate, and all the pegs of the tabernacle, and all the pegs of the court round about. 

Exodus (35-36)

•May 11, 2026 • Leave a Comment

~~~~

Q. Could one unexpected day the Jews bring out the Ark of the Covenant and cause both the Dome of the Rock and the Al-Aqsa Mosque to collapse?

Exodus 35

And Moses gathered all the congregation of the children of Israel together and said unto them, “These are the words which the Lord hath commanded, that ye should do them: — the narrative of what relates to the construction of the sanctuary is now resumed from Exodus 31:18.

Six days shall work be done, but on the seventh day there shall be for you a holy day, a Sabbath of rest to the Lord. Whosoever doeth work therein shall be put to death. 

— six days shall work be done; work for the tabernacle, but on the seventh day they must not strike a stroke, no, not at the tabernacle work; the honour of the sabbath was above that of the sanctuary;

— shall be put to death; the Targum of Jonathan specifies how; by the casting of stones, stoning outside the camp being the punishment of sabbath breakers, Numbers 15:35.

Ye shall kindle no fire throughout your habitations upon the Sabbath day.” — ye shall kindle no fire throughout your habitations upon the sabbath day;

— this law seems the need to be emphasized, again and again; continuing; it is said to be throughout their generations as elsewhere, where the law of the sabbath is repeated.

God raise up Bezaleel and Aholiab for the crafting of his vessels and edifices

And Moses spoke unto all the congregation of the children of Israel, saying, “This is the thing which the Lord commanded, saying, 

‘Take ye from among you an offering unto the Lord. Whosoever is of a willing heart, let him bring it, an offering of the Lord: gold and silver and brass; 

— let him bring it, an offering of the Lord; or an offering to him, otherwise not; if brought stubborn and grudgingly it would not be acceptable, for God loves a willing and cheerful giver: gold, silver, and brass;

and blue and purple and scarlet, and fine linen and goats’ hair; 

and rams’ skins dyed red, and badgers’ skins, and shittim wood; 

and oil for the light, and spices for anointing oil and for the sweet incense; 

and onyx stones, and stones to be set for the ephod and for the breastplate. 

10 “‘And every wisehearted among you shall come and make all that the Lord hath commanded: 

11 the tabernacle, his tent and his covering, his clasps, and his boards, his bars, his pillars and his sockets; 

12 the ark and the staves thereof, with the mercy seat and the veil of the covering; 

13 the table and his staves and all his vessels, and the showbread; 

14 the candlestick also for the light, and his furniture and his lamps with the oil for the light; 

15 and the incense altar and his staves, and the anointing oil, and the sweet incense, and the hanging for the door at the entrance of the tabernacle; 

16 the altar of burnt offering with his brazen grate, his staves and all his vessels, the laver and his foot; 

17 the hangings of the court, his pillars and their sockets, and the hanging for the door of the court; 

18 the pegs of the tabernacle, and the pegs of the court and their cords; 

19 the clothes of service to do service in the holy place, the holy garments for Aaron the priest and the garments of his sons to minister in the priest’s office.’” 

Six days shall work be done, but on the seventh day there shall be for you a holy day, a Sabbath of rest to the Lord. Whosoever doeth work therein shall be put to death.

20 And all the congregation of the children of Israel departed from the presence of Moses. 

21 And they came every one whose heart stirred him up, and every one whom his spirit made willing, and they brought the Lord’S offering to the work of the tabernacle of the congregation, and for all his service and for the holy garments.

— the Targum of Jonathan says

And every man whose heart moved him, and every one who was filled with the Spirit of prophecy, came, and brought what he had for a separation before the Lord for the work of the tabernacle of ordinance, and for all its service, and for the holy vestments.

22 And they came, both men and women, as many as were willinghearted, and brought bracelets and earrings, and rings and tablets, all jewels of gold; and every man who offered, offered an offering of gold unto the Lord. 

23 And every man with whom was found blue and purple and scarlet, and fine linen and goats’ hair, and red skins of rams and badgers’ skins, brought them. 

24 Every one who offered an offering of silver and brass brought the Lord’S offering; and every man with whom was found shittim wood for any work of the service brought it.

25 And all the women who were wisehearted spun with their hands and brought that which they had spun, both of blue and of purple, and of scarlet and of fine linen. 

26 And all the women whose heart stirred them up in wisdom spun goats’ hair.

27 And the rulers brought onyx stones, and stones to be set for the ephod and for the breastplate, 

— the Targum of Jonathan says

“And the clouds of heaven went to Pishon, and drew from there beryl stones of power and stones of completion to be set in the Ephod and the Breastplate. They deposited them upon the face of the wilderness; then the leaders of Israel went and brought them for the needs of the work.”

28 and spices, and oil for the light and for the anointing oil, and for the sweet incense. 

— the Targum of Jonathan says

“And the clouds of heaven returned and went to the Garden of Eden; they took from there the choice spices and the olive oil for illumination, and the pure balsam for the anointing oil and for the incense of spices.”

29 The children of Israel brought a willing offering unto the Lord, every man and woman whose heart made them willing to bring for all manner of work, which the Lord had commanded to be made by the hand of Moses.

30 And Moses said unto the children of Israel, “See, the Lord hath called by name Bezaleel the son of Uri, the son of Hur of the tribe of Judah. 

— both Bezalee and Aholiab; Aholiab, though subordinate to Bezaleel, was the director of his own department, that of weaving and embroidery (Exodus 38:23), and had to instruct in it as Bezaleel had in his.

31 And He hath filled him with the Spirit of God, in wisdom, in understanding and in knowledge, and in all manner of workmanship, — God hath filled Bezaleel with his Spirit, in wisdom, in understanding;

32 and to devise skillful works, to work in gold and in silver and in brass, 

33 and in the cutting of stones to set them, and in carving of wood to make any manner of skillful work. 

34 And He hath put in his heart that he may teach, both he and Aholiab, the son of Ahisamach of the tribe of Dan. 

— and he hath put in his heart that he may teach; instruct others in the things be had knowledge of; the Lord not only gave him gifts of wisdom, understanding, and knowledge, to devise and contrive curious works;

35 Them hath He filled with wisdom of heart, to work all manner of work of the engraver and of the skilled workman, and of the embroiderer in blue and in purple, in scarlet and in fine linen, and of the weaver—even of those who do any work and of those who devise skillful work.” 

Exodus 36

Then Bezaleel and Aholiab, and every wisehearted man in whom the Lord put wisdom and understanding to know how to work all manner of work for the service of the sanctuary, wrought according to all that the Lord had commanded. 

And Moses called Bezaleel and Aholiab, and every wisehearted man in whose heart the Lord had put wisdom, even every one whose heart stirred him up, to come unto the work to do it. 

And they received from Moses all the offering which the children of Israel had brought for the work of the service of the sanctuary, to make it thereby. And they brought yet unto him freewill offerings every morning. 

Whosoever doeth work on the Sabbath therein shall be put to death

And all the wise men who wrought all the work of the sanctuary came every man from his work which they made, 

and they spoke unto Moses, saying, “The people bring much more than enough for the service of the work which the Lord commanded to make.” 

And Moses gave a commandment, and they caused it to be proclaimed throughout the camp, saying, “Let neither man nor woman make any more work for the offering of the sanctuary.” So the people were restrained from bringing, 

for the supply they had was sufficient for all the work to make it, and too much. 

And every wisehearted man among them who wrought the work of the tabernacle made ten curtains of finetwined linen, and blue and purple and scarlet; with cherubims of skillful work made he them. 

The length of one curtain was twenty and eight cubits, and the breadth of one curtain four cubits; the curtains were all of one size. 

10 And he coupled the five curtains one unto another, and the other five curtains he coupled one unto another. 

11 And he made loops of blue on the edge of one curtain from the selvage in the coupling. Likewise he made in the outermost side of another curtain, in the coupling of the second. 

12 Fifty loops made he in one curtain, and fifty loops made he in the edge of the curtain which was in the coupling of the second; the loops held one curtain to another. 

13 And he made fifty clasps of gold, and coupled the curtains one unto another with the clasps. So it became one tabernacle. 

14 And he made curtains of goats’ hair for the tent over the tabernacle; eleven curtains he made them. 

15 The length of one curtain was thirty cubits, and four cubits was the breadth of one curtain; the eleven curtains were of one size. 

16 And he coupled five curtains by themselves and six curtains by themselves. 

17 And he made fifty loops upon the outermost edge of the curtain in the coupling, and fifty loops made he upon the edge of the curtain which coupleth the second. 

18 And he made fifty clasps of brass to couple the tent together, that it might be one. 

19 And he made a covering for the tent of rams’ skins dyed red, and a covering of badgers’ skins above that. 

20 And he made boards for the tabernacle of shittim wood, standing upright. 

21 The length of a board was ten cubits, and the breadth of a board one cubit and a half. 

22 One board had two tenons equally distant one from another. Thus did he make for all the boards of the tabernacle.

23 And he made boards for the tabernacle, twenty boards for the south side southward. 

24 And forty sockets of silver he made under the twenty boards: two sockets under one board for his two tenons, and two sockets under another board for his two tenons. 

25 And for the other side of the tabernacle, which is toward the north corner, he made twenty boards 

26 and their forty sockets of silver: two sockets under one board, and two sockets under another board. 

27 And for the sides of the tabernacle westward he made six boards. 

28 And two boards made he for the corners of the tabernacle in the two sides. 

29 And they were coupled beneath and coupled together at the head thereof to one ring; thus he did to both of them in both the corners. 

30 And there were eight boards, and their sockets were sixteen sockets of silver, under every board two sockets. 

31 And he made bars of shittim wood: five for the boards of the one side of the tabernacle, 

32 and five bars for the boards of the other side of the tabernacle, and five bars for the boards of the tabernacle for the sides westward. 

33 And he made the middle bar to extend through the boards from the one end to the other. 

34 And he overlaid the boards with gold, and made their rings of gold to be places for the bars, and overlaid the bars with gold. 

35 And he made a veil of blue and purple and scarlet, and finetwined linen; with cherubims he made it of skillful work. 

36 And he made thereunto four pillars of shittim wood and overlaid them with gold. Their hooks were of gold, and he cast for them four sockets of silver. 

37 And he made a hanging for the tabernacle door of blue and purple and scarlet, and finetwined linen, of needlework, 

38 and the five pillars of it with their hooks. And he overlaid their capitals and their fillets with gold, but their five sockets were of brass. 

Exodus (33-34)

•May 10, 2026 • Leave a Comment

~~~~

“I am thy shield!” the Lord said, “Unto thy seed have I given this land, from the river [Nile] of Egypt unto the great river, the River Euphrates” (Genesis 15

Exodus 33

1 And the Lord said unto Moses, “Depart and go up hence, thou and the people whom thou hast brought up out of the land of Egypt, unto the land which I swore unto Abraham, to Isaac, and to Jacob, saying, ‘Unto thy seed will I give it.’ 

— the land which I swore unto Abraham, Isaac and to Jacob; saying, unto thy seed will I give it: meaning the land between the two great rivers, which as he had promised with an oath to their fathers to give it to them, he would faithfully observe it, though they were unworthy of such a favour;

— the Targum of Jonathan reveals a specific psychological motivation for the command to leave, saying,

“And the Lord spoke with Moses: ‘Go, depart from here—lest My burning anger intensify against the people and I destroy them. Therefore, travel you and the people whom you brought up from the land of Egypt, to the land which I swore to Abraham, to Isaac, and to Jacob, saying: To your children I will give it.'”

— God shifts the “ownership” of the nation; He doesn’t call them “My people,” but rather “the people whom you brought up.” That is, even in anger, God remains faithful to the Covenant of the Patriarchs; because of His promise to Abraham, Isaac, and Jacob.

And I will send an angel before thee; and I will drive out the Canaanite, the Amorite, and the Hittite and the Perizzite, the Hivite and the Jebusite”

— and God will drive out the Canaanite, the Amorite, and the Hittite, the Perizzite, the Hivite, and the Jebusite; who were then the inhabitants of the land, and these he promises to drive out, to make way for their possession;

— and that “by his hand” as the Targum of Jonathan interprets it, by the hand of an angel. Only six nations are mentioned, though there were seven; the Girgashite is omitted, but added in the Septuagint version.

unto a land flowing with milk and honey. For I will not go up in the midst of thee, for thou art a stiffnecked people, lest I consume thee on the way.” — unto a land flowing with milk and honey; abounding with all the necessaries and good things of life;

— for God himself will not go up in the midst of thee; lest he consumes thee, for “God is a consuming fire” Exodus 32:10; Leviticus 10:2; Hebrews 12:29.

And when the people heard these evil tidings they mourned, and no man put on his ornaments. — when the people heard these evil tidings, they mourned; it was something that these sinful people felt the tidings to be “evil” to shrink from the presence of God;

— his near presence, by day and by night, constantly (Exodus 13:22), and they dreaded a change, which they felt must involve a loss, and one the extent of which they could not measure; “an angel” they thought, is a poor consolation when we are craving for God himself!

For the Lord had said unto Moses, “Say unto the children of Israel, ‘Ye are a stiffnecked people. I will come up into the midst of thee in a moment and consume thee. Therefore now put off thy ornaments from thee, that I may know what to do unto thee.’” 

— I will come up; that is, If God were to go up for one moment in the midst of thee, he would consume them;

— therefore now put off thy ornaments from thee; put them aside altogether; show thy penitence by giving up their use; denies them the tokens of his presence they had been blessed with; token of their sorrow the Lord required of his offending people; and mourn for their sin;

— that I may know what to do unto thee; that I may either inflict my judgments, or suspend them, as thou art penitent or impenitent.

And the children of Israel stripped themselves of their ornaments by Mount Horeb. — and they stripped off their ornaments; that is, left off their ornaments, ceased to wear them altogether.

And Moses took the tabernacle and pitched it outside the camp, afar off from the camp, and called it the tabernacle of the congregation. And it came to pass that every one who sought the Lord went out unto the tabernacle of the congregation, which was outside the camp. 

— perhaps this tabernacle was a model of the tabernacle that had already been erected, this, a hasty draft from the pattern showed him in the mount, designed for direction to the workmen, and used in the mean time as a tabernacle of meeting between God and Moses about public affairs;

— or, did Moses, with the help of a few hundreds of the Levites among the thousands available, moved the sanctuary and pitched it outside the camp, afar off from the camp; to signify to them that they were unworthy of close proximity;

— the Targum of Jonathan says “the tabernacle he took away from thence” seems like this tabernacle was the original taken away; and pitched outside the camp;

— the King James and Geneva Study Bible versions say “without the camp” such old English usage is misleading; hence better to use the 21st Century King James Version or KJ21.

And it came to pass, when Moses went out unto the tabernacle, that all the people rose up and stood every man at his tent door, and looked after Moses until he had gone into the tabernacle. — when Moses went out; all the people rose up; probably Moses “went out” at set times each day;

— and the people watched for his going, and stood up as a mark of respect and reverence. They felt that he went to the tent mainly to pray for them;

— the Targum of Jonathan says adversely about the people being wicked:

“And it was when Moses passed forth from the camp to go to the tabernacle that all the wicked people arose, and stood, every man at the door of his tent, and looked with the evil eye after Moses, when he entered the tabernacle.”

And it came to pass, as Moses entered into the tabernacle, the pillar of cloud descended and stood at the door of the tabernacle, and the Lord talked with Moses. — and as Moses entered into the tabernacle, the cloudy pillar descended from the top of Mount Sinai in which the Lord was;

— and all the people rose up and worshipped, everyman in his tent door; it was awesome sight, so they bowed, not to Moses, for he was gone into the tabernacle out of sight, but a deep fear and adorating bow to the Lord in the pillar of cloud.

“Thou canst not see My face, for there shall no man see Me and live.” 

11 And the Lord spoke unto Moses face to face, as a man speaketh unto his friend. And he returned again into the camp; but his servant Joshua, the son of Nun, a young man, departed not out of the tabernacle.

— face to face, or, mouth to mouth, as Numbers 12:8; not that God hath face or mouth, or that Moses could behold it, which is denied, Exodus 33:20; but the sense is, he spoke with him freely and familiarly, plainly, cordially, openly, not by an angel in a dream or vision, as he did to other prophets;

— but his servant Joshua abode there to assist and direct those who resorted to seek God in Moses’s absence; and he seems appointed for this work rather than Aaron, or any other of the elders, because they had one way or other been guilty of the idolatry; and he was the general of the army at the battle with Amalek.

12 And Moses said unto the Lord, “See, Thou sayest unto me, ‘Bring up this people,’ and Thou hast not let me know whom Thou wilt send with me. Yet Thou hast said, ‘I know thee by name, and thou hast also found grace in My sight.’ 

— I know thee by name, Moses, out of the burning bush (Exodus 3:4), and again, probably, when he “called unto him out of the midst of the cloud” (Exodus 24:16); it implies a very high degree of Divine favour. God “knows by name” only those whom he greatly regards.

13 Now therefore, I pray Thee, if I have found grace in Thy sight, show me now Thy way, that I may know Thee, that I may find grace in Thy sight; and consider that this nation is Thy people.” 

— shew me now thy way: either the way which he himself would take, the way of his providence in bringing the children of Israel into the land of Canaan.

14 And He said, “My presence shall go with thee, and I will give thee rest.” — my presence shall go with thee; or before thee, both with Moses and before the people; meaning the Angel of his presence he had before promised.

15 And he said unto Him, “If Thy presence go not with me, carry us not up hence. — that is, Let us rather die in the wilderness with thy presence and favour, than go into Canaan without God’s presence;

16 For wherein shall it be known here that I and Thy people have found grace in Thy sight? Is it not in that Thou goest with us? So shall we be separated, I and Thy people, from all the people who are upon the face of the earth.” 

— and if thou wilt lead the people up to Canaan, consider that we are thine own people, to whom thou must acknowledge thyself as our God.

17 And the Lord said unto Moses, “I will do this thing also that thou hast spoken; for thou hast found grace in My sight, and I know thee by name.” 

— and I know thee by name; he owns the truth of the thing, on which Moses had formed his plan, and what can be a greater blessing than to partake of the special plan of God, and to be personally known to him.

18 And he said, “I beseech Thee, show me Thy glory.” — Moses repeats, in a more definite form, his request above in verse 13 “show me now Thy way.” He asks to be allowed to see Gods’s glory; but is told in reply that he cannot see this in its fulness.

19 And He said, “I will make all My goodness pass before thee; and I will proclaim the name of the Lord before thee, and will be gracious to whom I will be gracious, and will show mercy on whom I will show mercy.” 

20 And He said, “Thou canst not see My face, for there shall no man see Me and live.” — thou canst not see my face; the full display of his glory, that light inaccessible, before which the angels stand, but which would be insufferable to mortal eyes; this no man can see and live.

21 And the Lord said, “Behold, there is a place by Me, and thou shalt stand upon a rock.

22 And it shall come to pass, while My glory passeth by, that I will put thee in a cleft of the rock, and will cover thee with My hand while I pass by; 

23 and I will take away Mine hand, and thou shalt see My back parts, but My face shall not be seen.” 

MSG

God said, “Look, here is a place right beside me. Put yourself on this rock. When my Glory passes by, I’ll put you in the cleft of the rock and cover you with my hand until I’ve passed by. Then I’ll take my hand away and you’ll see my back. But you won’t see my face.”

Exodus 34

1 And the Lord said unto Moses, “Hew thee two tablets of stone like unto the first, and I will write upon these tablets the words that were in the first tablets which thou brokest. 

— hew thee two tables; something is always lost by sin, even when it is forgiven. The first tables were “the work of God” (Exodus 32:16). the second were hewn by the hand of Moses.

And be ready in the morning, and come up in the morning unto Mount Sinai, and present thyself there to Me on the top of the mount. 

— and present thyself there to me on the top of the mount; where the pillar of cloud stood, and near it Moses was to stand and wait to hear what would be said unto him, and to see what would be made to pass before him.

And no man shall come up with thee, neither let any man be seen throughout all the mount; neither let the flocks nor herds feed before that mount.” 

— neither let the flocks nor herds feed before that mount; or over against it, or rather “near” it; Moses was to be alone, and no one was to be seen in any part of the mount.

And he hewed two tablets of stone like unto the first; and Moses rose up early in the morning and went up unto Mount Sinai, as the Lord had commanded him, and took in his hand the two tablets of stone. 

—and Moses rose up early in the morning: and went up unto Mount Sinai, as the Lord had commanded him; which was the third time of his going there, and every time he continued forty days and forty nights.

And the Lord descended in the cloud and stood with him there, and proclaimed the name of the Lord. 

— and the Lord descended in the cloud; the same with the cloudy pillar, which had gone up from the door of the tabernacle, and was on high in the air over the mount, and on which the Lord now descended in it;

And the Lord passed by before him, and proclaimed, “The Lord, the Lord God, merciful and gracious, longsuffering, and abundant in goodness and truth, — the Lord, the Lord God proclaims, “The Lord, the Lord God, merciful and gracious. . . ”

keeping mercy for thousands, forgiving iniquity and transgression and sin, and that will by no means clear the guilty, visiting the iniquity of the fathers upon the children, and upon the children’s children unto the third and to the fourth generation.” 

MSG

So Moses cut two tablets of stone just like the originals. He got up early in the morning and climbed Mount Sinai as God had commanded him, carrying the two tablets of stone. God descended in the cloud and took up his position there beside him and called out the name, God. God passed in front of him and called out,

“God, God, a God of mercy and grace, endlessly patient—so much love, so deeply true—loyal in love for a thousand generations, forgiving iniquity, rebellion, and sin. Still, he doesn’t ignore sin. He holds sons and grandsons responsible for a father’s sins to the third and even fourth generation.”

Targum of Jonathan

And he hewed two tables of stone like the former: and Mosheh arose in the morning and ascended Mount Sinai, as the Lord had instructed him, and took in his hand the two tables of stone. And the Lord made His Shekinah to pass by before his face, and proclaimed,

The Lord, the Lord God, merciful and gracious, long-suffering, and nigh in mercies, abounding to exercise compassion and truth; keeping mercy and bounty for thousands of generations, absolving and remitting guilt, passing by rebellions, and covering sins; pardoning them who convert unto the law, but holding not guiltless in the great day of judgment those who will not convert; visiting the sins of fathers upon rebellious children upon the third and upon the fourth generation.

And Moses made haste, and bowed his head toward the earth and worshiped. — Moses made haste, and bowed his head; as the Divine glory passed before him, Moses bowed his head in adoration, worshipping God, and not daring to look until the glory had gone by.

And he said, “If now I have found grace in Thy sight, O Lord, let my Lord, I pray Thee, go among us, for it is a stiffnecked people; and pardon our iniquity and our sin, and take us for Thine inheritance.” — O Lord, let my Lord, I pray thee, go amongst us;

— as the Lord had signified as if he would not go among them, but leave them to the conduct of a an angel; and Moses had before prayed that his presence or face might go with them.

10 And He said, “Behold, I make a covenant. Before all thy people I will do marvels such as have not been done in all the earth, nor in any nation; and all the people among whom thou art shall see the work of the Lord, for it is a fearsome thing that I will do with thee. 

— following the Golden Calf, there was fear that God would “replace” Israel with another nation; but the Targum of Jonathan reveals God’s unwillingness to change his chosen people that he was already working with, saying

“And He said: ‘Behold, I decree a covenant that I will not exchange this people for another people. However, from you shall go forth multitudes of righteous ones.

“In the presence of all your people, I will perform wonders for them at the time they go into captivity by the rivers of Babylon; I will bring them up from there and settle them within the River Sambatyon.

“Such wonders as these have not been created among all the inhabitants of the earth or among any of the nations. And all the people among whom you dwell shall see on that day the work of the Lord, for awesome is that which I am doing with you.’”

— the Targum, however, affirms the eternal nature of the bond, even in the face of sin as it looks far into the future, specifically addressing the exile and the fate of the “lost” parts of the nation, promising they shall bring “forth multitudes of righteous ones.”

11 Observe thou that which I command thee this day. Behold, I drive out before thee the Amorite and the Canaanite, and the Hittite and the Perizzite, and the Hivite and the Jebusite. 

— the Amorite, Canaanite, Hittite, Perizzite, Hivite and the Jebusite; six nations are only mentioned, though there were seven, the Girgashites being omitted, because either they left the land before; or because they were subjugated by the others; but they are retained in the Septuagint version.

12 Take heed to thyself, lest thou make a covenant with the inhabitants of the land whither thou goest, lest it be for a snare in the midst of thee. 

— lest it be for a snare in the midst of thee; be the means of drawing them into the same sinful practices with themselves, especially into idolatrous ones, and so of bringing ruin and destruction on them.

13 But ye shall destroy their altars, break their images, and cut down their Asherah poles. — and cut down their groves; which were clusters of trees, where they had their temples and their idols, and did service to them, and where, besides idolatry, many impurities were committed.

14 For thou shalt worship no other god; for the Lord, whose name is Jealous, is a jealous God, — whose name is Jealous; the jealous God, who cannot endure any competitor or corrival; whereas the false and puny gods of the heathens were contented with multitudes of partners.

15 lest thou make a covenant with the inhabitants of the land and they go a whoring after their gods, and do sacrifice unto their gods, and one call thee and thou eat of his sacrifice,

 — and one call thee, and thou eat of his sacrifice; invite to eat of what remained, that was offered to the idol: hence it appears, that having feasts at sacrifices, and eating things offered to idols in a festival way, are very ancient practices;

16 and thou take their daughters unto thy sons, and their daughters go a whoring after their gods, and make thy sons go a whoring after their gods. — and make thy sons go a whoring after their gods; by the means of tempting and drawing them into idolatrous practices, as the wives of Solomon were a snare to him.

17 “Thou shalt make thee no molten gods. — thou shalt make thee no molten gods; it is just possible that the Israelites when they worshipped the golden calf may have conceived that they were not breaking the second commandment, which forbade the adoration of any “graven image.” An express law was therefore made against “molten images.”

18 “The Feast of Unleavened Bread shalt thou keep. Seven days thou shalt eat unleavened bread, as I commanded thee, in the time of the month of Abib; for in the month of Abib thou camest out from Egypt. 

— the feast of unleavened bread shalt thou keep; which was instituted at the time of their coming out of Egypt, and on that account, and then observed, Exodus 12:15 and afterwards repeated, and the month expressed in which they were to keep it.

19 “All that openeth the womb is Mine, and every firstling among thy cattle, whether ox or sheep, that is male. — all that openeth “the womb” is mine, and every firstling among thy cattle, whether ox or sheep, that is male, shall be sanctified, and set apart for his use.

20 But the firstling of an ass thou shalt redeem with a lamb; and if thou redeem him not, then shalt thou break his neck. All the firstborn of thy sons thou shalt redeem. And none shall appear before Me empty. — and none shall appear before me empty; at the grand festivals, the Passover, Pentecost, and Tabernacles.

God wrote the two tablets of testimony in Paleo-Hebrew, not square script Hebrew

21 “Six days thou shalt work, but on the seventh day thou shalt rest; in plowing time and in harvest thou shalt rest. — in earing and in harvest thou shall rest; that is, in the time of ploughing, and in the time of reaping and gathering in the harvest.

22 And thou shalt observe the Feast of Weeks of the firstfruits of wheat harvest, and the Feast of Ingathering at the year’s end. — the feast of weeks; called in Exodus 23:16, “the feast of harvest,” and in the New Testament “the day of Pentecost”

23 Thrice in the year shall all your menchildren appear before the Lord God, the God of Israel. — the God of Israel; who had chosen them to be his special people, had redeemed them out of Egypt, and done great things for them since; had made a covenant with them.

24 For I will cast out the nations before thee and enlarge thy borders; neither shall any man desire thy land when thou shalt go up to appear before the Lord thy God thrice in the year. 

— neither shall any man desire thy land; I will not only tie their hands, that they shall make no invasion upon you, but I will take off their thoughts and affections from such an enterprise, which it was very easy for God to effect many ways.

25 “Thou shalt not offer the blood of My sacrifice with leaven, neither shall the sacrifice of the Feast of the Passover be left until the morning. 

— thou shall not offer the blood of my sacrifice with leaven; that is, not to kill the passover while there was any leaven in their houses; so the Targum of Jonathan says “You shall not sacrifice the victim of My passover before you have done away with leaven.”

26 The first of the firstfruits of thy land thou shalt bring unto the house of the Lord thy God. Thou shalt not boil a kid in his mother’s milk.” — the first of the firstfruits of thy land thou shalt bring; this, and another law in this verse, concerning not seething a kid in his mother’s milk, are repeated from Exodus 23:19.

27 And the Lord said unto Moses, “Write thou these words, for according to the tenor of these words I have made a covenant with thee and with Israel.” — write for thee these words, that is, put them in writing for thine own use and the use of thy people.

28 And he was there with the Lord forty days and forty nights; he neither ate bread nor drank water. And He wrote upon the tablets the words of the covenant, the Ten Commandments.

29 And it came to pass, when Moses came down from Mount Sinai with the two tablets of testimony in Moses’ hand, when he came down from the mount, that Moses knew not that the skin of his face shone while he talked with Him. — Moses did not know his face shone, while he talked with him;

— the Targum of Jonathan reveals that Moses had achieved the highest possible level of intimacy with the Divine that a human could survive, saying

“And it was, at the time of Moses’ descent from Mount Sinai, with the two Tablets of Testimony in the hand of Moses as he descended from the mountain, that Moses did not know that the splendor of the features of his face shone; which became his from the splendor of the Glory of the Shekhinah of the Lord, at the time of His speaking with him.”

— the Targum of Jonathan reveals Moses didn’t know that his face shone with the splendour which had come upon him from the brightness of the glory of the Lord’s Shekinah in the time of His speaking with him;

— this radiance was why Moses eventually has to wear a veil when speaking to the people, “for they were afraid to come near to him” Exodus 34:30–35

30 And when Aaron and all the children of Israel saw Moses, behold, the skin of his face shone, and they were afraid to come nigh him. — behold, the skin of Moses’ face shone; darted out rays of light and glory all around him, Aaron and the people were afraid to go near Moses when they saw the brightness of his face;

— they were afraid, their fear arose from a sense of guilt; the beaming radiance of his countenance made him appear to their awe-struck consciences of a flaming sword from heaven.

31 And Moses called unto them, and Aaron and all the rulers of the congregation returned unto him; and Moses talked with them. — and Moses talked with them; after he had put a veil on his face, of which there is an account in the following verses;

— he talked with them and told them all that had happened to him in the mount; what a glorious sight he had been indulged with; what a proclamation of the grace and goodness of God had been made to him; and what laws and ordinances God had enjoined him and their observance.

Later the two tablets of testimony were placed in the Ark of the Covenant

32 And afterward all the children of Israel came nigh, and he gave them in commandments all that the Lord had spoken with him on Mount Sinai. 

— and afterward all the children of Israel came near; that is, after Aaron and the rulers had had a conversation with Moses, then the whole body of the people by turns were admitted to come before him, and hear the laws of God from him.

33 And until Moses had done speaking with them, he put a veil on his face. — and till Moses had finished speaking with them, he had a veil over his face.

34 But when Moses went in before the Lord to speak with Him, he took the veil off until he came out. And he came out, and spoke unto the children of Israel that which he was commanded. 

— and he came out, and spake unto the children of Israel that which he was commanded; out of the tabernacle with the law and commands now given, for these he had already declared;

— but after times, and all such times when he went in to the Lord to inquire of him his mind and will concerning certain things, in which the people wanted information, when, upon his return, he acquainted them with whatsoever the Lord ordered to be done.

35 And the children of Israel saw the face of Moses, that the skin of Moses’ face shone; and Moses put the veil upon his face again, until he went in to speak with Him. 

— and Moses put the veil upon his face again, until he went in to speak with him; this he did from time to time, when he came out from the Lord he put on his veil, and when he went in again, he takes it off.

MSG

When Moses finished speaking with them, he put a veil over his face, but when he went into the presence of God to speak with him, he removed the veil until he came out.

When he came out and told the Israelites what he had been commanded, they would see Moses’ face, its skin glowing, and then he would again put the veil on his face until he went back in to speak with God.

— the Targum of Jonathan says

“And the children of Israel saw the features of Moses, that the splendor of the features of Moses’ face radiated; and Moses would put the veil back over his face until the time he went in to speak with Him.”

Who is this lying Ephraim?

•May 10, 2026 • Leave a Comment

God may have seen Ephraim as the rightful heir and favorite among the thirteen patriarchs, yet it’s ironic that prophecy also casts him in a negative light.

“Ephraim compasseth me with lies, and the house of Israel with deceit” (Hosea 11:12).

Of course the house of Israel was led by Ephraim; so who is this lying Ephraim?

Ephraim could be described as a land filled with amber waves of grain and a nation holding the gates of its enemies. It’s also a country that twice saved Western Europe and Asia from collapse, but its once benevolent nature has been replaced with a reputation for deceit.

US Secretary of State Colin Powell holding a model vial of anthrax while giving the presentation to the United Nations Security Council on 5 February 2003

“They Lied About Afghanistan. They Lied About Iraq. And They Are Lying About Ukraine,” writes Chris Hedges of the chronic lying characteristics of the leaders of the United States.

“The Russian invasion of Ukraine was a war crime, although one that was provoked by NATO expansion and by the United States backing of the 2014 “Maidan” coup which ousted the democratically elected Ukrainian President Viktor Yanukovych.”

The prophet Hosea said the house of Israel, symbolizing the ten lost tribes, was steeped in hypocrisy, while the house of Ephraim, the dominant northern tribe with its capital in Samaria, was consumed by lies and deceit.

Ephraim and Manasseh

The United States is Ephraim!

Here are just a few historic and classic examples of lying and deceit in the house of Ephraim for reflection:

The Gulf of Tonkin incident was a supposed confrontation that pushed the United States into the Vietnam War. It centered on a fabricated claim that North Vietnamese ships clashed with US vessels in the Gulf of Tonkin. The initial American report accused North Vietnam of attacking the USS Maddox, but later revelations from the Pentagon Papers, Robert McNamara’s memoirs, and 2005 NSA publications showed the US government had lied to justify going to war with Vietnam.

This deception led to the US Congress passing the Gulf of Tonkin Resolution, giving President Lyndon Johnson the authority and justification to deploy US forces against what was described as “communist aggression.”

On January 26, 1998, Bill Clinton addressed the nation, firmly stating, “I want to say one thing to the American people. Listen to me. I’m going to say this again: I did not have sexual relations with that woman, Miss Lewinsky. I never told anyone to lie. Not once. Never.” His falsehoods eventually led to him becoming the second president in US history to be impeached by the House of Representatives.

In an August 2002 speech that launched the Bush administration’s push for war with Iraq, Cheney claimed, “Simply stated, there’s no doubt that Saddam Hussein now has weapons of mass destruction. There is no doubt he is amassing them to use against our friends, against our allies, and against us.”

In October 2002, Defense Secretary Donald Rumsfeld asserted he had “bulletproof” evidence linking Saddam Hussein to Osama bin Laden. Around the same time, a National Intelligence Estimate reported that Iraq had “continued its weapons of mass destruction program.”

“However, there is no doubt at all that the development of weapons of mass destruction by Saddam Hussein poses a severe threat not just to the region, but to the wider world.” – Tony Blair, House of Commons, 10 April 2002.

Prime Minister Tony Blair defended himself in 2005: “I have never told a lie. No. I don’t intend to go telling lies to people. I did not lie over Iraq.”

“The 1989 Tiananmen Square massacre was one of the most prominent lies. Wikileaks testifies that there were no bloodshed inside Tiananmen Square! HERE TheTelegraph

And here is the Real Donald Trump

In a June 7, 2020 interview on CNN’s “State of the Union,” former Secretary of State and Joint Chiefs of Staff Colin Powell called Donald Trump a chronic liar. Powell said, “The one word I have to use for what he’s been doing over the last several years is a word I never used before, not with any of the four presidents I worked for—he lies. He lies about things, and he gets away with it because people won’t hold him accountable.”

Some of President Trump’s top staff mocked him behind his back. His first Secretary of State, Rex Tillerson, reportedly called him a “f***ing moron.” Political adviser Steve Bannon compared him to “an 11-year-old child,” and former White House Chief of Staff John Kelly allegedly labeled him an “idiot.”

And even Secretary of State Mike Pompeo, considered a loyalist, was reportly said to have written a note describing the President as “full of shit.”

According to John Bolton, Trump didn’t seem aware that Britain was a nuclear power and even asked if Finland was part of Russia. “I don’t think he’s fit for office,” the former National Security Advisor added. “I don’t believe he has the competence to do the job.”

“There really isn’t any guiding principle that I was able to discern other than what’s good for Donald Trump’s re-election,” Bolton, known to the world for his walrus mustache, added, “I think he was so focused on the re-election that longer-term considerations fell by the wayside.”

“He doesn’t operate pursuant to philosophy, or grand strategy or policy,” Bolton, described by Trump as “a war mongering fool, reflected on his 17 months in the White House. “He’s often described as transactional, but what it means is that every day is a new adventure. Decisions get made on an ad-hoc and episodic basis.”

“I didn’t lie.”

In an interview with ABC News, Bolton remarked about President Trump, saying, “Putin thinks he can play him like a fiddle.”

Lastly, Bolton was unsettled by Trump’s remark that “the only way we’re going to lose this election is if it’s rigged.” He went on to say that Trump “might try anything” and that “there are no rules” when it comes to the President.

“Mr Trump is an enigma,” said Michael Cohen, who worked for him for many years and claimed to know him better than even his own family. Cohen described him in detail as “a cheat, a liar, a fraud, a bully, a racist, a predator, a con man,” and someone who “has spent his entire life avoiding and evading responsibility for his actions.”

“He’s a clown,” Mary Trump remembered her aunt Maryanne saying during one of their lunches after Donald announced he was running for President. “This will never happen.”

Maryanne also became enraged when Donald began to receive endorsements from prominent Christians and White Evangelicals such as Jerry Falwell Jr. remembering he was a man with “five bankruptcies.” Maryanne, who is a Catholic since her conversion 50 years ago, allegedly raged to Mary: “What the f*** is wrong with them? The only time Donald went to church is when the cameras were there. It’s mind boggling. He has no principles. None!”

“Frankenstein’s Monster,” exclaimed Mary, who had studied schizophrenia patients at Hillside Hospital on Long Island. She went on to describe the narcissist’s dysfunctional family background, likening him to a three-year-old, and remarked, “Trump’s ego is fragile and needs constant reinforcement because deep down he knows he is nothing like what he claims to be.”

Mary spoke about her uncle’s life of “cheating and lies,” pointing to an incident from his youth: “Trump even paid someone to take the SATs for him so he could get into the University of Pennsylvania’s prestigious Wharton School of Business,” where he has claimed he graduated with the “highest grades possible.”

That someone was his buddy Joe Shapiro, a bright kid known for being a great test taker, and the so-called “sociopath” had, from an early age, mastered the art of lying, spinning, and obfuscating, as well as knowing how to pay people generously. This set the stage for the rise of what we now have — not just “the World’s Most Dangerous Man” as Commander-in-Chief in the White House, but also “the World’s Most Boggling Gorilla.”

Mike Cohen paints a startling picture of the group surrounding Trump, calling him “a cheat, a liar, a fraud, a bully, a racist, a predator, and a con man.”

In an August speech to the Council for National Policy, a conservative activist group, Trump said, “You’ll never have an election count on November 3. In my opinion, you’re not going to know the outcome of this election for weeks, months, maybe never.”

Bob Woodward: Trump Doesn’t Seem To Know “What Is Real And What Is Unreal.”

And here is Donald Trump’s Secretary of State, Mike Pompeo:

Ex-CIA director Pompeo: 'We lied, we cheated, we stole' - YouTube

On April 15, 2019, at a forum at Texas A&M University, former CIA director and current Secretary of State Mike Pompeo remarked, “I was the CIA director. We lied, we cheated, we stole. It was like – we had entire training courses. It reminds you of the glory of the American experiment.” Interestingly, a Christian religious news broadcaster sharply commented on his words, saying, “That’s not the résumé of the Secretary of State… that’s the résumé of Satan.”

Of course, Trump’s Secretary of State isn’t Satan, but definitely seems like someone possessed by a demon.

During his second term in the White House, President Donald Trump often remarked, “The Panama Canal was built by Americans for Americans, though others were welcome to use it. It came at a tremendous cost in American blood and treasure — 38,000 workers lost their lives constructing it.”

Enhance lighting, sharpness, natural color balance
“Donald Trump a chronic liar,” claimed Colin Powell, the late Secretary of State

Fact check: President Donald Trump repeated his false claim that 38,000 Americans died during the building of the Panama Canal. That figure is not even close to true, experts on the canal’s construction say.

While the century-old records are imprecise, they show about 5,600 people died during the canal’s American construction phase between 1903 and 1914 — and “of those, the vast majority were Afro-Caribbeans,” such as workers from Barbados and Jamaica, according to Julie Greene, a history professor at the University of Maryland and author of the book “The Canal Builders: Making America’s Empire at the Panama Canal.”

The late historian David McCullough, author of another book on the building of the canal, found that “the number of white Americans who died was about 350.”

Following report of the 880lbs (408kg) of highly enriched uranium stockpile were already moved elsewhere before the seven esteemed B-2 bombers arrived, President Trump says the Fordow, Natanz and Isfahan nuclear facilities were “completely and fully obliterated!”

Then following leaks of enriched uranium stockpile being removed the strong headed White House Press Secretary Karoline Leavitt said, “This alleged assessment is flat-out wrong and was classified as ‘top secret’ but was still leaked to CNN by an anonymous, low-level loser in the intelligence community.”

And she thickened her lie: “The leaking of this alleged assessment is a clear attempt to demean President Trump, and discredit the brave fighter pilots who conducted a perfectly executed mission to obliterate Iran’s nuclear program.”

Then President Donald Trump took to social media hitting out at CNN and the New York Times over reports claiming America’s strikes on three of Iran’s nuclear facilities did not destroy the country’s program.

“We just caught the failing New York Times, working with fake news CNN, cheating again! They tried to demean the great work our B-2 pilots did, and they were wrong in doing so,” President Trump said in his Truth Social post, adding, “These reporters are just bad and sick people.”

Later he boasted: “I don’t want to use an example of Hiroshima. I don’t want to use an example of Nagasaki. But that was essentially the same thing. That ended that war.”

Professor Jeffrey Sachs on Donald Trump’s 60 Minutes Interview, Nov 7, 2025. In this video, Professor Jeffrey Sachs breaks down Donald Trump’s recent 60 Minutes interview — exposing 10 of his biggest lies and false claims. From inflation and tariffs to Ukraine, AI, and the Insurrection Act, we fact-check every major statement Trump made during his 73-minute appearance on 60 Minutes — Every Lie Explained (original video replaced)

~~~~~

On the religious side, the United States was originally founded largely by Puritans, called Pilgrims, a break-away group of devout Christians who were known as Separatists, because they separated from the Church of England to follow the precepts of the Bible.

Facing intense persecution, they set sail for the New World, seeking a place where they could worship God freely and live in peace—at least, that was their claim.

But the same problem persists:

“Ephraim tells lies right and left. Not a word of Israel can be trusted,” says Hosea 11:12 in the Message Bible.

And the prophet Hosea continues prophesying in the next chapter:

And Ephraim said, “Yet I am become rich, I have found myself substance; in all my labors they shall find no iniquity in me that were sin” Hosea 12:8

Or as the Message Bible expresses Ephraim under brighter light:

Their businessmen engage in wholesale fraud.
They love to rip people off!
Ephraim boasted, “Look, I’m rich!
I’ve made it big!
And look how well I’ve covered my tracks:
not a hint of fraud, not a sign of sin!”
Hosea 12:7-8 MSG

Here again is Ephraim, or the United States of America, having built a rich and prosperous nation, they act as though they are very upright and honest in their dealings, and in acknowledging God’s blessings upon them.

And although taking notice initially of God and his providence, they soon ascribe all their wealth and riches to their own labour, diligence and industry.

Enhance lighting, sharpness, natural color balance
The thirteenth tribe had just arrived, the latest, but arriving with “horns of a wild ox” — not horns of a domestic buffalo; but with violence, lies and deceits.

~~~~

On the religious side, not long after the American War of Independence from 1775 to 1783, the story of Joseph Smith (1805–1844) began, involving a supposed prophet whose fabricated treasure-hunting scheme, fueled by false claims, played a role in shaping the Latter Day Saint movement.

Prophet Joseph Smith’s vision began when the angel Moroni gave him the Golden Plates, which were hidden in a stone box buried at the Hill Cumorah in upstate New York, just a few miles from his boyhood home on a farm.

Enhance lighting, sharpness, and color naturally
Joseph Smith holding the golden plates before the angel Moroni

When Smith arrived, “the hill opened, and they walked into a cave, in which there was a large and spacious room.” The account continues by saying they found “more plates than probably many wagon loads; and were piled up in the corners and along the walls.”

But Smith was forbidden by the angel to show the plates to anyone until they had been translated from their original “reformed Egyptian” language.

Enhance lighting, sharpness, natural color balance
Jesus the Son and God the Father came to visit Joseph Smith, an honour and privilege even Moses or Elijah couldn’t achieve

At home, Smith dictated the words from the plates while his wife or a scribe wrote them down, eventually forming the Book of Mormon. Instead of looking directly at the plates, he used a transparent seer stone placed in the bottom of his hat to translate them.

Smith released the first edition of the translation in March 1830 as the Book of Mormon, with an initial print run of 5,000 copies, sparking a movement more captivating and thrilling than a Tom Clancy novel.

Overlapping the life of Joseph Smith, a false prophetess were to appear to energize the Adventist movement.

Here comes Ellen G White (1827–1915):

Enhance lighting, sharpness, natural color
Ellen G White, claims seeing rays of lights from the Throne of God

“The Bible nowhere sanctions the use of intoxicating wine. The wine that Christ made from water at the marriage feast of Cana was the pure juice of the grape” (The Ministry of Healing, p 333) Ellen G White claimed, and thus wine is actually grape juice; and her claim manages to brainwash 20 million faithfuls worldwide with her belief that Noah was drunk because he had drank too much grape juice!

“I do not write one article in the paper expressing merely my own ideas. They are what God has opened before me in vision–the precious rays of light shining from the throne” (Ellen G White, Testimonies for the Church, vol. 5, p.67).

Ellen G White’s vision from the throne and her revelation about the Flood:

“At this time immense forests were buried. These have since been changed to coal, forming the extensive coal beds that now exist, and also yielding large quantities of oil. The coal and oil frequently ignite and burn beneath the surface of the earth. Thus rocks are heated, limestone is burned, and iron ore melted. The action of the water upon the lime adds fury to the intense heat, and causes earthquakes, volcanoes, and fiery issues. As the fire and water come in contact with ledges of rock and ore, there are heavy explosions underground, which sound like muffled thunder. The air is hot and suffocating. Volcanic eruptions follow; and these often failing to give sufficient vent to the heated elements, the earth itself is convulsed, the ground heaves and swells like the waves of the sea, great fissures appear, and sometimes cities, villages, and burning mountains are swallowed up” (Patriarchs and prophets, Pacific Press, 1958, pg 108-109).

Then numerous false shepherd were to follow in the land of Ephraim:

“The chronological events that are recorded in Exodus 16 clearly define ben ha arbayim— “between the two evenings,” or “between the setting times”— as the time period that immediately FOLLOWS sunset, or ba erev” (Frederick R Coulter, The Christian Passover, p 48).

Notice that Fred Coulter has the definition as distinct different times; i.e. they do not overlap.

Hence two lamb would be needed: one to fulfil Exodus 12:6 “hā·‘ar·bā·yim” another Detueronomy 16:6 “at erev!” Hence this false shepherd is blind and naked!

“There is no question that the Passover commands in Exodus 12 have been misinterpreted and given different meanings than the true scriptural meaning of God’s ordinances and statutes delivered to Moses” (ibid, p 115). Such a loaf of greasy bullshit!

Gerald Flurry’s chronic lying claim of a Mighty Angel that had handed Malachi’s Message to him must be confused and not very articulated because Flurry in later years has to make revisions after revisions to get the messages right for his so-called Philadelphia Church of God. Flurry also prophesied that Donald Trump would serve his second term to fulfill Jeroboam II revival, “BECAUSE A BIDEN PRESIDENCY IS CONTRARY TO BIBLE PROPHECY.” What nonsense and all Flurry’s incurable BULLSH^T! (Pg 1, The Philadelphia Trumpet, January, 2021).

In fact, Gerald Flurry’s teaching is more like the original crafty Jeroboam. “It is too much for you to go up to Jerusalem. Behold thy gods, O Israel, which brought thee up out of the land of Egypt!  And he set one in Bethel, and the other put he in Dan,” (King Jeroboam: I King 12:28-29)

And in UCG‘s teaching, the morning includes the afternoon? 

And the writer wrote, “Evening is associated with darkness and night, morning is associated with day, (pg 9).

Nothing is consistent as yet a while later he wrote evening means twilight:

The term twilight means: “evening twilight; time of concealment; of refreshment; of stumbling, in dim light.” Twilight is not in the afternoon, but it is when the light grows dim, after sunset, but before complete darkness (The Passover of Exodus 12, pg 10).

Can this writer be specific and consistent since later he came back and wrote it means night again!

Genesis 1:3-5 “Then God said, ‘Let there be light,’ and there was light. And God saw the light, that it was good; and God divided the light from the darkness. God called the light Day, and the darkness He called Night. So the evening [erev, darkness, night] and the morning [boqer, light, day] were the first day.” Morning is used in Scripture to refer to the light portion of a day. The Hebrew word for night is layil. It is used as a synonym for the Hebrew erev, which is normally translated “evening” (The Passover of Exodus 12, pg 11).

So according to UCG, morning (boqer) would be day, which starts from 6 AM unto 6 PM, including the afternoon? “Morning is used in Scripture to refer to the light portion of a day.” So 1 PM, 2PM 3 PM is also morning. And evening is the whole night, from 6 PM to 6 AM. Think again. Morning includes the afternoon? Yes this is not just UCG’s morning but UCG’s insanity! 

Think again, the morning includes the afternoon? Was the writer just lying or on drugs? And this contradicts a moment later: “Next we find the expression “at evening” or “at even” (Exodus 12:18). This is the Hebrew expression ba ‘erev. In general it means sunset” (pg 12). It doesn’t mean night anymore? Blind Guides. The whole body of UCG is sick, full of coronavirus, starting with the head, and the whole Council of Elders has been infected since 1999.

This modern day of a lying and deceitful Ephraim is like going back to the ancient days of Jeroboam:

“It is too much for you to go up to Jerusalem. Behold thy gods, O Israel, which brought thee up out of the land of Egypt!” 29 And he set the one in Bethel, and the other put he in Dan . . . 31 And he made a house of high places . . . 32 And Jeroboam ordained a feast in the eighth month, on the fifteenth day of the month, like unto the feast that is in Judah. (King Jeroboam: I King 12:28-32)

For these reasons his shepherd are under rebuke followed by their judgement:

12 “Come, let me get the wine,
let us imbibe the strong drink,
and tomorrow will be like today,
only far better!”
Isaiah 56:9-12

“Who is blind, but My servant? Or deaf, as My messenger that I sent? Who is blind as he that is perfect, and blind as the Lord’s servant?” Isaiah 42:19

“Ephraim shall be desolate in the day of rebuke; among the tribes of Israel have I made known that which shall surely be” Hosea 5:9

These shepherd are currently not sanctified nor purified yet; they definitely still need to be sanctified . . .

Perhaps the two-pronged mysteries about how such sanctification and purification could occur are prophecied and explained in the book of Ezekiel

(1) Ezekiel 4 – 390/40 Years Timeline
(2) The Flaming Sword and Fire from the South!

Until these shepherd are sanctified, until they are purified, the City on the Hill doesn’t shine, and won’t shine; and their teachings are of no effect.

“Thus saith the Lord God: Woe unto the foolish prophets, who follow their own spirit and have seen nothing!
 O Israel, thy prophets are like the foxes in the deserts”
Ezekiel 13:3-4

“You only have I known… therefore I will punish you” Amos 3:2

~~~

And lastly, this is the fourth in a series on the identities of Ephraim and Manasseh, for others, see (1) The Irony of a Birthright (2) Ephraim preferred over Manasseh (3) Ephraim as the Thirteenth Tribe (4) Who is this lying Ephraim? (5) The Ox with horns of a Unicorn

Iran to Seize Control of the Strait of Hormuz

•May 9, 2026 • Leave a Comment

Becoming “a global powerhouse,” is of such a lofty incentive that Iran rolls out new Parliamentary regulations to control the Strait of Hormuz as its Domain

An emboldened Iran has extended its maritime territorial claim to include the Strait of Hormuz. What is President Donald Trump going to do?

RT News • May 8, 2026 ~ Malaysia Sun IranPressTV

Iran has officially launched a new mechanism to oversee maritime traffic through the Strait of Hormuz amid a lingering standoff with the US over the strategic waterway, state outlet Press TV reported on Tuesday.

Under the framework, ships will receive emails with transit rules they must comply with to secure permits to pass.

The move came hours after US President Donald Trump unexpectedly paused ‘Project Freedom’ – in which Western-flagged ships are given military escorts in the strait – just two days after it started.

The strait – which carries around a fifth of global seaborne oil and LNG – has effectively been blocked since US and Israeli launched strikes against Iran in late February.

Iranian forces have denied passage to US- and Israel-linked vessels, as well as ships from Western countries that support the actions against Tehran, while the US has imposed a blockade on Iranian ports, leaving tankers stranded for over two months.

Washington and Tehran remain at odds over the strait’s future, with reports saying the US rejected Iran’s latest proposal for a governance mechanism in peace talks.

Playing Cats and Mouse, the Persians challenge, Dare to invade? “Bring it on.”

According to the report, under Iran’s new scheme, vessels seeking transit will receive emails from the newly established Persian Gulf Strait Authority outlining the rules for passage. Ships must adjust operations as requested in the emails to obtain permits before passing. The report did not mention the requirements for permits.

Tehran has not officially confirmed the details, but Parliament Speaker Mohammad Bagher Ghalibaf said on X that “the new system for the Strait of Hormuz is in the process of being solidified.”

Reports say draft legislation in the Iranian parliament would ban ships linked to Israel from the strait, place strict limits on vessels tied to the US, and impose transit fees on ships from non-hostile states.

While active fighting was paused under a fragile ceasefire last month, tensions flared up again on Monday, with US and Iranian forces exchanging fire as US escorts began guiding vessels through the strait under Project Freedom – which was announced on Sunday and framed as a humanitarian effort rather than an offensive operation.

In a social media post on Tuesday, Trump said the escorts would be temporarily halted at the “request of Pakistan and other countries” to test the prospects for a deal. He touted the “tremendous military success” and “great progress” toward an agreement, adding that the US blockade on Iranian ports – which Iran considers a violation of the ceasefire and an impediment to a lasting peace deal – will remain in force.

Iranian Foreign Minister Seyed Abbas Araghchi later wrote on X that Trump’s Project Freedom “is Project Deadlock,” urging Washington to focus on Pakistani-mediated talks instead of seeking a military solution and “being dragged back into quagmire.”

Is Iran’s maritime territorial claim to include the full stretch of the Strait of Hormuz going to be the final Battle of Waterloo for President Trump?

AsiaBusinessDaily

“The Strait of Hormuz is not considered the high seas under international law. However, under the United Nations Convention on the Law of the Sea (UNCLOS), it has been recognized as an international strait connecting areas of high seas or exclusive economic zones, and the “right of transit passage” for vessels has been guaranteed.

“This latest measure is interpreted as part of Iran’s efforts to control the Strait of Hormuz following the outbreak of war in Iran. Currently, the Iranian parliament is moving swiftly to legislate Iran’s authority over the Strait of Hormuz.”

And lastly, who is Iran in biblical prophercies? Iran is a new name for ancient Persia. It was an empire ruling over a vast region 2700 years ago; but who are the lost house of Israel? For a detailed insight of the Lost Ten Tribes, we can dig deep into Ephraim and Manasseh:

Who are the posterity of biblical Jacob? And on the identities of Ephraim and Manasseh, see (1) The Irony of a Birthright (2) Ephraim preferred over Manasseh (3) Ephraim as the Thirteenth Tribe (4) Who is this lying Ephraim? (5) The Ox with horns of a Unicorn

Exodus (31-32)

•May 9, 2026 • Leave a Comment

~~~~

Q. As the Ark of the Covenant is so powerful, Could on one unexpected day the Jews bring out the Ark and cause both the Dome of the Rock and the Al-Aqsa Mosque to collapse?

Exodus 31

1 And the Lord spoke unto Moses, saying,

“See, I have called by name Bezaleel the son of Uri, the son of Hur, of the tribe of Judah. — I have called by name. God “calls by name” only those whom he appoints to some high office, as Moses (Exodus 3:4, 33:12), Cyrus (Isaiah 45:3, 4), and here Bezaleel and Aholiab.

God raise up Bezaleel and Aholiab for the crafting of his vessels and edifices

And I have filled him with the Spirit of God, in wisdom and in understanding and in knowledge and in all manner of workmanship, — I have filled him with the spirit of God; wisdom, understanding and knowledge; and in all manner of artistic workmanship;

to devise skillful works: to work in gold and in silver and in brass, — to be skillful goldsmiths or brasiers;

and in cutting of stones to set them, and in carving of timber, to work in all manner of workmanship. — to be a first-class artisan, competent to take charge of both the plain and ornamental work, which the building of any sacred edifice required;

And I, behold, I have given with him Aholiab, the son of Ahisamach, of the tribe of Dan; and in the hearts of all who are wisehearted I have put wisdom, that they may make all that I have commanded thee: — Aholiab, of the tribe of Dan; to be a partner with Bezaleel, as Moses and Aaron,

the tabernacle of the congregation, and the ark of the Testimony and the mercy seat that is thereupon, and all the furniture of the tabernacle,

and the table and his furniture, and the pure candlestick with all his furniture, and the altar of incense,

and the altar of burnt offering with all his furniture, and the laver and his foot,

10 and the clothes of service, and the holy garments for Aaron the priest and the garments of his sons to minister in the priest’s office,

11 and the anointing oil and sweet incense for the holy place. According to all that I have commanded thee shall they do.”

13 “Speak thou also unto the children of Israel, saying, ‘Verily My Sabbaths ye shall keep; for it is a sign between Me and you throughout your generations, that ye may know that I am the Lord who doth sanctify you.

— it is a sign between me and you; throughout your generations; a token of the covenant between them, of his being their God and they his people in a peculiar sense;

— one which no other nations of the world observe; of his sanctifying and separating them from all other people; for this was not a sign between him and other nations, but between him and the people of Israel only; and was to be observed throughout their ages.

14 Ye shall keep the Sabbath therefore, for it is holy unto you. Every one who defileth it shall surely be put to death; for whosoever doeth any work therein, that soul shall be cut off from among his people.

— for it is holy unto you; a day that was set apart of God for holy exercises, and by doing any servile work upon it, or not observing it in a religious way, shall surely be put to death;

— every one that defileth it shall surely be put to death; this is a serious enactment, and must be regarded in conjunction with the dignity attached to Sabbath observance by its having become the special covenant sign between God and His people.

15 Six days may work be done, but on the seventh is the Sabbath of rest, holy to the Lord. Whosoever doeth any work on the Sabbath day, he shall surely be put to death.

— but the seventh is the sabbath of rest; and holy to the Lord; separated from other days, and entirely devoted to the worship and service of God, and to be kept holy to the Lord in all holy and religious exercises, as hearing and studying the word, and prays.

16 Therefore the children of Israel shall keep the Sabbath, to observe the Sabbath throughout their generations for a perpetual covenant. — for a perpetual covenant, or by a perpetual covenant, or it is a perpetual covenant, that is, not to be obsolete but a perpetual agreement.

17 It is a sign between Me and the children of Israel for ever; for in six days the Lord made heaven and earth, and on the seventh day He rested and was refreshed.’” — t is a sign, repeated for emphasis as a sign of the covenant between God and Israel.

18 And He gave unto Moses, when He had made an end of communing with him upon Mount Sinai, two tablets of testimony, tablets of stone, written with the finger of God. — written with the finger of God, that is, by God himself, and not by an angel; but with the power or Spirit of God.

The two tablets of testimony, tablets of stone, written with the finger of God

Exodus 32

1 And when the people saw that Moses delayed to come down out of the mount, the people gathered themselves together unto Aaron and said unto him, “Arise, make us gods which shall go before us; for as for this Moses, the man who brought us up out of the land of Egypt, we know not what has become of him.”

— how ridiculous the assertion that “the people” did not know what had become of Moses! They knew that he was up there with God. The elders, Aaron, Joshua and Hur, would have told them that; the fire on the mount would have burned in on all minds the confirmation. They were just rebellious!

And Aaron said unto them, “Break off the golden earrings which are in the ears of your wives, of your sons and of your daughters, and bring them unto me.”

— Aaron’s compliance just a reflection of his cowardice and under Satan’s influence, Jonathan; he knew as well as what he should have said, but, like many another man in influential position, when beset by popular cries, he was frightened, and yielded.

And all the people broke off the golden earrings which were in their ears, and brought them unto Aaron. — all the people brake off the golden earrings;

— Aaron had miscalculated the strength of the people’s fanaticism; ot the slightest resistance was offered to his requirement. “All the people,” with one accord, surrendered their earrings ready for idol worship.

And he received them from their hand, and fashioned it with an engraving tool after he had made it a molten calf; and they said, “These are thy gods, O Israel, which brought thee up out of the land of Egypt!”

— a molten calf; it has been usual to regard the selection of the “calf” form for the image as due to Egyptian influences; a sacred bull, called Apis, was worshipped at Memphis, and another, called Mnevis, at Heliopolis, both being regarded as actual incarnate deities.

And when Aaron saw it, he built an altar before it; and Aaron made proclamation and said, “Tomorrow is a feast to the Lord.” — and when Aaron saw the molten calf, he made proclamation, “tomorrow is a feast to the Lord;”

— the Targums of Jonathan and Jerusalem paraphrase it, “and Aaron saw Hur slain before him,” for reproving them of their idolatry, that is, Aaron, fearing they would also take away his life if he opposed them, he quickly grant his approval of idol worship;

And they rose up early on the morrow, and offered burnt offerings, and brought peace offerings; and the people sat down to eat and to drink, and rose up to play.

— they rose up early; to show their zeal these idolaters began early in the morning, and offered burnt-offerings; and to play; to dance and sing, as was done by the Egyptians in the worship of their Apis or Ox.

And the Lord said unto Moses, “Go, get thee down; for thy people which thou broughtest out of the land of Egypt have corrupted themselves.

— the Lord said unto Moses, Go, get thee down; Moses was, of course, wholly ignorant of all that had occurred in the camp. The thick cloud which covered the top of Sinai had prevented his seeing what occurred in the plain below;

— for thy people which thou broughtest out of the land of Egypt have corrupted themselves; their works, their ways and their manners; their minds, the imaginations of their hearts, were first corrupted, and made themselves abominable in the sight of God.

They have turned aside quickly out of the way which I commanded them. They have made themselves a molten calf and have worshiped it, and have sacrificed thereunto and said, ‘These are thy gods, O Israel, which have brought thee up out of the land of Egypt!’”

— they have turned aside quickly, quickly after the law was given them, and they had promised to obey it; quickly after God had done such great things for them, and declared his kind intentions to do greater.

And the Lord said unto Moses, “I have seen this people, and behold, it is a stiffnecked people.

— it is a stiff-necked people; it is generally explained as “obstinate,” but rather means “perverse,” the metaphor being taken from the horse that stiffens his neck against the pull of the rein, and will not be guided by the rider.

10 Now therefore let Me alone, that My wrath may wax hot against them, and that I may consume them; and I will make of thee a great nation.”

— now, therefore, let me alone, the Targum of Jonathan says, “and now leave off thy prayer, and do not cry for them before me;” as the Prophet Jeremiah was often bid not to pray for this people in his time, which was a token of God’s great displeasure with them;

— full text from Targum of Jonathan

And now, cease from thy prayer, and cry not for them before Me; for I will let My anger burn like strong fire against them, and consume them, and I will make thee a great people.

11 And Moses besought the Lord his God and said, “Lord, why doth Thy wrath wax hot against Thy people, whom Thou hast brought forth out of the land of Egypt with great power and with a mighty hand?

— and Moses besought the Lord his God; if God would not be called the God of Israel, yet he hoped he might address him as his own God.

12 Why should the Egyptians speak and say, ‘For mischief did He bring them out, to slay them in the mountains and to consume them from the face of the earth’? Turn from Thy fierce wrath, and repent of this evil against Thy people.

— turn from thy fierce wrath, and repent of this evil against thy people; but this is said after the manner of men concerning him, when he alters the course of his dealings with men according to his unalterable will.

13 Remember Abraham, Isaac, and Israel, Thy servants to whom Thou sworest by Thine own self and saidst unto them, ‘I will multiply your seed as the stars of heaven, and all this land that I have spoken of will I give unto your seed, and they shall inherit it for ever.’”

— to whom thou swarest by thine own self; which he did, because he could swear by no greater; and for the confirmation of his covenant and promise, Genesis 22:16.

14 And the Lord repented of the evil which He thought to do unto His people. — and the Lord repented of the evil which he thought to do unto his people; he did not do what he threatened to do, but a change of mind and did what Moses desired he would.

15 And Moses turned and went down from the mount, and the two tablets of the testimony were in his hand. The tablets were written on both their sides; on the one side and on the other were they written.

— Moses carries them in both hands, being of stone; Targum of Jonathan says “and the two tables of the testimony were in his hands.”

16 And the tablets were the work of God, and the writing was the writing of God, graven upon the tablets. — and the tables were the work of God; not of angels or men; the stones were made and formed by God into the shape they were; and the writing was the writing of God, graven upon the tables.

17 And when Joshua heard the noise of the people as they shouted, he said unto Moses, “There is a noise of war in the camp.” — Joshua had waited upon the middle of the mount for Moses, and so knew neither what the people had done, nor heard what God had said to Moses;

— and when Joshua heard the noise of the people, as they shouted; dancing about the calf: when Moses went up into the mount, Joshua went with him, and tarried in a middle part of the mount all the forty days until he returned.

18 And Moses said, “It is not the voice of them that shout for mastery, neither is it the voice of them that cry for being overcome; but the noise of them that sing do I hear.”

— but the noise of them that sing do I hear; as at a merry entertainment; Moses, who knew what the children of Israel had done, and what they were about, could better judge of the nature of the sound he heard than Joshua could, who knew nothing of what was transacting.

19 And it came to pass, as soon as he came nigh unto the camp, that he saw the calf and the dancing; and Moses’ anger waxed hot, and he cast the tablets out of his hands and broke them beneath the mount. — and he cast the tablets out of his hands, and brake them at the foot of Sinai;

— he brought the tablets, told them what they were, and writing them with his own fingers, engraving them himself on such tablets of stone; and then broke them to pieces, to show that they had broken these laws, and this he did before their eyes;

— the Targum of Jonathan reveals the influence of Satan, saying

“And it was, when Moses drew near to the camp and saw the Calf and the dances in the hands of the wicked ones, dancing and bowing before it; and Satan was within it, skipping and leaping before the people.

“Immediately, the wrath of Moses blazed hot, and he cast the Tablets from his hands and shattered them at the foot of the mountain.

“However, the Holy Writing that was upon them flew and soared into the air of the heavens, and it was crying out and saying: ‘Woe to the people who heard at Sinai from the mouth of the Holy One: Do not make for yourselves an image, form, or any likeness, yet at the end of forty days they have made a molten calf in which there is no substance!'”

20 And he took the calf which they had made and burned it in the fire and ground it to powder, and strewed it upon the water and made the children of Israel drink of it.

— ground it to powder; melted it either into one great mass, or rather into divers little fragments, which afterwards by a the or other instruments he, by the help of many others, might soon grind to powder, or dust of gold.

21 And Moses said unto Aaron, “What did this people unto thee, that thou hast brought so great a sin upon them?” — and Moses said unto Aaron; having destroyed the calf, and thereby expressed his abhorrence of their idolatry,

— he examines the cause and reason of it; and begins with Aaron, though his own brother, with whom he had committed the government of the people during his absence.

22 And Aaron said, “Let not the anger of my lord wax hot. Thou knowest the people, that they are set on mischief. — and Aaron said, Let not the anger of my lord wax hot; Aaron cuts a poor figure, making a shuffling excuse and betraying more dread of the anger of Moses than of the Lord.

23 For they said unto me, ‘Make us gods which shall go before us; for as for this Moses, the man who brought us up out of the land of Egypt, we know not what has become of him.’ — we wot not what is become of him; their words because they carried in them some reflection on Moses for staying so long in the mount;

— and as if that contributed much to this affair, and which put the people on forming such a scheme, they concluding he must be dead by then, as the Targum of Jonathan says, be consumed in the mountain, by the flaming fire from before the Lord.

24 And I said unto them, ‘Whosoever hath any gold, let them break it off.’ So they gave it to me. Then I cast it into the fire, and there came out this calf.”

— and there came out this calf; he speaks of it as if the gold became in the form of a calf without any design, or without using any methods to put it in this form; as if done by the work of magic;

— the Targum of Jonathan says,

And I said to them, Whoever hath gold, let him deliver and give it to me; and I cast it into the fire, and Satan entered into it, and there came out of it the similitude of this calf!

25 And when Moses saw that the people were naked (for Aaron had made them naked unto their shame among their enemies),

— Moses saw that the people were naked; the obvious meaning of the word פרע, parua (unrestrained) used here; it is the sense they were stripped of their ornament and armour, besides their jewels; and gotten out of control;

26 then Moses stood in the gate of the camp and said, “Who is on the Lord’S side? Let him come unto me.” And all the sons of Levi gathered themselves together unto him.

— the tribe of Levi, Moses’ own tribe, now distinguished itself by immediately returning to its allegiance and obeying the call to fight on the side of Moses.

27 And he said unto them, “Thus saith the Lord God of Israel: ‘Put every man his sword by his side, and go in and out from gate to gate throughout the camp, and slay every man his brother, and every man his companion, and every man his neighbor.’”

— and go in and out from gate to gate throughout the camp; not into the tents, where good men might be bemoaning their sins, but throughout the streets, where many were loitering, they showed no sign of any remorse by these idolaters;

— and slay every man his brother, and every man his companion, and every man his neighbour; who were idolaters; none were to be spared on account of relation, friendship or acquaintance.

28 And the children of Levi did according to the word of Moses, and there fell of the people that day about three thousand men. — about 3000 men fell by their sword on that day; and if Levi stood the test, how did Aaron escape his penalty?

— the Levites were to slay those of this wickedness; yet escaped being executed but those who openly stood forth; those who persisted in shouting and dancing, after night were dying, even into the morning; these sinners feel secure and jovial in their sin.

29 For Moses had said, “Consecrate yourselves today to the Lord, even every man upon his son and upon his brother, that He may bestow upon you a blessing this day.”

— consecrate yourselves; that is, offer a sacrifice, “and make atonement for yourselves before the Lord,” as the Targum of Jonathan says.

30 And it came to pass on the morrow that Moses said unto the people, “Ye have sinned a great sin. And now I will go up unto the Lord. Perhaps I shall make an atonement for your sin.”

— and I will go up unto the Lord: on the top of Mount Sinai: and I shall make atonement for your sin; not by any sacrifice offered, but to intercede on their behalf for God to forgive their sin.

God wrote them with his fingers in Paleo-Hebrew, not square script Hebrew

31 And Moses returned unto the Lord and said, “Oh, this people have sinned a great sin, and have made themselves gods of gold. — Moses said unto the people, Ye have sinned a great sin; he had labored to show the people the heinous nature of their sin, and to bring them to repentance.

32 Yet now, if Thou wilt forgive their sin — and if not, blot me, I pray Thee, out of Thy book which Thou hast written!” — as a true mediator of his people, Moses was ready to stake his own life for the deliverance of the nation, and not just to live before God himself.

33 And the Lord said unto Moses, “Whosoever hath sinned against Me, him will I blot out of My book. — whosoever hath sinned against me, him will I blot out: Ezekiel 18:4; “the soul that sinneth, it shall die.”

34 Therefore now go, lead the people unto the place of which I have spoken unto thee; behold, Mine angel shall go before thee. Nevertheless in the day when I visit I will visit their sin upon them.”

— my angel shall go before thee; the promise is, as nearly as possible, a repetition of the original one, “Behold, I send an angel before thee, to keep thee in the way, and to bring thee into the place which I have prepared” Exodus 23:20.

35 And the Lord plagued the people, because they made the calf which Aaron made. — the Lord plagued the people, because they made the calf; no immediate judgements were inflicted, but this early lapse into idolatry was always mentioned as an aggravation of their subsequent apostasies;

— the Lord plagued the people; I will visit their sin upon them; when I shall punish them for their other sins, which I foresee they will commit; and I will remember and punish this also.

Iran Extended Maritime Zone

•May 8, 2026 • Leave a Comment

Iran’s IRGC has established a new maritime control zone in the Strait of Hormuz. Meanwhile, Iran’s Foreign Ministry confirmed receiving a US counter-proposal via Pakistan to halt the conflict, though details remain under review due to “excessive demands.”

President Trump stated discussions are “very positive” but also rejected Iran’s latest proposal as “not acceptable.”

Feeling emboldened, Iran has extended its maritime territorial claim to include the Strait of Hormuz. What is President Donald Trump going to do?

EconomicTimes • May 6, 2026 ~ AsiaNetNews aaj.tv IranMirror

Tehran: The Islamic Revolutionary Guard Corps has announced a new maritime control zone in the Strait of Hormuz, as per a report by Tasnim News Agency on Monday.

According to the Iranian state broadcaster, the IRGC declared a new maritime control area in the Strait of Hormuz. The new zone of “smart control” has the line between Mount Mobarak in Iran and south of Fujairah in the United Arab Emirates in the south, and the line between the end of Qeshm Island in Iran and Umm Al Quwain in the United Arab Emirates in the west.

Meanwhile, Iran’s Foreign Ministry spokesperson Esmail Baghaei has confirmed that officials are currently assessing a counter-proposal from the United States aimed at halting the ongoing conflict, according to a report by Al Jazeera.

Addressing a press conference, Baghaei noted that “the US message was received through Pakistan” and stated that he “will not discuss the details of the issues raised at this time, because these issues are still under review.”

The spokesperson highlighted the difficulties in the negotiation process, suggesting that the American approach of making “excessive and unreasonable demands” ensures the proposal “is not easy to review.”

Addressing recent media coverage regarding Tehran’s atomic ambitions, Baghaei dismissed reports concerning negotiations over its nuclear programme as being “mostly speculation.”

Is Iran’s maritime territorial claim to include the full extent of the Strait of Hormuz going to be the Battle of Waterloo for President Donald Trump? 

Earlier, a spokesman for the Iranian military said that all commercial ships and oil tankers should not move in the Strait of Hormuz without contacting Iran.

Iran has complete control over the Strait of Hormuz, and the US Navy should not even come close to it.

He warned that Iran would respond strongly to any threat to its sovereignty. Ebrahim Azizi said that US intervention in the Strait of Hormuz would be considered a violation of the ceasefire.

And lastly, who is Iran in biblical prophercies? Iran is a new name for ancient Persia. It was an empire ruling over a vast region 2700 years ago; but who are the lost house of Israel? For a detailed insight of the Lost Ten Tribes, we can dig deep into Ephraim and Manasseh:

Who are the posterity of biblical Jacob? And on the identities of Ephraim and Manasseh, see (1) The Irony of a Birthright (2) Ephraim preferred over Manasseh (3) Ephraim as the Thirteenth Tribe (4) Who is this lying Ephraim? (5) The Ox with horns of a Unicorn

Here are the key highlights of the 14-points memo the US imposes Iran to consider

  • In its current form, the memorandum would declare an end to the war in the region.
  • Start a 30-day period of negotiations on a detailed agreement to open Hormuz, limit Iran’s nuclear programme, and lift US sanctions.
  • Iran’s restrictions on shipping through the strait and the US naval blockade would be gradually lifted during the 30-day period.
  • If the negotiations collapsed, US forces would be able to restore the blockade or resume military action against Iran, a US official said.
  • US is actively negotiating the duration of the moratorium on Iran’s uranium enrichment, with three sources saying it would be at least 12 years and one putting 15 as a likely landing spot.
  • Iran proposed a 5-year moratorium on enrichment, while the US demanded a 20-year moratorium.
  • Washington wants to insert a provision whereby any Iranian violation of enrichment would prolong the moratorium, the source said.
  • Iran, however, would be able to enrich to the low level of 3.67% after the provision expires.
  • Washington also seeks Tehran to commit to never seeking a nuclear weapon or conducting weaponisation-related activities.
  • Further, a US official said that the two sides are also discussing a clause whereby Iran would commit not to operate underground nuclear facilities.
  • Iran would also commit to an enhanced inspections regime, including snap inspections by UN inspectors, according to the US official.
  • On Washington’s part, it would commit to a gradual lifting of the sanctions on Iran and the gradual release of billions of dollars in Iranian funds, frozen around the world.
  • Two sources also claimed Tehran would agree to remove its highly enriched uranium from the country, with one source saying an option was being discussed to move the material to the US.

Trump has threatened renewed violence against Iran, writing on his Truth Social platform that if Iran did not agree to a deal “the bombing starts, and it will be, sadly, at a much higher level and intensity than it was before.”

Exodus (29-30)

•May 8, 2026 • Leave a Comment

~~~~

Q. Could on one unexpected day the Jews bring out the Ark of the Covenant and cause both the Dome of the Rock and the Al-Aqsa Mosque to collapse?

Exodus 29

~~~~

This chapter deals with Aaron and his son, their purification and anointing

1 “And this is the thing that thou shalt do unto them to hallow them, to minister unto Me in the priest’s office: Take one young bullock and two rams without blemish, — this is the thing that thou shalt do unto the priests; that is, Aaron and his sons; their consecration had been commanded in the preceding chapter;

and unleavened bread and cakes unleavened tempered with oil, and wafers unleavened anointed with oil — of wheat flour shalt thou make them; — unleavened bread as used during Passover, purer than leavened, since fermentation was viewed as corrupted.

and thou shalt put them into one basket and bring them in the basket, with the bullock and the two rams. — the bullock and the two rams in the basket; along with the bread, cakes, and wafers; to be brought to the door of the tabernacle, to the altar, in order to be slain and sacrificed.

And Aaron and his sons thou shalt bring unto the door of the tabernacle of the congregation, and shalt wash them with water. — Aaron and his sons shalt be washed; a symbol of purity, also to signify that they must be clean who bear the vessels and work of the Lord.

And thou shalt take the garments, and put upon Aaron the coat and the robe of the ephod and the ephod and the breastplate, and gird him with the embroidered girdle of the ephod. — and the robe of the ephod: which was all of blue, and had pomegranates and golden bells at the hem of it; this was put over the broidered coat;

— and the breastplate; with the Urim and Thummim in it, or the twelve precious stones on which were engraven the names of the twelve tribes of Israel, which hung down over the breast by wreathen chains of gold, from the shoulder pieces of the ephod;

And thou shalt put the miter upon his head and put the holy crown upon the miter. — and Moses shall put the holy crown upon the mitre; the holy crown was a plate of gold or a diadem which had these words, “holiness to the Lord” engraven on it;

— and says the Targum of Jonathan, “And thou shalt set the mitre on his head, and put the diadem upon which is engraven the Name of Holiness upon the mitre;” the mitre was on top of Aaron’s head, and upon his forehead.

Then shalt thou take the anointing oil, and pour it upon his head and anoint him. — and Moses shall pour the oil upon Aaron’s head, between his eyebrows; and anoint him;

— the investiture of Aaron’s sons; they do not seem to have been anointed, as Aaron was, by having the holy oil poured upon their heads, but only by having some of it sprinkled upon their garments.

And thou shalt gird them with girdles, Aaron and his sons, and put the bonnets on them. And the priest’s office shall be theirs for a perpetual statute; and thou shalt consecrate Aaron and his sons. — and thou shall consecrate Aaron and his sons; or “fill the hand of them” that is, with sacrifices to offer for themselves and others;

And Aaron and his sons together shall put their hands upon the head of the bullock

10 “And thou shalt cause a bullock to be brought before the tabernacle of the congregation, and Aaron and his sons shall put their hands upon the head of the bullock. — “to be brought before the tabernacle” means outside the tabernacle; and thus the altar was a much larger one;

— and Aaron and his sons shall put their hands upon the head of the bullock; not Aaron first alone, and then his sons, but all together, not one after another;

11 And thou shalt kill the bullock before the Lord by the door of the tabernacle of the congregation. — and thou shalt kill the bullock before the Lord; that is, Moses being ordered to do it, who now officiated as a priest; Aaron and his sons not yet completely invested with that office, or thoroughly consecrated to it, yet.

12 And thou shalt take of the blood of the bullock, and put it upon the horns of the altar with thy finger, and pour all the blood alongside the bottom of the altar. — that some of the victim’s blood should be smeared upon the altar’s horns; and the remainder should be poured at its base.

13 And thou shalt take all the fat that covereth the inwards, and the caul that is above the liver, and the two kidneys and the fat that is upon them, and burn them upon the altar.

14 But the flesh of the bullock and his skin and his dung shalt thou burn with fire outside the camp. It is a sin offering. — shalt thou burn with fire outside the camp; so the Messiah, the antitype, suffered outside the gates of Jerusalem a most painful and shameful death.

15 “Thou shalt also take one ram, and Aaron and his sons shall put their hands upon the head of the ram. — and Aaron and his sons shall put their hands upon the head of the ram; confessing their sins; acknowledging their guilt,

— and by this act transferring the same to the ram, which was to be a burnt offering, and was typical of the imputation of sin to the Messiah, or the Son of God, the mediator.

16 And thou shalt slay the ram, and thou shalt take his blood and sprinkle it round about upon the altar. — and thou shall take his blood, and sprinkle it round about upon the altar; the blood being received into a basin;

— it was not to be put upon the altar with the finger, as the blood of the bullock, but was to be sprinkled probably with a bunch of hyssop, round about upon the altar;

— this may signify that his blood has its virtue and efficacy from that, to make atonement for the sins of men, and to cleanse men from their sins.

17 And thou shalt cut the ram in pieces, and wash the inwards of him and his legs, and put them on top of his pieces and on top of his head; — and put them unto his pieces, and unto his head; lay them together, so that they might be entirely consumed at once.

18 and thou shalt burn the whole ram upon the altar. It is a burnt offering unto the Lord: it is a sweet savor, an offering made by fire unto the Lord. — for a smell of sweet savour, or a sweet smelling savour; an offering pleasing to God.

19 “And thou shalt take the other ram, and Aaron and his sons shall put their hands upon the head of the ram. —and Aaron and his sons shall put their hands on the head of the ram, as they were to do, and did, upon the head of the other.

20 Then shalt thou kill the ram, and take of his blood and put it upon the tip of the right ear of Aaron, and upon the tip of the right ear of his sons, and upon the thumb of their right hand, and upon the great toe of their right foot, and sprinkle the blood upon the altar round about.

— and put it upon the tip of the right ear of Aaron, and upon the tip of the right ear of his sons; upon the great toe of their right foot, it sanctified their whole walk in life, their “going out,” and their “coming in;” and sprinkle the blood upon the altar round about; as was done with the blood of the other ram.

21 And thou shalt take of the blood that is upon the altar and of the anointing oil, and sprinkle it upon Aaron and upon his garments, and upon his sons and upon the garments of his sons with him; and he shall be hallowed, and his garments, and his sons and his sons’ garments with him.

22 “Also thou shalt take of the ram the fat, and the rump, and the fat that covereth the inwards, and the caul above the liver, and the two kidneys and the fat that is upon them, and the right shoulder (for it is a ram of consecration),

23 and one loaf of bread and one cake of oiled bread, and one wafer out of the basket of the unleavened bread that is before the Lord.

24 And thou shalt put all in the hands of Aaron and in the hands of his sons, and shalt wave them for a wave offering before the Lord. — and shalt wave before the Lord: which was waved or shook to and fro, from east to west, and from north to south, to or before him, whose are the four winds of the world;

— this was done by Moses and Aaron; “both were employed in waving, both the owners and the priest, how? the priest put his hand under the hand of the owner and waved, and in this Aaron and his sons were the owners and Moses the priest.”

25 And thou shalt receive them from their hands, and burn them upon the altar for a burnt offering, for a sweet savor before the Lord. It is an offering made by fire unto the Lord. — for a sweet savour before the Lord; that it might be pleasing and acceptable to him.

26 “And thou shalt take the breast of the ram of Aaron’s consecration, and wave it for a wave offering before the Lord; and it shall be thy part.

27 And thou shalt sanctify the breast of the wave offering and the shoulder of the heave offering, which is waved and which is heaved up, of the ram of the consecration, even of that which is for Aaron and of that which is for his sons.

28 And it shall be Aaron’s and his sons’ by a statute for ever from the children of Israel, for it is a heave offering; and it shall be a heave offering from the children of Israel from the sacrifice of their peace offerings, even their heave offering unto the Lord.

29 “And the holy garments of Aaron shall be his sons’ after him, to be anointed therein and to be consecrated in them. — for the priesthood continued in Aaron’s family by succession, the eldest son being high priest.

30 And that son who is priest in his stead shall put them on seven days, when he cometh into the tabernacle of the congregation to minister in the holy place. — shall put them on seven days; the next successor was to wear the garments seven days running.

31 “And thou shalt take the ram of the consecration and boil his flesh in the holy place. — in the courtyard at the door of the tabernacle, where it was both boiled and eaten.

32 And Aaron and his sons shall eat the flesh of the ram, and the bread that is in the basket by the door of the tabernacle of the congregation.

33 And they shall eat those things with which the atonement was made, to consecrate and to sanctify them; but a stranger shall not eat thereof, because they are holy.

— but a stranger shall not eat thereof, because they are holy; meaning not just one of another nation, but of another family, though an Israelite;

— the Targum of Jonathan renders it, a profane or common person, a layman, one that was not a priest; who, though he was of the seed of Israel, yet not being of the seed of Aaron, as he might not eat of the above things, because they were devoted to holy use.

34 And if aught of the flesh of the consecrations or of the bread remain unto the morning, then thou shalt burn the remainder with fire. It shall not be eaten, because it is holy. — it was not to be given to a stranger, nor to be cast to dogs.

35 “And thus shalt thou do unto Aaron and to his sons, according to all things which I have commanded thee. Seven days shalt thou consecrate them. — to make it the more solemn and efficacious, the entire sacrifice and ceremony are to be repeated every day for seven days.

36 And thou shalt offer every day a bullock for a sin offering for atonement; and thou shalt cleanse the altar when thou hast made an atonement for it, and thou shalt anoint it to sanctify it. — and thou shall offer every day a bullock for a sin offering for atonement; that is, every day of the seven days of consecration.

37 Seven days thou shalt make an atonement for the altar and sanctify it; and it shall be an altar most holy. Whatsoever toucheth the altar shall be holy. — whatsoever toucheth the altar shall be holy; that is, must be holy; nothing which is not holy must touch it;

— that such should be holy who were of the sons of Aaron, but of the rest of the people it was not lawful for them to draw nigh; the Targum of Jonathan adds “lest they be burned with the fiery flame which cometh from the holy place.”

38 “Now this is that which thou shalt offer upon the altar: two lambs of the first year, day by day continually. — two lambs day by day continually; which is the daily sacrifice.

39 The one lamb thou shalt offer in the morning, and the other lamb thou shalt offer at evening. — a lamb offered upon the altar every morning, and the other every evening; a term from the Hebrew idiom, hā·‘ar·bā·yim, “between the two evenings.”

What time is ben ha arbayim?

40 And with the one lamb a tenth part of flour mingled with a fourth part of a hin of beaten oil, and a fourth part of a hin of wine for a drink offering.

41 And the other lamb thou shalt offer at evening, and shalt do thereto according to the meat offering of the morning and according to the drink offering thereof, for a sweet savor, an offering made by fire unto the Lord.

42 “This shall be a continual burnt offering throughout your generations at the door of the tabernacle of the congregation before the Lord, where I will meet you to speak there unto thee.

— this shall be a continual burnt offering throughout your generations; to be offered up morning and evening in every age; at “the tabernacle of meeting, where I will meet you.”

43 And there I will meet with the children of Israel, and [the tabernacle] shall be sanctified by My glory. — not only with Moses or with Aaron, and his sons, but with the people themselves, by granting them his gracious presence in public ordinances; “and (Israel) shall be sanctified through My glory.”

— “the tabernacle” is added, since they are not in the original; but it makes more sense to substitute the space with Israel, that is, the people that are sanctified by his glory.

44 And I will sanctify the tabernacle of the congregation and the altar. I will sanctify also both Aaron and his sons to minister to Me in the priest’s office. — the tabernacle and the altar were sanctified, or set apart for holy uses, as well as cleansed and expiated by sacrifices;

— I will sanctify also both Aaron and his sons, to minister to me in the priest’s office.

45 And I will dwell among the children of Israel and will be their God. — I will dwell among the children of Israel; it is the fulfilment of this promise by the presence of the Shekinah within the Tabernacle; will watch over them as a nation, by a peculiar providence.

46 And they shall know that I am the Lord their God, who brought them forth out of the land of Egypt, that I may dwell among them. I am the Lord their God.

— I am the Lord their God; of which he had given full proof and evidence by what he had done for them, and would yet give more; and to have the Lord our God with the greatest protection and happiness that can be enjoyed.

Exodus 30

The tabernacle, and subsequently the Temple, were arranged in three compartments: the outermost court, which was accessible to all Israelites; the second, which could only be trodden by the priests alone; and the third, where the Shekinah dwelt in solitude, broken only once a year by the presence of the High Priest.

1 “And thou shalt make an altar to burn incense upon; of shittim wood shalt thou make it. — an altar to burn incense; not an altar to burn sacrifices: cows bulls, lambs and others; here it is called the incense of spices or perfumes.

A cubit shall be the length thereof and a cubit the breadth thereof. Foursquare shall it be, and two cubits shall be the height thereof. The horns thereof shall be part of the same. — the main altar outside for sacrifices is much larger, five cubits square and three cubit in height.

And thou shalt overlay it with pure gold, the top thereof and the sides thereof round about, and the horns thereof; and thou shalt make unto it a crown of gold round about. — the top thereof, and the sides thereof, and the horns thereof: all and each of them were covered with gold; this altar had a top.

And two golden rings shalt thou make for it under the crown of it, by the two corners thereof; upon the two sides of it shalt thou make it; and they shall be for places for the staves to bear it.

And thou shalt make the staves of shittim wood and overlay them with gold. — and thou shalt make the staves of shittim wood; that is, of the same wood the altar itself was made.

And thou shalt put it before the veil that is by the ark of the Testimony, before the mercy seat that is over the Testimony, where I will meet with thee. — this altar to burn incense is to be placed in the sanctuary just before the veil; between the candlestick and the table of shewbread, outside the Holy of Holies.

And Aaron shall burn thereon sweet incense every morning. When he dresseth the lamps, he shall burn incense upon it. — Aaron was to burn sweet incense upon this altar every morning and every evening.

And when Aaron lighteth the lamps at evening, he shall burn incense upon it, a perpetual incense before the Lord throughout your generations. — a perpetual incense before the Lord throughout your generations; no “strange incense” was to be offered upon it.

Ye shall offer no strange incense thereon, nor burnt sacrifice, nor meat offering; neither shall ye pour drink offering thereon. — burnt sacrifice and meat offering are offered in another larger altar outside the sancturay.

10 And Aaron shall make an atonement upon the horns of it once in a year with the blood of the sin offering of atonements. Once in the year shall he make atonement upon it throughout your generations. It is most holy unto the Lord.” — this atonement made on the Day of Atonement; once in the year; the tenth day of the seventh month.

11 And the Lord spoke unto Moses, saying,

12 “When thou takest the sum of the children of Israel according to their number, then shall they give every man a ransom for his soul unto the Lord when thou numberest them, that there be no plague among them when thou numberest them.

— that there be no plague among them; if a man did not feel his need of “ransom,” and gladly pay the small sum at which the ransom was fixed, he would show himself so proud and presumptuous that he might well provoke a Divine “plague,” or punishment.

13 This they shall give, every one that passeth among them that are numbered: half a shekel according to the shekel of the sanctuary (a shekel is twenty gerahs); a half shekel shall be the offering to the Lord. — king David offended in not demanding payment of this tribute or atonement-tax when he numbered the people.

14 Every one who passeth among them that are numbered, from twenty years old and above, shall give an offering unto the Lord.

15 The rich shall not give more and the poor shall not give less than half a shekel, when they give an offering unto the Lord to make an atonement for your souls.

16 And thou shalt take the atonement money of the children of Israel, and shalt appoint it for the service of the tabernacle of the congregation, that it may be a memorial unto the children of Israel before the Lord, to make an atonement for your souls.”

MSG

God spoke to Moses: “When you take a head count of the Israelites to keep track of them, all must pay an atonement-tax to God for their life at the time of being registered so that nothing bad will happen because of the registration.

“Everyone who gets counted is to give a half-shekel (using the standard Sanctuary shekel of a fifth of an ounce to the shekel)—a half-shekel offering to God. Everyone counted, age twenty and up, is to make the offering to God.

“The rich are not to pay more nor the poor less than the half-shekel offering to God, the atonement-tax for your lives. Take the atonement-tax money from the Israelites and put it to the maintenance of the Tent of Meeting. It will be a memorial fund for the Israelites in honor of God, making atonement for your lives.”

17 And the Lord spoke unto Moses, saying,

18 “Thou shalt also make a laver of brass, with his foot also of brass, for washing; and thou shalt put it between the tabernacle of the congregation and the altar, and thou shalt put water therein.

— a round, cauldron-shaped vessel for use by the officiating priests to wash before their entrance on their ministry; and indicates in general the necessity of purity.

A laver of brass for washing between the tabernacle and the altar

19 For Aaron and his sons shall wash their hands and their feet thereat.

20 When they go into the tabernacle of the congregation, they shall wash with water, that they die not. Or when they come near to the altar to minister, to burn offering made by fire unto the Lord,

21 so they shall wash their hands and their feet, that they die not. And it shall be a statute for ever to them, even to him and to his seed throughout their generations.”

22 Moreover the Lord spoke unto Moses, saying,

23 “Take thou also unto thee principal spices: of pure myrrh five hundred shekels, and of sweet cinnamon half as much (even two hundred and fifty shekels), and of sweet calamus two hundred and fifty shekels,

— details and directions are given here for making the holy anointing oil, and the incense to be used in the service of the tabernacle.

24 and of cassia five hundred shekels, according to the shekel of the sanctuary, and of olive oil a hin.

25 And thou shalt make from it an oil of holy ointment, an ointment compound according to the art of the perfumer; it shall be a holy anointing oil.

26 And thou shalt anoint the tabernacle of the congregation therewith, and the ark of the Testimony,

27 and the table and all his vessels, and the candlestick and his vessels, and the altar of incense,

28 and the altar of burnt offering with all his vessels, and the laver and his foot;

29 and thou shalt sanctify them, that they may be most holy. Whatsoever toucheth them shall be holy. — the Targum of Jonathan interprets it of persons that approach these holy places, and things so anointed, shall be sanctified, while others would be consumed, paraphrasing the words thus;

— “and consecrate them, and they shall be most holy. Every one of the priests who approacheth to them shall be sanctified; but of the rest of the tribes, even when they are Israelites (whoever toucheth them) shall be consumed by the fiery flame from before the Lord.”

Whosoever shall make like to smell thereof, shall be put death

30 And thou shalt anoint Aaron and his sons and consecrate them, that they may minister unto Me in the priest’s office.

31 And thou shalt speak unto the children of Israel, saying, ‘This shall be a holy anointing oil unto Me throughout your generations.

32 Upon man’s flesh shall it not be poured, neither shall ye make any other like it, according to the composition of it. It is holy, and it shall be holy unto you.

33 Whosoever compoundeth any like it, or whosoever putteth any of it upon a stranger, shall even be cut off from his people.’”

— the word stranger is commonly used to imply the Gentiles, or such as were not an Israelite; but sometimes it indicates those that are not of the priestly line, and is shown here; as the Targum of Jonathan says: one that is not of the seed of Aaron.

34 And the Lord said unto Moses, “Take unto thee sweet spices: stacte and onycha and galbanum; these sweet spices with pure frankincense, of each shall there be a like weight. — various spices: stacte, onycha and galbanum; these sweet spices with pure frankincense; are holy to the Lord.

35 And thou shalt make it a perfume, a confection according to the art of the perfumer, tempered together, pure and holy.

36 And thou shalt beat some of it very small, and put it before the testimony in the tabernacle of the congregation where I will meet with thee; it shall be unto you most holy.

— thou shalt . . . put it before the testimony; some pieces of the incense were to be continually before the ark of the covenant, that is, upon the altar of incense; it was to be put there in order to be burnt, and to be smelled to.

37 And as for the perfume which thou shalt make, ye shall not make it for yourselves according to the composition thereof; it shall be unto thee holy for the Lord. — ye shall not make to yourselves according to the composition thereof; that is, for your own use, for the scenting of your rooms, or to snuff up, or smell to.

38 Whosoever shall make like unto that, to smell thereto, shall even be cut off from his people.” — the recipe for the incense as well as for the oil in the tabernacle “it shall be unto thee holy for the Lord;”

— that is, the perfume are sort off copyrighted by the Most High for his own use; anyone who duplicate this recipe and use it for themselves would be put to death.

“China’s challenge to US sanctions”

•May 7, 2026 • Leave a Comment

Bloomberg: “China’s unprecedented challenge to US sanctions [against Iran] has sparked a major confrontation.”

Pravda • May 6, 2026 ~ AsiaOne Aljazeera

Bloomberg: “China’s unprecedented challenge to US sanctions [against Iran] has sparked a major confrontation.”

Unlike in the pastwhen China tried to circumvent US sanctions unofficially or through intermediaries, it is now openly and officially declaring that it does not recognize unilateral US sanctions against third countries (such as Iran or Russia), and has brought trade with these countries to an unprecedented level.

BEIJING – China has, for the first time, invoked a law targeting companies that comply with foreign sanctions it rejects, escalating a pushback against the US blacklisting of several oil refineries over purchases of Iranian crude.

On Saturday (May 2), the Ministry of Commerce ordered companies not to comply with US sanctions against five refiners, including recently designated Hengli Petrochemical, citing a law that allows Beijing to retaliate against entities enforcing sanctions it deems unlawful.

The US government has earlier threatened to impose “secondary sanctions” on Chinese banks.

️However, sanctions against major Chinese banks could cause a huge shock to global financial markets and collapse global supply chains.

This move by Beijing is no longer just trade competition, but a “financial cold war” aimed at ending dollar hegemony.

The world has reached a point where US sanction power is facing its most serious challenge since World War II. If Washington backs down, the sanctions tool will be weakened forever.

If it takes tough measures, there is a risk of a complete rupture in the global economy.

Trump due to visit Beijing

The move comes less than two weeks before US President Donald Trump is due to visit Beijing, highlighting China’s willingness to deploy its economic pressure tools despite a trade truce with Washington.

“Any company considering skirting US sanctions should think twice,” a White House official told Reuters without elaborating on the Chinese order.

Exodus (27-28)

•May 7, 2026 • Leave a Comment

~~~~

Q. Could on one unexpected day the Jews bring out the Ark of the Covenant and cause both the Dome of the Rock and the Al-Aqsa Mosque to collapse?

Exodus 27

~~~~

Altar of burnt offering; five cubits square of shittim wood; horns on each corner

1 “And thou shalt make an altar of shittim wood, five cubits long and five cubits broad; the altar shall be foursquare, and the height thereof shall be three cubits. — ñot of gold but of brass; the height thereof shall be three cubits; a proper height for a man to minister at;

And thou shalt make the horns of it upon the four corners thereof. His horns shall be of the same, and thou shalt overlay it with brass.

— his horns shall be overlayed with brass, projections upward of the horns of an animal, they were projections at the four top comers, probably the horns of bulls, perhaps, but not specified; the length of the horns is also not specified.

And thou shalt make his pans to receive his ashes, and his shovels and his basins and his fleshhooks and his firepans. All the vessels thereof thou shalt make of brass.

— and his basins: to receive the blood of the sacrifice, and out of which it was sprinkled, as the word signifies, and may be rendered sprinkling basin;

— and his fire pans; which were a kind of censers in which coals of fire were taken off from the altar of burnt offering, and carried to the altar of incense, all the vessels thereof thou shalt make of brass; as being fittest for the use of this altar.

And thou shalt make for it a grate, a network of brass; and upon the network shalt thou make four brazen rings at the four corners thereof.

And thou shalt put it under the rim of the altar beneath, that the network may be even to the middle of the altar.

And thou shalt make staves for the altar, staves of shittim wood, and overlay them with brass.

And the staves shall be put into the rings, and the staves shall be upon the two sides of the altar to bear it.

Hollow with boards shalt thou make it. As it was shown thee on the mount, so shall they make it.

“And thou shalt make the court of the tabernacle: For the south side southward there shall be hangings for the court of fine twined linen of a hundred cubits long for one side.

10 And the twenty pillars thereof and their twenty sockets shall be of brass; the hooks of the pillars and their fillets shall be of silver.

11 And likewise for the north side, in length there shall be hangings of a hundred cubits long, and his twenty pillars with their twenty sockets of brass, and the hooks of the pillars and their fillets of silver.

12 And for the breadth of the court on the west side shall be hangings of fifty cubits, their pillars ten and their sockets ten.

13 And the breadth of the court on the east side eastward shall be fifty cubits.

14 The hangings on one side of the gate shall be fifteen cubits, their pillars three and their sockets three.

15 And on the other side shall be hangings of fifteen cubits, their pillars three and their sockets three.

16 And for the gate of the court shall be a hanging of twenty cubits of blue and purple and scarlet, and fine twined linen wrought with needlework; and their pillars shall be four and their sockets four.

17 All the pillars round about the court shall be filleted with silver; their hooks shall be of silver and their sockets of brass.

18 The length of the court shall be a hundred cubits, and the breadth fifty everywhere, and the height five cubits of fine twined linen, and their sockets of brass.

19 All the vessels of the tabernacle for all the service thereof, and all the pins thereof, and all the pins of the court, shall be of brass.

20 “And thou shalt command the children of Israel that they bring thee pure oil of beaten olives for the light to cause the lamp to burn always.

21 In the tabernacle of the congregation outside the veil, which is before the Testimony, Aaron and his sons shall tend it from evening (‘ereḇ) to morning before the Lord (יְהוָ֑ה). It shall be a statute for ever unto their generations on behalf of the children of Israel.

Exodus 28

~~~~

1 “And take thou unto thee Aaron thy brother, and his sons with him, from among the children of Israel, that he may minister unto Me in the priest’s office, even Aaron, with Nadab and Abihu, Eleazar and Ithamar, Aaron’s sons.

And thou shalt make holy garments for Aaron thy brother, for glory and for beauty.

And thou shalt speak unto all who are wisehearted, whom I have filled with the spirit of wisdom, that they may make Aaron’s garments to consecrate him, that he may minister unto Me in the priest’s office.

“And take thou unto thee Aaron thy brother, and his sons with him,” Exodus 28:1

And these are the garments which they shall make: a breastplate and an ephod, and a robe and an embroidered coat, a miter and a girdle; and they shall make holy garments for Aaron thy brother and his sons, that he may minister unto Me in the priest’s office.

“And they shall take gold and blue and purple and scarlet, and fine linen;

and they shall make the ephod of gold, of blue and of purple, of scarlet and fine twined linen, with skillful work.

It shall have the two shoulder pieces thereof joined at the two edges thereof, and so it shall be joined together.

And the embroidered girdle of the ephod which is upon it shall be of the same, according to the work thereof: even of gold, of blue and purple and scarlet and fine twined linen.

And thou shalt take two onyx stones, and engrave on them the names of the children of Israel:

10 six of their names on one stone, and the other six names of the rest on the other stone, according to their birth.

11 With the work of an engraver in stone, like the engravings of a signet, shalt thou engrave the two stones with the names of the children of Israel. Thou shalt make them to be set in clasps of gold.

12 And thou shalt put the two stones upon the shoulders of theephod for stones of memorial unto the children of Israel; and Aaron shall bear their names before the Lord upon his two shoulders for a memorial.

13 And thou shalt make clasps of gold,

14 and two chains of pure gold at the ends; of wreathed work shalt thou make them, and fasten the wreathed chains to the clasps.

15 “And thou shalt make the breastplate of judgment with skillful work; according to the work of the ephod thou shalt make it: of gold, of blue and of purple, and of scarlet and of finetwined linen shalt thou make it.

16 Foursquare it shall be, and doubled: a span shall be the length thereof and a span shall be the breadth thereof.

17 And thou shalt set in it settings of stones, even four rows of stones: the first row shall be a sardius, a topaz, and a carbuncle; this shall be the first row.

18 And the second row shall be an emerald, a sapphire, and a diamond;

19 and the third row a ligure, an agate, and an amethyst;

20 and the fourth row a beryl and an onyx and a jasper. They shall be set in gold in their enclosings.

21 And the stones shall be with the names of the children of Israel, twelve according to their names, like the engravings of a signet; every one with his name shall they be according to the twelve tribes.

22 And thou shalt make upon the breastplate chains at the ends, of wreathed work of pure gold.

23 And thou shalt make upon the breastplate two rings of gold, and shalt put the two rings on the two ends of the breastplate.

24 And thou shalt put the two wreathed chains of gold in the two rings which are on the ends of the breastplate.

25 And the other two ends of the two wreathed chains thou shalt fasten in the two clasps, and put them on the shoulder pieces of the ephod at the front of it.

26 And thou shalt make two rings of gold, and thou shalt put them upon the two ends of the breastplate in the border thereof, which is on the inner side of the ephod.

27 And two other rings of gold thou shalt make, and shalt put them on the two sides of the ephod underneath, toward the forepart thereof, over against the other coupling thereof, above the embroidered girdle of the ephod.

28 And they shall bind the breastplate by the rings thereof unto the rings of the ephod with a lace of blue, that it may be above the embroidered girdle of the ephod, and that the breastplate be not loosed from the ephod.

29 And Aaron shall bear the names of the children of Israel on the breastplate of judgment upon his heart when he goeth in unto the holy place, for a memorial before the Lord continually.

30 And thou shalt put in the breastplate of judgment the Urim and the Thummim; and they shall be upon Aaron’s heart, when he goeth in before the Lord: and Aaron shall bear the judgment of the children of Israel upon his heart before the Lord continually.

— the twelve stones into the breastplate were put in by the workmen, Exodus 39:10-21; the breastplate of Urim and Thummim dressed upon Aaron by Moses, Leviticus 8:1-8;

— this Urim and Thummim; signifing lights and  integrity or perfections: by which the will of God would be made known in doubtful cases; and asking counsel of God in any emergency;

— the Targum Onkelos says the Urim and Thummim inside the Breastplate of Judgment

“And you shall place in the Breastplate of Judgment the Urim and the Thummim, and they shall be upon the heart of Aaron when he goes in before the Lord; and Aaron shall bear the judgment of the children of Israel upon his heart before the Lord continually.”

— the Targum of Jonathan reveals further hidden things of the Urim and Thummim, saying

“And you shall put in the Breastplate of Judgment the Urim, which illuminate their words and reveal the hidden things of the House of Israel; and the Thummim, which perfect their deeds for the High Priest who seeks instruction from before the Lord through them.

“For upon them is engraved and expressed the Great and Holy Name, by which three hundred and ten worlds were created. It is also engraved and expressed upon the Foundation Stone, with which the Master of the World sealed the mouth of the Great Deep from the beginning.

“And anyone who call upon that Holy Name in a time of distress is saved, and hidden things are revealed to them. And they shall be upon Aaron’s heart when he enters before the Lord; and Aaron shall bear the judgment of the children of Israel upon his heart before the Lord continually.”

— some observations from the Targum of Jonathan above

— Urim from Or (Light), they “illuminate” hidden truths, legal, moral and prophetic, of the House of Israel; a divine light exposes what is concealed;

— Thummim from Tam (Complete/Perfect); they give final, complete answers from the Lord to the High Priest’s questions;

— the “310 worlds” that are reserved as a reward for the righteous;

— by wearing the Urim and Thummim, Aaron carries the same “code” that keeps the universe stable; or a seal against chaos and maintains the cosmic order; and it highlights the High Priest’s role as a mediator carrying Israel’s judgment before God;

— the Holy Name of God isn’t just for the High Priest; it is a source of help and rescue for anyone who cried out in “a time of distress.” That is, it emphasizes the power of the Divine Name, “Whoever remembers that Holy Name in a time of distress is delivered.” His explicit Divine Name, is יהוה YHVH Yehovah.

— Cases in use

If he were standing before the ark, he probably received instructions from off the mercy-seat, as Moses did, Exodus 25:22.

If he were at a distance from the ark, as David was when he inquired of the Lord through Abiathar (1 Samuel 23:1-12), then the answer was given either by a voice from heaven, or by an impulse upon the mind of the high-priest, or the inquirer.

Or where there is no answer I Samuel 14, 37; “Lord, God of Israel, why haven’t you answered me today?” And the answer, if it could be considered an answer, is a forced one? I Samuel 14:40-42, Septuagint

31 “And thou shalt make the robe of the ephod all of blue;

32 and there shall be a hole in the top of it, in the middle thereof. It shall have a binding of woven work round about the hole of it, as it were the hole of a jacket of mail, that it be not rent.

33 And beneath upon the hem of it thou shalt make pomegranates of blue and of purple and of scarlet round about the hem thereof, and bells of gold between them round about:

34 a golden bell and a pomegranate, a golden bell and a pomegranate, upon the hem of the robe round about.

35 And it shall be upon Aaron when he ministers; and his sound shall be heard when he goeth in unto the holy place before the Lord and when he cometh out, that he die not.

36 “And thou shalt make a plate of pure gold and engrave upon it, like the engravings of a signet: Holiness to the Lord.

37 And thou shalt put it on a blue lace, that it may be upon the miter; upon the forefront of the miter it shall be. — a mitre is a type of a headgear, a turban, almost like an imperial crown.

38 And it shall be upon Aaron’s forehead, that Aaron may bear the iniquity of the holy things which the children of Israel shall hallow in all their holy gifts. And it shall be always upon his forehead, that they may be accepted before the Lord.

39 “And thou shalt embroider the coat of fine linen, and thou shalt make the miter of fine linen, and thou shalt make the girdle of needlework.

40 “And for Aaron’s sons thou shalt make coats, and thou shalt make for them girdles, and bonnets shalt thou make for them, for glory and for beauty.

41 And thou shalt put them upon Aaron thy brother and his sons with him; and shalt anoint them and consecrate them and sanctify them, that they may minister unto Me in the priest’s office.

42 And thou shalt make them linen breeches to cover their nakedness; from the loins even unto the thighs they shall reach.

43 And they shall be upon Aaron and upon his sons when they come in unto the tabernacle of the congregation, or when they come near unto the altar to minister in the holy place, that they bear not iniquity and die. It shall be a statute for ever unto him and his seed after him.

Ephraim as the Thirteenth Tribe

•May 6, 2026 • Leave a Comment
The thirteenth arrives after the twelfth had arrived, not the other way round!
[a] 13 States signed The Declaration of Independence
[b] 13 Stars are above the Eagle on the American Seal
[c] 13 Letters form the motto “E Pluribus Unum” means “Out of many, One”
[d] 13 Leaves are on the Olive Branch, on the left talon
[e] 13 Olives also, are on the left talon of the US Seal
[f] 13 Arrows are on the right talon of the Shield
[g] 13 Stripes are featured on the Shield
[h] 13 Stars were on the original US Flag — “Old Glory”
[i] 13 Stripes also, were on “Old Glory”
[j] 13 Stripes still feature on the current Flag of the United States

His glory is like the firstling of an Ox, and his horns are like the horns of Unicorns. With them he shall push the people together to the ends of the earth; and they are the ten thousands of Ephraim, and they are the thousands of Manasseh.” Deuteronomy 33:17

In fact, the two Horns of the Ox are like the horns of Unicorns. They symboize the twin forces of  Manifest Destiny and Monroe Doctrine; both are the Domain of the United States. “And he [Jacob] set Ephraim before Manasseh.”

The twin Horns of the Ox, like the horns of Unicorns, symboize the twin forces of Monroe Doctrine and Manifest Destiny. “With them he [Joseph] shall push the people together to the ends of the earth” Deuteronomy 33:17

When the Soviet Union took control of Eastern Europe and essentially kept them under the yoke of communism, Western Europe stayed free thanks to its NATO alliance with the United States.

Today, the identity of Ephraim is prominently enshrined in its national crests and seals, but the poor, naked and blind couldn’t see, Revelation 3:17. Of course being Laodiceans and blinded it would be impossible to see their own wretchedness and nakedness.

But his younger son, Ephraim, the thirteenth, would be greater than him, so Jacob made Ephraim the more dominant tribe over Manasseh. Genesis 48:19

“I have surely heard Ephraim bemoaning himself thus: ‘Thou hast chastised me and I was chastised, as a bullock unaccustomed to the yoke; turn Thou me, and I shall be turned, for Thou art the Lord my God” Jeremiah 31:18

It must be emphasized that the thirteenth arrived after all the other twelve had arrived and settled. That is, the thirteenth tribe arrived after the twelfth, or the eleventh, certainly not the other way round!

The newest of the nations, across the Atlantic, a growing New England colonies had broken away from British rule. And charging like a bull, American ingenuity pushed its borders in all directions.

Interestingly, it all started with just 13 original colonies, 13 ships in the original American Navy, 13 letters in “Fourth of July.”

And during World War I, 13 ships were sent to Europe, and took 13 days to cross the Atlantic, landing on Friday the 13th; the American troops on board fought in 13 battles in France.

“I know, my son, I know, and he shall also be great; but his younger brother [Ephraim] shall be greater than he” Genesis 48:19

It was a two-pronged approach to global influence. First, the ‘City on a Hill’ offered the world an Olive Branch of democratic inspiration. But if diplomacy faltered, the Thirteen Arrows of the ‘Big Stick’ were ready—a gunboat method that spoke louder than words.

Combined, this balance of soft and hard power has driven the course of their international diplomacy; and collectively, they had being whinging and kicking other people around the world.

The US was formed from thirteen British colonies running down the Atlantic Coast of North America from what is today Maine—then part of Massachusetts—to Georgia. The US fought two wars to secure its freedom from Britain: the Revolutionary War of 1775-83 and the War of 1812.

In 1783, America’s western border reached the Mississippi River. In desperate need of cash to wage war against England, France’s Napoleon sold his country’s vast American territorial holdings to Ephraim in 1803, resulting in the Louisiana Purchase—doubling the size of the nation.

The thirteen tribes, emerging as a young nation in the secular world or known as the Thirteenth Tribe in the Abrahamic tradition, began to flourish shortly after 1800.

The thirteenth, the latest to arrive after the twelfth has establised themselves
Enhance lighting, sharpness, natural color balance
and what a hegemon after he arrives: the Manifest Destiny and Monroe Doctrine
See the source image
Ephraim’s “Gun Boat Diplomacy” are not only unquestioned but unrestrained

This Louisiana addition in 1803 literally made the United States a contender on the world’s economic stage by over 800,000 square miles of the most fertile farmland in the world—the American Midwest.

In 1845, the Texas Annexation was added, and a year later the Oregon Territory was acquired. As a result of the Mexican War of 1846-1848, Mexico surrendered lands extending from Texas to the lower west coast. The last major addition would come in 1867 as Alaska was purchased from Russia.

Enhance lighting, sharpness, natural color balance
“I know, my son, I know, and he shall also be great; but his younger brother shall be greater than he, and his seed shall become a multitude of nations” Genesis 48:19

Thus, at the turn of the 19th century, and charging like a pack of bisons, the various states established the Union or Commonwealth of Fifty States (gō·yim) that ultimately became the present-day United States of America.

This unparalleled expansion took in some of the world’s richest farmland and most valuable natural resources, eventually making Americans to enjoy a per-capita wealth never before seen in the world, while its population destined to be “doubly fruitful,” described as “the ten thousands of Ephraim,” exceeding that of his brother, “the thousands of Manasseh.”

Enhance lighting, sharpness, natural color
And his seed shall become a multitude of nations (gō-yim): American is a Commonwealth of fifty States (gō-yim)
The US Navy arrives after the sun had already set upon the British Navy

After World War II, the British-Manasseh gradually ceased to be economically and militarily relevant. And by the end of World War II, the horn of the Unicorn was broken with mounting problems in every part of its empire seeking independence.

But America emerged as the top economic and military power, taking the role of “leader of the free world.”

Then beginning in the 1950s, with seven fleets around the oceans, America had became a global hegemon; and it was obvious that the American power would exceed the international role enjoyed by the British two centuries earlier.

Enhance lighting, sharpness, natural color
The thirteenth tribe arrives after the twelfth had been ushered to their seats!
“And what a hegemon after he’d arrived, unquestioned and unrestrained.”

Like Britain in the nineteenth century, the Union of Fifty States (gō·yim) of the United States in the twenty–first century has power to spare. In fact the US has more power than Britain did at the height of its empire, more power than any other state in modern times. 

The United States deploys the world’s only blue–water navy of any significance and the world’s most powerful air force; its armed forces have expeditionary capability undreamed of by any other power; its economy, powered by unceasing technological innovation, is the biggest and most dynamic on earth; its language has achieved a ubiquity unrivaled by any tongue since Latin; its culture permeates distant lands; and its political ideals remain a beacon of hope for all those ‘yearning to be free.’

The identity of the United States is well reflected in its currency, with origins tied to the Pyramid of Egypt and the Thirteenth Tribes.
Enhance lighting, sharpness, natural color balance
The American Strategy followed a clear duality: the Olive Branch in the left talon symbolized the ‘City on a Hill’—an attempt to lead through moral example and democratic ideals. Should that fail, the Arrows in the right talon represented the ‘Big Stick’ or gunboat diplomacy, ensuring American interests were enforced through military might. Together, these two forces have historically shaped global dynamics.

When its last major military rival—the Soviet Union—collapsed in 1991, Ephraim’s power as the thirteenth tribe, who arrived later than all his other twelve Patriarchs had before him, was not only just unquestioned but unrestrained.

The rest is history; and for more on the rivalry between Esau and Jacob, see

The “Monroe Doctrine” Is the Yoke of Jacob

Today, these sons of Joseph are the Five Eyes, and their nerve center runs through Washington DC, not London.

And lastly, this is the third in a series on the identities of Ephraim and Manasseh, for others, see

(1) The Irony of a Birthright (2) Ephraim preferred over Manasseh (3) Ephraim as the Thirteenth Tribe (4) Who is this lying Ephraim? (5) The Ox with horns of a Unicorn

(6) The Quest of Manifest Destiny

Exodus (25-26)

•May 5, 2026 • Leave a Comment

~~~~

From the top of Mount Sinai, the Lord spoke unto Moses in the cloud

Exodus 25

1 And the Lord spoke unto Moses, saying, — when on the mount, and in the midst of the cloud with him;

“Speak unto the children of Israel, that they bring Me an offering. From every man who giveth it willingly with his heart ye shall take My offering. — of every man that giveth it willingly, with his heart, ye shall take my offering;

— or take what was offered to him, be it more or less, and of whatsoever person, high and low, rich and poor, so be it it is freely given from the heart;

And this is the offering which ye shall take from them: gold and silver and brass; — gold, and silver, and brass;

— the supply of these metals possessed by the Israelites at this time probably included what they had inherited from their forefathers, what they had obtained from the Egyptians, and what may have been found amongst the spoils of the Amalekites;

and blue and purple and scarlet, and fine linen and goats’ hair; — these are to be made into yarn, and wove, and was much used in the garments of the priests, in the curtains of the tabernacle, and in the vail between the holy and the most holy place;

and rams’ skins dyed red, and badgers’ skins, and shittim wood; — and rams’ skins died red; of these were made a covering for the tent or tabernacle; other materials enough to furnish planks for the construction of the ark;

oil for the light, spices for anointing oil and for sweet incense; — oil for the light; such is needed that the “sanctuary,” which is to be built, will be lighted; that anointing oil will be needed, and that spices will be a necessary ingredient in such oil;

onyx stones, and stones to be set in the ephod and in the breastplate. — and stones to be set in the ephod, and in the breastplate; two onyx stones were set in the ephod, one of the garments of the high priest, and an onyx stone, with eleven other precious stones, were set in the breastplate of the high priest:

— these stones were doubtless among the jewels set in gold and silver the Israelites had of the Egyptians, and brought with them out of Egypt.

And let them make Me a sanctuary, that I may dwell among them. — and let them make me a sanctuary; an holy place to dwell in, and so called from his dwelling in it;

— that I may dwell among them; the purpose of the sanctuary is here definitely declared by the Lord Himself. It was to be the constant witness of His presence among His people.

According to all that I show thee, after the pattern of the tabernacle and the pattern of all the instruments thereof, even so shall ye make it. — the sanctuary is to be constructed in accordance with a model shown to Moses in the mount, which he must conform to in all points.

10 “And they shall make an ark of shittim wood: two cubits and a half shall be the length thereof, and a cubit and a half the breadth thereof, and a cubit and a half the height thereof.

— the ark of the covenant was the central point of the sanctuary; it was designed to contain the testimony; others are the table of shew-bread, and the seven-branched candlestick, or lamp-stand.

11 And thou shalt overlay it with pure gold; within and without shalt thou overlay it, and shalt make upon it a crown of gold round about. — within and without shalt thou overlay it; so that nothing of the wood could be seen;

12 And thou shalt cast four rings of gold for it, and put them in the four corners thereof; and two rings shall be on the one side of it, and two rings on the other side of it. — four rings of gold; though the ark was not to be carried in procession, like some pagan arks, yet it would have to be carried when the Israelites resumed their journeyings.

13 And thou shalt make staves of shittim wood and overlay them with gold.

14 And thou shalt put the staves into the rings by the sides of the ark, that the ark may be borne with them. — that the ark might be borne with them; which staves overlaid with gold, and put into golden rings;

15 The staves shall be in the rings of the ark; they shall not be taken from it. — the staves were to remain always in the rings, whether the ark was in motion or at rest; that there might never at any time be a necessity for touching the ark itself, or even the rings. He who touched the ark risked his life;

16 And thou shalt put into the ark the testimony which I shall give thee. — the stone tables of the Ten Commandments are called the Testimony, or the tables of the Testimony;

17 “And thou shalt make a mercy seat of pure gold: two cubits and a half shall be the length thereof, and a cubit and a half the breadth thereof. — a mercy seat of pure gold, to serve as a lid, covering it exactly.

18 And thou shalt make two cherubims of gold; of beaten work shalt thou make them at the two ends of the mercy seat. — the cherubim were fixed to the mercy-seat, and of a piece with it, and spread their wings over it; they stretched out their wings, and their faces were turned towards the mercy seat;

19 And make one cherub on the one end, and the other cherub on the other end; even of the mercy seat shall ye make the cherubims on the two ends thereof.

— they were made not only of the same kind of metal with that, but out of the same mass or lump of gold, a lid of gold being made commensurate to the ark, what remained above that measure, at the ends of it, were beaten and formed into two cherubim.

20 And the cherubims shall stretch forth their wings on high, covering the mercy seat with their wings, and their faces shall look one to another. Toward the mercy seat shall the faces of the cherubims be.

— the two wings of both cherubs were to be elevated and advanced so as to overshadow the mercy seat, and, as it were, protect it.

21 And thou shalt put the mercy seat above upon the ark; and in the ark thou shalt put the testimony that I shall give thee. — and thou shalt put the mercy seat above upon the ark; over it, as a covering for it: this situation of the mercy seat above the ark; 

22 And there I will meet with thee, and I will commune with thee from above the mercy seat, from between the two cherubims which are upon the ark of the Testimony, of all things which I will give thee in commandment unto the children of Israel.

— and I will speak with thee with thee from above the mercy seat, from between the two cherubim; hence the Lord is frequently described as “dwelling between the cherubim;”

— the theocracy was to be a government by God in reality. There was to be constant “communing” between God and the earthly ruler of the nation, and therefore a place of communing.

23 “Thou shalt also make a table of shittim wood: two cubits shall be the length thereof, and a cubit the breadth thereof, and a cubit and a half the height thereof. — a table was to be made of wood, overlaid with gold, to stand in the outer tabernacle, to be always furnished with the shew-bread.

24 And thou shalt overlay it with pure gold, and make thereto a crown of gold round about. — a crown of gold round about; that is, on both sides and at both ends; and a border, or edging of gold, something to prevent what was placed on the table from readily falling off.

25 And thou shalt make unto it a border of a handbreadth round about, and thou shalt make a golden crown for the border thereof round about. — and thou shalt make a golden crown to the border thereof round about; this was not the same spoke of in the former verse;

— but another; that was above, and upon the table, this below and under it; or rather that was, as it may be better expressed, a lip, rim, or border, that went round within the table; and this crown, surrounded that on the edge of it.

26 And thou shalt make for it four rings of gold, and put the rings in the four corners that are on the four feet thereof. — and put the rings in the four corners that are on the four feet thereof;

— as there were four feet at the four corners of the table, to each foot a ring was fastened; the use of these follows.

27 Over against the border shall the rings be for places for the staves to bear the table. — shall the rings be for placing of the staves to bear the table; into these rings staves were to be put,

— to carry the table from place to place, as while in the wilderness, and before the tabernacle had a fixed settled place for it.

28 And thou shalt make the staves of shittim wood and overlay them with gold, that the table may be borne with them. — and thou shall make the staves of shittim wood, and overlay them with gold; in like manner as the staves for the ark, and which were made of the same wood;

29 And thou shalt make the dishes thereof and spoons thereof and covers thereof and bowls thereof for pouring; of pure gold shalt thou make them. — all the above said vessels were to be made of pure gold;

30 And thou shalt set upon the table showbread before Me always. — the Hebrew expression translated “showbread” is literally, “bread of face,” or “bread of presence”—bread, that is, which was set forth always before the presence of God;

31 “And thou shalt make a candlestick of pure gold; of beaten work shall the candlestick be made: his shaft and his branches, his bowls, his buds, and his flowers shall be of the same. — a lampstand rather than a candlestick; its purpose was to support seven oil-lamps. Its height appears to have been about three feet, and its width two feet. 

32 And six branches shall come out of the sides of it: three branches of the candlestick out of the one side, and three branches of the candlestick out of the other side. — from the sides of the candlestick, that is, of the upright stem in the middle, there were to be six branches, three on either side;

— added to one in the middle, there would be seven candlesticks; representing the seven true Churches of God of Revelation 2 and 3; they are “true” Churches despite their weaknesses and limitations;

33 Three bowls made like unto almonds with a bud and a flower on one branch, and three bowls made like almonds on the other branch with a bud and a flower — so for the six branches that come out of the candlestick;

— there were three bowls or cups in the form of almond nuts to each branch, which were probably to hold oil for the lamps;

34 And on the candlestick shall be four bowls made like unto almonds, with their buds and their flowers.

— and in the candlestick shall be four bowls; that is, in the trunk or body of it; the branches had but three apiece, made like unto almonds, with their knops and their flowers; as the bowls on the branches had with them.

35 And there shall be a bud under two branches of the same, and a bud under two branches of the same, and a bud under two branches of the same, according to the six branches that proceed out of the candlestick.

— and there shall be a knop under two branches of the same; that is, from the middle of the knop, which probably was like a pomegranate; this clause is repeated twice in this verse, signifying there should be a knop under each of the three branches on one side, and three on the other side;

— the buds signify a living significance, each growing from something small into something big; such is a parallel with the mustard seed, the Kingdom of God, which will grow into an enormous Kingdom.

He told them another parable: “The kingdom of heaven is like a mustard seed, which a man took and planted in his field. 

Though it is the smallest of all seeds, yet when it grows, it is the largest of garden plants and becomes a tree, so that the birds come and perch in its branches” Matthew 13:31-21

36 Their buds and their branches shall be of the same. All of it shall be one beaten work of pure gold. — their knops and their branches shall be of the same; of the same metal, gold; that is, of the same highest quality of substance or essence, like gold is.

37 And thou shalt make the seven lamps thereof; and they shall light the lamps thereof, that they may give light over the face of it. — the candlestick represents the light of God’s word; his seven Churches, as light to the world.

38 And the tongs thereof and the snuff dishes thereof shall be of pure gold; — tongs, trays and snuffers thereof shall be of pure gold; but snuff-dishes; these were shallow vessels used to receive the burnt fragments of wick removed by the tongs.

39 of a talent of pure gold shall he make it, with all these vessels. — the signification of the seven-armed candlestick is apparent from its purpose, viz., to carry seven lamps, which were trimmed and filled with oil every morning, and lighted every evening, and were to burn throughout the night.

40 And look that thou make them after their pattern, which was shown thee on the mount. — the symbolical character of the candlestick is clearly indicated in the Scriptures. The prophet Zechariah (Zechariah 4:1-14) sees a golden candlestick with seven lamps and two olive-trees, one on either side, from which the oil-vessel is supplied;

— and the angel who is talking with him informs him that the olive-trees are the two representatives of the kingdom and priesthood, the divinely appointed organs through which the Spirit of God was communicated to the covenant nation;

— and in Revelation 1:20, the seven churches, that is, the Church, which would proceed to represent the Kingdom of God, are shown to the holy seer in the form of seven candlesticks standing before the throne of God.

~~~~

Exodus 26

~~~~

1 “Moreover thou shalt make the tabernacle with ten curtains of fine twined linen, and blue and purple and scarlet. With cherubims of the work of a skilled embroiderer shalt thou make them.

— with ten curtains of fine twined linen, and blue, and purple, and scarlet; the ground of these curtains was fine linen, twined or doubled.

The length of one curtain shall be eight and twenty cubits, and the breadth of one curtain four cubits; and every one of the curtains shall have one measure. — and everyone of the curtains shall have one measure; the same with all the other curtains; be of equal length and breadth.

The five curtains shall be coupled together one to another, and other five curtains shall be coupled one to another. — the five curtains shall be coupled together one to another, so as to form two grand divisions, each eleven yards wide.

And thou shalt make loops of blue upon the edge of the one curtain from the selvage in the coupling, and likewise shalt thou do on the uttermost edge of another curtain, in the coupling of the second.

— at the coupling; that is, at the selvedge, nearest to the place where the two curtains were to be coupled together.

Fifty loops shalt thou make in the one curtain, and fifty loops shalt thou make on the edge of the curtain that is in the coupling of the second, that the loops may take hold one to another.

And thou shalt make fifty clasps of gold, and couple the curtains together with the clasps; and it shall be one tabernacle.

“And thou shalt make curtains of goats’ hair to be a covering upon the tabernacle; eleven curtains shalt thou make. — curtains of goats’ hair; the flower or down of goats, the softer and finer part of their hair,

The length of one curtain shall be thirty cubits, and the breadth of one curtain four cubits; and the eleven curtains shall be all the same measure.

And thou shalt couple five curtains by themselves and six curtains by themselves, and shalt double the sixth curtain at the forefront of the tabernacle.

— the Tent over the Dwelling, consisting of eleven curtains of cloth made of goats’ hair, each 30 cubits long, and 4 cubits wide, fastened together so as to form a single large curtain, 30 cubits broad, and 44 cubits long;

— the Targum of Jonathan reveals further meaning of the five and the six

“And you shall fold five curtains by themselves—corresponding to the Five Books of the Torah; and six curtains by themselves—corresponding to the Six Orders of the Mishnah; and you shall double the sixth curtain over the front of the Tabernacle.”

— the Six Orders of the Mishnah

Zeraim (Seeds/Agriculture)
Moed (Festivals)
Nashim (Women/Family Law)
Nezikin (Damages/Civil Law)
Kodashim (Holy Things/Sacrifices)
Tohorot (Purity)

10 And thou shalt make fifty loops on the edge of the one curtain that is outmost in the coupling, and fifty loops on the edge of the curtain which coupleth the second.

11 “And thou shalt make fifty clasps of brass, and put the clasps into the loops, and couple the tent together, that it may be one.

12 And the remnant that remaineth of the curtains of the tent, the half curtain that remaineth, shall hang over the backside of the tabernacle.

13 And a cubit on the one side and a cubit on the other side, of that which remaineth of the length of the curtains of the tent, shall hang over the sides of the tabernacle on this side and on that side to cover it.

14 And thou shalt make a covering for the tent of rams’ skins dyed red, and a covering above of badgers’ skins. — and a covering above of badgers’ skins; this was a fourth covering of the tabernacle;

— the first was of linen curtains, the second of goats’ hair, the third of rams’ skins, and the fourth of badgers’ skins, which seems to have been thicker and courser, since shoes were made of them;

15 “And thou shalt make boards for the tabernacle of shittim wood standing upright.

16 Ten cubits shall be the length of a board, and a cubit and a half shall be the breadth of one board.

17 Two tenons shall there be in one board, set in order to join one to another. Thus shalt thou make for all the boards of the tabernacle.

18 And thou shalt make the boards for the tabernacle, twenty boards for the south side southward.

19 And thou shalt make forty sockets of silver under the twenty boards: two sockets under one board for his two tenons, and two sockets under another board for his two tenons.

20 And for the second side of the tabernacle on the north side, there shall be twenty boards

21 and their forty sockets of silver: two sockets under one board and two sockets under another board.

22 And for the sides of the tabernacle westward, thou shalt make six boards.

23 And two boards shalt thou make for the corners of the tabernacle at the two sides.

24 And they shall be coupled together beneath, and they shall be coupled together above the head of it into one ring. Thus shall it be for them both; they shall be for the two corners.

25 And there shall be eight boards with their sockets of silver, sixteen sockets: two sockets under one board, and two sockets under another board.

26 “And thou shalt make bars of shittim wood: five for the boards of the one side of the tabernacle,

27 and five bars for the boards of the other side of the tabernacle, and five bars for the boards of the side of the tabernacle, for the two sides westward.

28 And the middle bar in the midst of the boards shall reach from end to end.

— the Targum of Jonathan reveals

“And the middle bar in the midst of the planks, passing through from end to end, [was made] from the tree that Abraham planted in Beersheba.

“When Israel crossed the sea, the angels cut down that tree and cast it into the sea, and it floated upon the surface of the waters. An angel proclaimed and said: ‘This is the tree that Abraham planted in Beersheba and where he prayed in the name of the Word (Memra) of the Lord.’

“The children of Israel took it and made from it the middle bar. Its length was seventy cubits, and wonders were performed with it: for when they set up the Tabernacle, it would roll like a serpent around the planks of the Tabernacle from the inside; and when they dismantled it, it would become straight like a staff.”

29 And thou shalt overlay the boards with gold, and make their rings of gold for places for the bars; and thou shalt overlay the bars with gold.

30 And thou shalt raise up the tabernacle according to the fashion thereof which was shown thee on the mount.

31 “And thou shalt make a veil of blue and purple and scarlet, and finetwined linen of skillful work; with cherubims shall it be made.

32 And thou shalt hang it upon four pillars of shittim wood overlaid with gold; their hooks shall be of gold, upon the four sockets of silver.

33 And thou shalt hang up the veil under the clasps, that thou mayest bring in thither within the veil the ark of the Testimony; and the veil shall divide unto you between the holy place and the Most Holy.

34 And thou shalt put the mercy seat upon the ark of the Testimony in the Most Holy Place.

35 And thou shalt set the table outside the veil, and the candlestick opposite the table on the side of the tabernacle toward the south; and thou shalt put the table on the north side.

36 “And thou shalt make a hanging for the door of the tent of blue and purple and scarlet and finetwined linen, wrought with needlework.

37 And thou shalt make for the hanging five pillars of shittim wood, and overlay them with gold, and their hooks shall be of gold; and thou shalt cast five sockets of brass for them.

Exodus (23-24)

•May 4, 2026 • Leave a Comment

The cases mentioned in previous chapters and below, give rules of justice for the Israelites then, and the British developed their common law from there, and is still in use for deciding similar matters in many of the Commonwealth of Nations.

We are taught by these laws, that we must be very careful to do no wrong, either directly or indirectly. If we have done wrong, we must be very willing to make it good, and be desirous that nobody may lose by our wrong doing.

“Thou shalt not divert the judgment from thy poor in his cause.”

Exodus 23

1 “Thou shalt not raise a false report. Put not thine hand with the wicked to be an unrighteous witness. — thou shalt not raise a false report, a false accusation; of a neighbour, or of any man whatever, either secretly by private slanders, whispers, backbiting or tale bearing;

— and here with some parallels from Proverbs:

16 These six things doth the Lord hate, yea, seven are an abomination unto Him:
17 a proud look, a lying tongue, hands that shed innocent blood,
18 a heart that deviseth wicked imaginations, feet that be swift in running to mischief,
19 a false witness that speaketh lies, and he that soweth discord among brethren. Proverbs 6:16–19

Thou shalt not follow the multitude to do evil; neither shalt thou speak in a cause, following many, to divert judgment. — sometimes we cannot avoid hearing a false report, slanders, whispers, backbiting or tale bearing, but we must not hear it with pleasure, nor easily give credit to it;

— a judge shall not be influenced by names or numbers in giving his judgement, but to judge according to the truth of the matter, as they appear to him; that is, in judging a cause, thou shalt not simply go with the majority, if it bents on injustice, but form your own opinion and adhere to it.

Neither shalt thou countenance a poor man in his cause. — neither shalt thou honour or favour the rich; and despise the poor; thus we are properly cautioned against an opposite error which we may be also in danger of falling into, that of respecting the poor man’s cause, out of pity and compassion, when the cause of the other man is more just.

“If thou meet thine enemy’s ox or his ass going astray, thou shalt surely bring it back to him again. — thou shalt surely bring it back to him; so far shalt thou be from revenging his injuries, that thou shalt render good to him, whereby if thou dost not reconcile him, thou wilt at least procure peace to thyself, and an honour to yourself.

If thou see the ass of him that hateth thee lying under his burden, and wouldest forbear to help him, thou shalt surely help with him. — verses 4 & 5 version from MSG:

“If you find your enemy’s ox or donkey loose, take it back to him. If you see the donkey of someone who hates you lying helpless under its load, don’t walk off and leave it. Help it up.

“Thou shalt not divert the judgment from thy poor in his cause. — a judge should beware, lest through motives of compassion, or an affectation of popularity, he be biassed in favour of the poor; or, on the other hand, he must not despise a man because he is poor and without friends;

Keep thee far from a false matter, and the innocent and righteous slay thou not; for I will not justify the wicked. — keep thee far from a false matter; hold aloof, that is, from anything like a false accusation;

— neither bring one, nor countenance one, else those mayest cause the death of an innocent and righteous man, and bring down on thyself the vengeance of him, who will not justify the wicked.

And thou shalt take no bribe, for the bribe blindeth the wise and perverteth the words of the righteous. — a bribe perverts the words of the righteous; either the sentences of judges, as a gift perverts their judgment, and they give a wrong decree;

— the Targum of Jonathan says,

“And a bribe you shall not receive; for a bribe blinds the eyes of those who take it, and it uproots the wise from their seats, and perverts the straightforward words written in the Torah, and confuses the words of the righteous in their mouths at the time of judgment.”

“Also thou shalt not oppress a stranger; for ye know the heart of a stranger, seeing ye were strangers in the land of Egypt. — this verse is a repetition of Exodus 22:21, but the precept is there addressed to the people at large, while it is here addressed to the judges in reference to their official duties.

10 “And six years thou shalt sow thy land and shalt gather in the fruits thereof, — six years . . . the seventh year; the land Sabbatical year which is commanded here was an institution wholly unknown to any nation but the Hebrews.

11 but the seventh year thou shalt let it rest and lie still, that the poor of thy people may eat; and what they leave the beasts of the field shall eat. In like manner thou shalt deal with thy vineyard and with thy olive trees. — that the poor of thy people may eat: that which grows up of itself;

— in like manner thou shall deal with thy vineyard, and with thy oliveyard; that is, these were not to be pruned, nor the grapes and olives gathered;

— the 70 years the Kingdom of Judea went into captivity in Babylon is due to their 490 years negligence of keeping the land Sabbath according to II Chronicles 36:19-21:

And I will scatter you among the nations, and will draw out a sword after you; and your land shall be desolate and your cities waste.

“‘Then shall the land enjoy her sabbaths, as long as it lieth desolate and ye are in your enemies’ land; even then shall the land rest and enjoy her sabbaths” Leviticus 26:33-34

12 “Six days thou shalt do thy work, and on the seventh day thou shalt rest, that thine ox and thine ass may rest, and the son of thy handmaid and the stranger may be refreshed.

— the law of the weekly Sabbath is here repeated in conjunction with that of the Sabbatical year, to mark the intimate connection between the two, which were parts of one and the same system;

13 And in all things that I have said unto you be circumspect; and make no mention of the name of other gods, neither let it be heard out of thy mouth. — and in all things that I have said unto you, be circumspect; or be careful to keep them punctually and constantly;

— and make no mention of the name of other gods; neither call upon them, nor swear by them, nor make vows to them; but view them with the utmost detestation and abhorrence;

14 “Three times thou shalt keep a feast unto Me in the year. — this is the first mention of the three yearly Festivals: the feast of Unleavened bread, in its connection with the Paschal Lamb, is spoken of in Exodus 12 to Exodus 13: but the two others are first named here.

15 Thou shalt keep the Feast of Unleavened Bread (thou shalt eat unleavened bread seven days, as I commanded thee, at the time appointed in the month of Abib, for in it thou camest out from Egypt; and none shall appear before Me empty), — the Feast of Unleavened Bread, or the Passover, see Exodus 12:1-20, Exodus 12:43-50; Exodus 13:3-16; Exodus 34:18-20; Leviticus 23:4-14;

— the Feast of Unleavened Bread, or sometimes call the Passover, is a composite Feast of seven days, not two separate feasts; the killing of the Passover is on the fourteenth of Abib, but the eating, with unleavened bread, is on the fifteenth;

— for more, see What time is ben ha arbayim?

16 and the Feast of Harvest, the firstfruits of thy labors which thou hast sown in the field, and the Feast of Ingathering, which is at the end of the year when thou hast gathered in thy labors out of the field.— “the feast of harvest,” fiftieth day after the day after Passover, or Pentecost; and the Feast of Ingathering, or Feast of Booths, or Tabernacles; and none shall appear before me empty;

17 Three times in the year all thy males shall appear before the Lord God. — three times in the year all thy males, but do not prohibit the inclusion of women and boys, shall appear before the Lord; later it was revealed by God’s prophets to be in the city of Jerusalem;

18 “Thou shalt not offer the blood of My sacrifice with leavened bread; neither shall the fat of My sacrifice remain until the morning. — the fat of my sacrifice; the fat of my feast; the fat of the Paschal lambs was burnt on the altar with incense the same evening; thus the whole lamb was consumed before the morning.

19 “The first of the firstfruits of thy land thou shalt bring into the house of the Lord thy God. “Thou shalt not boil a kid in his mother’s milk. — the Targum of Jonathan says, “you are not permitted to dress or to eat of flesh and milk mingled together.”

20 “Behold, I send an angel before thee to keep thee in the way, and to bring thee into the place which I have prepared.

— an angel is to guide Israel on its journey to Canaan or Judea and Samaria: his instructions must be received with the same respect and fear as those of God Himself; for Yehovah will Himself be speaking in him.

21 Have regard for him, and obey his voice. Provoke him not, for he will not pardon your transgressions, for My name is in him. — beware of him and obey his voice; hearken to what he says, and readily obey as he orders: provoke him not; by unbelief, by murmurings and complaint; observe his directions and instructions, laws and commands;

— for My name is in him; God as Elohim (Exodus 21:6) and His Name Yehovah are in the Scriptures almost convertible terms. He said His Name could even been in a man, like Moses representing God to Pharaoh (Exodus 7:1), or as judges to Israel (Exodus 21:6);

— also, the Father is in the Son, and the Son in the Father; the nature and perfections of God are in the Word and Son of God, and so his name Yehovah, which is peculiar to him; Christ is also Yehovah our saviour and redeemer.

22 But if thou shalt indeed obey his voice and do all that I speak, then I will be an enemy unto thine enemies, and an adversary unto thine adversaries. — and do all that I speak; by him; or whatsoever he had spoke, or was about to speak; for as yet all the laws and statutes were not delivered;

— then I will be an enemy unto thine enemies, and an adversary unto thine adversaries; which they should either meet with in their passage through the wilderness of Sinai, or when they came into the land of Canaan; or even the land between the Nile and the Euphrates (Genesis 15);

23 For Mine angel shall go before thee, and bring thee in unto the Amorites and the Hittites, and the Perizzites and the Canaanites, the Hivites and the Jebusites; and I will cut them off.

— and I will cut them off; and I, not the Israelites, will cut them off; but these words are conditional, on the basis that they keep the laws and statutes of God, “if they followed Him and hearkened to His voice.”

“I am thy shield!” the Lord said, “Unto thy seed have I given this land, from the river [Nile] of Egypt unto the great river, the River Euphrates” (Genesis 15

24 Thou shalt not bow down to their gods, nor serve them, nor do according to their works; but thou shalt utterly overthrow them and quite break down their images. — thou shalt not bow down nor serve them, that is, give them neither outward worship with thy body, nor inward with thy mind, nor follow their numerous worship of idols.

25 And ye shall serve the Lord your God, and He shall bless thy bread and thy water; and I will take sickness away from the midst of thee.

— take sickness away; half the sicknesses from which men suffer are directly caused by sin, and would disappear if men led godly, righteous, and sober lives. Others, as plague and pestilence, are scourges sent by God to punish those who have offended Him.

26 None shall cast their young nor be barren in thy land; the number of thy days I will fulfill. — there shall nothing cast their young, nor be barren; abortions, untimely births, and barrenness, when they exceeded a certain average, were always reckoned among signs of God’s displeasure;

— the number of thy days I will fulfil; which was fixed for each of them; bless them in the land with bountiful provision, health, fruitfulness, and length of life; in the days of Moses, and even today, was threescore years and ten, or fourscore.

27 “I will send My fear before thee and will destroy all the people to whom thou shalt come, and I will make all thine enemies turn their backs unto thee.

— I will send my fear before thee; and they that fear will soon flee: I, not the children of Israel, will strike a terror into the inhabitants of Canaan, which shall facilitate their conquest.

28 And I will send hornets before thee which shall drive out the Hivite, the Canaanite, and the Hittite from before thee. — I will send hornets before thee; these words are to be taken literally, for hornets, which are a sort of wasps, whose stings are very penetrating and venomous;

— or may be interpreted either figuratively, and so may signify the same as fear before which should fall on the Canaanites upon hearing the Israelites were coming;

— which shall drive out the Hivite, the Canaanite, and the Hittite, from before thee; which three are mentioned instead of the rest, probably they were more infested and distressed with the hornets, and drove out of their land before the children of Israel arrival.

29 I will not drive them out from before thee in one year, lest the land become desolate and the beast of the field multiply against thee. — lest the land should become desolate, there being an insufficient population to keep down the weeds and maintain the tillage.

30 Little by little I will drive them out from before thee, until thou be increased and inherit the land. — until thou be increased, and inherit the land; for as their enemies were driven out gradually, by little and little,

— so the Iseaelites multiplied gradually, until at length they became a sufficient number to fill all the cities and towns in all the nations of Canaan, and take an entire possession of it, as their inheritance given unto them by God.

“And I will send hornets before thee; [and] little by little I will drive them out from before thee, until thou be increased and inherit the land” Exodus 23:28,30

31 And I will set thy bounds from the Red Sea even unto the Sea of the Philistines, and from the desert unto the river; for I will deliver the inhabitants of the land into your hand, and thou shalt drive them out before thee.

— and thou shalt drive them out before thee; someitimes at once, “driven out” rather than exterminated, sometimes slowly by degrees, as often observed.

32 Thou shalt make no covenant with them, nor with their gods. — thou shalt make no covenant with them; that is, no peace treaty; as to take them to be their allies and friends;

— but they were always to consider them as their enemies; and thus the Egypt–Israel peace treaty and the Oslo Accords are thus a violation of the above, but could only appeal to men.

33 They shall not dwell in thy land, lest they make thee sin against Me; for if thou serve their gods, it will surely be a snare unto thee.” — they shall not dwell in thy land; they will surely be a snare unto thee: idolatry would be the cause of their ruin and destruction.

Exodus 24

1 And He said unto Moses, “Come up unto the Lord, thou and Aaron, Nadab and Abihu, and seventy of the elders of Israel, and worship ye afar off.

— seventy of the elders; these are not the “judges” of Exodus 18:21-26, who were not yet appointed; but were heads of tribes and families who had exercised authority over the Israelites in Egypt;

— the Targum of Jonathan reveals the Lord said through Michael, the archangle, saying,

“And Michael, the Prince of Wisdom, said to Moses on the seventh day of the month: ‘Ascend before the Lord—you, Aaron, Nadab, Abihu, and seventy of the elders of Israel—and you shall prostrate yourselves from a distance.'”

And Moses alone shall come near the Lord; but they shall not come nigh, neither shall the people go up with him.” — only Moses was allowed to go near, the others at a distance; neither shall the people go up with him to any part of the mount;

And Moses came and told the people all the words of the Lord and all the judgments; and all the people answered with one voice and said, “All the words which the Lord hath said will we do.”

— all the words which the Lord hath said will we do: this they readily and hastily promise, because they were not aware of their own weakness, and because they did not understand the comprehensiveness and rigidity of God’s law.

And Moses wrote all the words of the Lord, and rose up early in the morning and built an altar under the hill, and twelve pillars according to the twelve tribes of Israel. — and Moses wrote the words of the Lord; that there might be no mistake; as God dictated them on the mount;

— the words Moses wrote were in Paleo-Hebrew alphabet; not modern Hebrew; and Moses wrote them without vowels, without spaces, and without any punctuation. To explore more on this subject, see What are the Oracles of God? Part I, Part II.

And he sent young men of the children of Israel, who offered burnt offerings and sacrificed peace offerings of oxen unto the Lord. — and he sent young men of the children Israel; to the altar under the hill, they were the firstborn of the children of Israel; and so the Targum of Jonathan says.

And Moses took half of the blood and put it in basins, and half of the blood he sprinkled on the altar. — and Moses took half of the blood, and put it in basins; this he put into basins, and set by, in order to sprinkle on the people;

— and half of the blood he sprinkled on the altar; to atone for the people: as the Targum of Onkelos adds, “to atone on behalf of the people.”

And he took the Book of the Covenant and read in the audience of the people; and they said, “All that the Lord hath said will we do, and be obedient.” — the book of the covenant; that is, the book which all the instruction collected over the years, the collection of laws and promises made;

— according to the Midrash, this “Book of the Covenant” contained the laws from Genesis until that moment at Sinai.

And Moses took the blood and sprinkled it on the people, and said, “Behold the blood of the covenant which the Lord hath made with you concerning all these words.” — and sprinkled it on the people; not on the whole body of the people, who could not be brought nigh enough, and were too numerous to be all sprinkled with it;

— either this was sprinkled on the young men that offered the sacrifices in the name of all the people; or on the seventy elders, as the heads of the Israelites.

Then went up Moses and Aaron, Nadab and Abihu, and seventy of the elders of Israel; — then went up Moses and Aaron with his two oldest sons, Nadab and Abihu;

— after the above things were done, the words of the Lord were told the people, and the book of the covenant read unto them, to which they agreed, sacrifices were offered, and the blood of them sprinkled on the altar, and on the people;

10 and they saw the God of Israel. And there was under His feet as it were a paved work of a sapphire stone, and as it were the body of heaven in his clearness. — they saw the God of Israel; certainly in human form, as Isaiah saw Him, otherwise they would have fell dead;

— the Targum of Jonathan reveals a memorial of servitude under the Egyptians, saying,

“And Nadab and Abihu lifted up their eyes and saw the Glory of the God of Israel. And beneath the footstool of His feet, which was placed under His throne, was like the work of a sapphire stone—a memorial of the servitude with which the Egyptians had enslaved the children of Israel in mud and in bricks.

For the women were treading the mud along with their husbands. There was a delicate, pregnant young woman there, and she miscarried her fetus, and it was trodden into the mud.

Gabriel descended and made a brick out of it, and carried it up to the highest heavens, and set it as a footstool under the footstool of the Master of the World. Its splendor was like the work of a precious stone, and like the strength of the beauty of the heavens when they are clear of clouds.”

11 And upon the nobles of the children of Israel He laid not His hand. Also they saw God, and ate and drank. — the nobles; the seventy elders, and other persons, already mentioned;

— He laid not his hand; God did not smite them with death, or pestilence, or even blindness. It was thought to be impossible to see God and live: (Genesis 32:30Judges 6:22, 23)

— the Targum of Jonathan reveals

“And toward Nadab and Abihu, the beautiful young men, He did not send His strike (punishment) at that hour; however, it was reserved for them until the Eighth Day [of the Tabernacle’s consecration] to be completed, to visit [punishment] upon them.

And they saw the Glory of the Shekhinah of the Lord, and they rejoiced in their sacrifices which were accepted with favor, as if they were eating and as if they were drinking.”

12 And the Lord said unto Moses, “Come up to Me onto the mount, and be there; and I will give thee tablets of stone, and a law and commandments which I have written, that thou mayest teach them.”

— come up to me into the mount, and be there; for as yet Moses was not got up to the top of the mount, only up some part of it with the elders, though at some distance from the people: but now he is bid to come up higher;

— the Targum of Jonathan reveals the 613 laws were already identified during Moses time

“And the Lord said to Moses: ‘Ascend before Me to the mountain and be there; and I will give to you the tablets of stone, in which are hinted (alluded to) the rest of the words of the Torah, and the six hundred and thirteen commandments which I have written for their instruction.'”

13 And Moses rose up with his minister Joshua, and Moses went up onto the mount of God. — Moses rose up, and his minister Joshua; the close connection of Joshua with Moses is here, for the first time, indicated; his employment as a general against Amalek (Exodus 17:9-13).

14 And he said unto the elders, “Tarry ye here for us until we come again unto you; and behold, Aaron and Hur are with you. If any man have any matters to arbitrate, let him come unto them.” — Moses said unto the elders; he understood that his stay in the mount was about to be a prolonged one.

15 And Moses went up onto the mount, and a cloud covered the mount. — and Moses went up into the mount; to the top of it, and as it seems alone, leaving Joshua behind in a lower part of the mountain.

16 And the glory of the Lord abode upon Mount Sinai, and the cloud covered it six days; and the seventh day He called unto Moses out of the midst of the cloud. — and the glory of the Lord abode upon Mount Sinai; the divine Shekinah or Majesty, some visible token of it, an exceeding great brightness and splendour for six days;

— and on the seventh day he called unto Moses out of the midst of the cloud; in which the glory of God was, and which seems to favour the first sense of the preceding clause, that it was the glory of God the cloud covered.

17 And the sight of the glory of the Lord was like devouring fire on the top of the mount in the eyes of the children of Israel. — the sight of the glory of the Lord; to the Israelites in the plain below,

— the appearance on the top of the Mount was “like devouring fire.” A light like that of a conflagration rested on the top of the Mount all the time that Moses was away.

18 And Moses went into the midst of the cloud, and got himself up onto the mount; and Moses was on the mount forty days and forty nights.

— forty days and forty nights, the whole time without eating and drinking (Deuteronomy 9:9). The number forty was certainly significant, since it was not only repeated on the occasion of his second protracted stay upon Mount Sinai.

Exodus (21-22)

•May 3, 2026 • Leave a Comment

~~~~

“I am thy shield!” the Lord said, “Unto thy seed have I given this land, from the river [Nile] of Egypt unto the great river, the River Euphrates” (Genesis 15

Exodus 21

1 “Now these are the judgements which thou shalt set before them: — now these are the judgements; the judicial laws and legal precedents, respecting the state of the people of Israel, so called because they are founded on justice and equity, and are according to precedents set before.

If thou buy a Hebrew servant, six years he shall serve; and in the seventh he shall go out free for nothing. — if thou buy an Hebrew servant; every Israelite was free-born; but slavery (through poverty, debt, or crime) was permitted under certain restrictions.

If he came in by himself, he shall go out by himself; if he was married, then his wife shall go out with him. — if he came in by himself, he shall go out by himself; that is, if he came into his servitude on his free will;

— if he were married, then his wife shall go with him; that is, if he had a wife, a daughter of Israel, as the Targum of Jonathan says; “but if (he be) the husband of a wife, a daughter of Israel, his wife shall go out with him.”

If his master has given him a wife, and she has borne him sons or daughters, the wife and her children shall be her master’s, and he shall go out by himself.

— if his master have given him a wife; if, however, the Hebrew slave, being previously unmarried, had been allowed by his master to take to wife one of his female slaves, then, when the husband claimed his freedom, both she and her children remained in his master’s stronghold.

And if the servant shall plainly say, ‘I love my master, my wife, and my children; I will not go out free,’ — if a man has no rights, he is thankful for small mercies, and responds with warm feeling to those who treat him kindly.

then his master shall bring him unto the judges (Elohim). He shall also bring him to the door or unto the doorpost, and his master shall bore his ear through with an awl, and he shall serve him for ever.

— his master shall bring him unto the judges (Elohimin in the original Hebrew); a formal act, a divine act, santifies by God as if they are God’s envoy, hence these judges are acting as Elohim; “for my name is in him” Exodus 23:21

“And if a man sell his daughter to be a maidservant, she shall not go out as the menservants do.

— if a man sell his daughter; Hebrew girls might be redeemed for a reasonable sum. But in the event of her parents or friends being unable to pay the redemption money, her owner was not at liberty to sell her elsewhere.

If she please not her master who hath betrothed her to himself, then shall he let her be redeemed. To sell her unto a strange nation he shall have no power, seeing he hath dealt deceitfully with her.

— then shall he let her be redeemed, either by herself or friends, or any other person that will redeem her, but not selling her to a foreigner.

And if he has betrothed her unto his son, he shall deal with her after the manner of daughters. — he shall deal with her after the manner of daughters; as if she was his daughter, and give her a dowry: or the son shall treat her after the manner the daughters of Israel are treated when married.

10 If he take for himself another wife, her food, her raiment, and her duty of marriage shall he not diminish. — her food, her raiment, and her duty of marriage, shall he not diminish; neither deny it her in whole, nor lessen it in part, but give her her full due of each.

11 And if he does not do these three unto her, then shall she go out free, without money. — then shall she go out free without money; be dismissed from her servitude, and not obliged to pay anything for her freedom.

12 “He that smiteth a man so that he die shall be surely put to death. — shall surely be put to death; by the order of the civil magistrate, and by the hand of such as shall be appointed by him; for this is the law of God.

13 And if a man lie not in wait, but God deliver him into his hand, then I will appoint thee a place whither he shall flee. — his life is taken away by him, though not purposely and maliciously; a distinction being drawn between accidental and intentional killing, then I will appoint thee a place, an asylum, whither he shall flee.

14 But if a man come presumptuously upon his neighbor to slay him with guile, thou shalt take him from Mine altar, that he may die. — if a man come presumptuously; rather, if a man come maliciously, or with premeditation; the Targum says then he may be slain by the sword by the priests.

15 “And he that smiteth his father or his mother shall be surely put to death. — so sacred and inviolable is that reverence which children owe to their parents, that, by the law of God, it was death not only to strike them, but even to curse or outrageously revile them, Exodus 21:17;

— the Targum of Jonathan says

And he who woundeth his father or his mother shall die by strangling.

16 “And he that stealeth a man and selleth him, or if he shall be found in his hand, he shall surely be put to death.

— the Targum of Jonathan says

And he who stealeth a soul of the children of Israel, and selleth him, or if he be found in his possession, shall die by strangling.

17 “And he that curseth his father or his mother shall surely be put to death. — and he that curseth his father, or his mother; though he does not smite them with his hand, yet if he smites them with his tongue, or speaks evil of them, shall surely be put to death;

— or as the Targum of Jonathan more specifically says; be killed by casting stones.

18 “And if men strive together and one smite another with a stone or with his fist, and he die not but keepeth to his bed, — the law imposed a fine, which was to be fixed at such an amount as would at once compensate the sufferer for the loss of his time, and defray the cost of his cure in his sick bed.

19 if he rise again and walk abroad upon his staff, then shall he that smote him be acquitted; he shall only pay for the loss of his time, and shall cause him to be thoroughly healed.

20 “And if a man smite his servant or his maid with a rod, and he die under his hand, he shall be surely punished. — and if a man smite his servant or his maid with a rod; a Canaanitish servant or maid, as the Targum of Jonathan says.

21 Notwithstanding, if he continue a day or two, he shall not be punished; for he is his money. — for he is his money; that is, his possession bought with his money.

22 “If men strive and hurt a woman with child, so that her fruit depart from her, and yet no misfortune follow, he shall be surely punished according as the woman’s husband will lay upon him; and he shall pay as the judges determine. — the husband may impose a fine, and if it be unreasonable, the judges shall have a power to moderate it.

23 And if any misfortune follow, then thou shalt give life for life, — the Targum of Jonathan, “but if there is death in her, then ye shall judge or condemn the life of the murderer for the life of the woman;’

— God intends it to be “life for life” especially against a woman with child; but men feel it too excessive hence soften it to a pecuniary or monetary compensation to be paid;

24 eye for eye, tooth for tooth, hand for hand, foot for foot, — in civil cases, it was given to regulate the procedure of the public magistrate in determining the amount of compensation in every case of injury, but did not encourage feelings of private revenge;

— but the Son of God says something radically different later, “Ye have heard that it hath been said, ‘An eye for an eye, and a tooth for a tooth.’ But I say unto you that ye resist not evil, but whosoever shall smite thee on thy right cheek, turn to him the other also. Matthew 38-39;

25 burning for burning, wound for wound, stripe for stripe. — the Targum of Jonathan says, the price of the pain of burning for burning, and indeed, in everyone of these cases, the law could not be well literally executed.

26 “And if a man smite the eye of his servant or the eye of his maid, that it perish, he shall let him go free for his eye’s sake. — this law was made to deter masters from using their servants with cruelty, since they would loose their own profit and advantage.

27 And if he smite out his manservant’s tooth or his maidservant’s tooth, he shall let him go free for his tooth’s sake. — all other principal members of the body, which they reckon to be twenty four, are included, as the fingers, toes and so on.

28 “If an ox gore a man or a woman, so that they die, then the ox shall be surely stoned, and his flesh shall not be eaten; but the owner of the ox shall be acquitted. — injuries to the person might arise either from man or from animals; protection from both was needed;

— an ox killed by stoning would not be bled in the usual way, and would be “unclean” for food; the flesh should not even be disposed of to the Gentiles, but had to be buried.

29 But if the ox were wont to push with his horn in times past, and it hath been testified to his owner, and he hath not kept him in so that he hath killed a man or a woman, the ox shall be stoned and his owner also shall be put to death.

30 If there be laid on him a sum of money, then he shall give for the ransom of his life whatsoever is laid upon him.

MSG (28-32)

“If an ox gores a man or a woman to death, the ox must be stoned. The meat cannot be eaten but the owner of the ox is in the clear.

But if the ox has a history of goring and the owner knew it and did nothing to guard against it, then if the ox kills a man or a woman, the ox is to be stoned and the owner given the death penalty.

If a ransom is agreed upon instead of death, he must pay it in full as a redemption for his life. If a son or daughter is gored, the same judgment holds. If it is a slave or a handmaid the ox gores, thirty shekels of silver is to be paid to the owner and the ox stoned.

31 Whether he hath gored a son or hath gored a daughter, according to this judgment shall it be done unto him.

32 If the ox shall push a manservant or a maidservant, he shall give unto their master thirty shekels of silver, and the ox shall be stoned.

33 “And if a man shall open a pit, or if a man shall dig a pit and not cover it, and an ox or an ass fall therein,

— the MSG (33-34)

“If someone uncovers a cistern or digs a pit and leaves it open and an ox or donkey falls into it, the owner of the pit must pay whatever the animal is worth to its owner but can keep the dead animal.

the owner of the pit shall make it good and give money unto the owner of them, and the dead beast shall be his.

35 And if one man’s ox hurt another’s, so that he die, then they shall sell the live ox and divide the money from it, and the dead ox also they shall divide.

36 Or if it be known that the ox used to push in times past and his owner hath not kept him in, he shall surely pay ox for ox, and the dead shall be his own.

— the MSG (35-36)

“If someone’s ox injures a neighbor’s ox and the ox dies, they must sell the live ox and split the price; they must also split the dead animal. But if the ox had a history of goring and the owner knew it and did nothing to guard against it, the owner must pay an ox for an ox but can keep the dead animal.”

The cases mentioned above give rules of justice then, and the British developed their common law from there, and is still in use for deciding similar matters in many of the Commonwealth of Nations.

We are taught by these laws, that we must be very careful to do no wrong, either directly or indirectly. If we have done wrong, we must be very willing to make it good, and be desirous that nobody may lose by any wrong doing.

~~~

Exodus 22

1 “If a man shall steal an ox or a sheep, and kill it or sell it, he shall restore five oxen for an ox and four sheep for a sheep. — five oxen . . . four sheep; the principle of the variation is not clear; perhaps the theft of an ox was regarded as involving more audacity, and so more guilt in the thief.

“If a thief be found breaking in and be smitten so that he die, there shall no blood be shed for him. — if a thief, in breaking into a dwelling in the night, was slain, the person who slew him did not incur the guilt of blood;

If the sun be risen upon him, there shall be blood shed for him, for he should make full restitution. If he have nothing, then he shall be sold for his theft. — if the sun be risen upon him. If the entry is attempted after daybreak. In this case it is charitably assumed that the thief does not contemplate murder;

— a robber breaking into a house at midnight might, in self-defense, be slain with impunity; but if he was slain after sunrise, it would be considered murder, for it was not thought likely an assault would then be made upon the lives of the occupants. In every case where a thief could not make restitution, he was sold as a slave for the usual term.

If the theft be certainly found in his hand alive, whether it be ox or ass or sheep, he shall restore double. — if the theft be certainly found in his hand alive; or “in finding be found” be plainly and evidently found upon him, before witnesses; so that there is no doubt of the theft; 

— he shall restore double; two oxen for an ox, two asses for an ass, and two sheep for a sheep; the thief being convicted in his own conscience of his evil, makes confession, or, however, the creatures are found with alive, and so more useful being restored;

“If a man shall cause a field or vineyard to be eaten, and shall put in his beast and shall feed in another man’s field, of the best of his own field and of the best of his own vineyard shall he make restitution.

“If fire break out and catch in thorns, so that the stacks of corn or the standing corn or the field be consumed therewith, he that kindled the fire shall surely make restitution.

“If a man shall deliver unto his neighbor money or stuff to keep, and it be stolen out of the man’s house, if the thief be found, let him pay double.

If the thief be not found, then the master of the house shall be brought unto the judges to see whether he has put his hand unto his neighbor’s goods.

“For all manner of trespass, whether it be for ox, for ass, for sheep, for raiment, or for any manner of lost thing which another challengeth to be his, the cause of both parties shall come before the judges; and whom the judges shall condemn, he shall pay double unto his neighbor.

10 “If a man deliver unto his neighbor an ass, or an ox, or a sheep, or any beast to keep, and it die or be hurt or driven away, no man seeing it,

11 then shall an oath of the Lord be between them both that he hath not put his hand unto his neighbor’s goods; and the owner of it shall accept thereof, and he shall not make it good.

12 And if it be stolen from him, he shall make restitution unto the owner thereof.

13 If it be torn in pieces, then let him bring it for witness, and he shall not make good that which was torn.

14 “And if a man borrow aught from his neighbor, and it become hurt or die, the owner thereof being not with it, he shall surely make it good.

15 But if the owner thereof be with it, he shall not make it good; if it be a hired thing, it came for his hire.

16 “And if a man entice a maid who is not betrothed, and lie with her, he shall surely endow her to be his wife.

The cases mentioned above give rules of justice then, and the British developed their common law from there, and is still in use for deciding similar matters in many of the Commonwealth of Nations.

We are taught by these laws, that we must be very careful to do no wrong, either directly or indirectly. If we have done wrong, we must be very willing to make it good, and be desirous that nobody may lose by any wrong doing.

17 If her father utterly refuse to give her unto him, he shall pay money according to the dowry of virgins.

— if her father refused to give her to him, he was to weigh (pay) money equivalent to the dowry of maidens, that is, to pay the father just as much for the disgrace brought upon him by the seduction of his daughter, as maidens would receive for a dowry upon their marriage.

18 “Thou shalt not suffer a witch to live. — the fact that witchcraft is often nothing but jugglery to deceive the people, and only those witches were to be put to death who would not give up their witchcraft assisted by evil spirits when it was forbidden.

19 “Whosoever lieth with a beast shall surely be put to death. — according to the Targum of Jonathan, the death of such a person was by stoning, for it says, he “shall be stoned to death.”

20 “He that sacrificeth unto any god, save unto the Lord only, he shall be utterly destroyed. — according to the Targum of Jonathan, the death of such a person “shall be slain with the sword.”

21 “Thou shalt neither vex a stranger nor oppress him, for ye were strangers in the land of Egypt. — thou shall not vex a stranger; one that is not born in Israel, but comes into another country to sojourn;

— nor oppress him; by taking his goods, by refusing to assist him with advice when asked, to trade with him, or to give him lodging, and furnish him with the necessaries of life.

22 Ye shall not afflict any widow or fatherless child. — law against oppressing widows and orphans. With the stranger are naturally placed the widow and orphan; like him, weak and defenceless; like him, special objects of God’s care.

23 If thou afflict them in any wise, and they cry at all unto Me, I will surely hear their cry; — I will surely hear their cry; the Targum of Jonathan says, “I will hear the voice of their prayer, and will avenge them.”

24 and My wrath shall wax hot, and I will kill you with the sword; and your wives shall be widows, and your children fatherless. — and I will kill you with the sword; with the sword, says the Targum of Jonathan;

— it designs one of God’s sore judgments, the sword; the meaning is, that when such evils should become frequent among them, God would suffer a neighbouring nation to break in upon them in an hostile way, and put them to the sword.

25 “If thou lend money to any of My people who are poor among thee, thou shalt not be to him as a usurer, neither shalt thou lay upon him usury. — interest not to be taken on money lent to the poor; especially to fellow Israelites;

— on the other hand, the lending of money upon interest to foreigners was distinctly allowed (Deuteronomy 23:20), and no limit placed upon the amount of interest that might be taken.

26 If thou at all take thy neighbor’s raiment in pledge, thou shalt deliver it unto him by the time the sun goeth down, — if he gave his upper garment as a pledge, he was to give it him back towards sunset, because it was his only covering; as the poorer classes use them as garment for warmth.

27 for that is his only covering. It is his raiment for his skin. Wherein shall he sleep? And it shall come to pass, when he crieth unto Me, that I will hear, for I am gracious.

— for I am gracious; or equitable; and therefore everything cruel and uncompassionate is abominable to him, and he will take care in his providence that the injured person shall be redressed and the injurer punished.

28 “Thou shalt not revile the judges, nor curse the ruler of thy people. — Thou shalt not revile, speak evil, show disrespect, to the judges and magistrates, for they are also acting as ‘ělôhı̂ym, or as gods.

29 “Thou shalt not delay to offer the first of thy ripe fruits and of thy liquors. The firstborn of thy sons shalt thou give unto Me. — like the firstfruits of the soil, the firstborn of men and animals are also to be given to God; who spared not his own Son, but delivered him up for all of us as well.

30 Likewise shalt thou do with thine oxen and with thy sheep: seven days it shall be with his dam; on the eighth day thou shalt give it to Me.

— the main object of forbidding sacrifice before the eighth day would appear to have being in regard for the health and comfort of the mother, which needed the relief obtained by suckling of its offspring.

31 “And ye shall be holy men unto Me; neither shall ye eat any flesh that is torn by beasts in the field: ye shall cast it to the dogs.

— neither shall ye eat any flesh that is torn of beasts; partly, because the blood was not taken out of it; partly, because the clean beast was ceremonially defiled by the touch of the unclean.

Exodus (19-20)

•May 2, 2026 • Leave a Comment

~~~~

“I am thy shield!” the Lord said, “Unto thy seed have I given this land, from the Nile of Egypt unto the great river, the River Euphrates” (Genesis 15

Exodus 19

In the third month after the children of Israel had gone forth out of the land of Egypt, the same day came they into the Wilderness of Sinai.

— the Targum of Jonathan says

“In the third month of the Exodus of the sons of Israel from the land of Mizraim, on that day, the first of the month, came they to the desert.”

For they had departed from Rephidim, and had come to the desert of Sinai and had pitched camp in the wilderness; and there Israel camped before the mount.

— for they were departed from Rephidim; after they had fought with Amalek, and came to the western part of the mount to Horeb, where the rock was smitten for them; and they were come from that now, and encamped at Sinai.

And Moses went up unto God, and the Lord called unto him out of the mountain, saying, “Thus shalt thou say to the house of Jacob, and tell the children of Israel:

— and Moses went up unto God; who was in the pillar of cloud upon the top of the mount; this was on the second day, according to the Targum of Jonathan: “the Lord called unto him out of the mountain;”

‘Ye have seen what I did unto the Egyptians, and how I bore you on eagles’ wings and brought you unto Myself.

— the Targums of Jonathan and Jerusalem paraphrase the words, “and I bore you on clouds, as on eagles’ wings;” which covered and protected and sustained them, as the eagles’ wings do its young.

Now therefore, if ye will obey My voice indeed and keep My covenant, then ye shall be a peculiar treasure unto Me above all people; for all the earth is Mine.

— above all people: for all the earth is mine; while claiming a peculiar right in Israel, God does not mean to separate Himself from the other nations, to cease to care for them, or give them up to their own devices;

— He is always “the Most High over all the earth” (Psalm 83:18), “a light to lighten the Gentiles,” one who “judges the people righteously, and governs all the nations upon earth” (Psalm 67:4). Israel’s prerogative does not rob them of their birthright. He maybe the favoured son; but they, too, “are, all of them, children of the Most High” (Psalm 82:6).

And ye shall be unto Me a kingdom of priests and a holy nation.’ These are the words which thou shalt speak unto the children of Israel.” — “if ye will obey My voice indeed and keep My covenant” ye shall be unto Me a kingdom of priests and a holy nation;

— and ye shall be unto me a kingdom of priests; instead of being in a state of servitude and bondage, as they had been in Egypt; and an holy nation” being separated from all others, and devoted to the worship and service of the true God.

And Moses came and called for the elders of the people, and laid before their faces all these words which the Lord commanded him. — Moses called for the elders, they formed the usual channel of communication between Moses and the people, reporting his words to them, and theirs to him.

And all the people answered together and said, “All that the Lord hath spoken we will do.” And Moses returned the words of the people unto the Lord. — all that the Lord hath spoken we will do; obey his voice in all things he directs unto, or keep the covenant he should make with them, and observe whatever was required on their parts;

And the Lord said unto Moses, “Lo, I come unto thee in a thick cloud, that the people may hear when I speak with thee, and believe thee for ever.” And Moses told the words of the people unto the Lord. — and the Lord said unto Moses; and the Targum of Jonathan added, on the third day;

10 And the Lord said unto Moses, “Go unto the people and sanctify them today and tomorrow, and let them wash their clothes — and let them wash their clothes; which to be understood both of their garments and their bodies also; teaching them by these outward things the necessity of internal purity and holiness, to appear before God;

11 and be ready against the third day; for the third day the Lord will come down in the sight of all the people upon Mount Sinai. — and be ready against the third day; not the third day of the month, but the third day from hence, this being the fourth, and the morrow the fifth, and the third day, the day following that, the sixth;

— for the third day the Lord will come down in the sight of all the people upon Mount Sinai; which must be understood, consistent with his omnipresence, and is only expressive of some visible display of his power, and of some sensible token of his presence to the people;

12 And thou shalt set bounds unto the people round about, saying, ‘Take heed to yourselves, that ye go not up into the mount or touch the border of it. Whosoever toucheth the mount shall be surely put to death. — whosoever toucheth the mount shall be surely put to death; which severe law was made to deter them from any attempt to go up the mountain, since it was death even to touch it;

13 There shall not a hand touch it, but he shall surely be stoned or shot through; whether it be beast or man, it shall not live.’ When the trumpet soundeth long, they shall come up to the mount.”

— the Targum of Jonathan seems to understand it, as if punishment would be immediately inflicted upon such a person, not by the hands of men, but by the hand of God; for it says, such an one shall be stoned with hailstones, and fiery darts shall be spread upon him; or, as the Jerusalem Targum, shall be shot at him.

14 And Moses went down from the mount unto the people, and sanctified the people; and they washed their clothes. — and Moses went down from the mount unto the people; the same day that he went up, the fourth day of the month:

— touch it; rather “touch him,” the person who had touched the mount was not to be touched, since the contact would be pollution.

15 And he said unto the people, “Be ready against the third day. Come not at your wives.” — come not at your wives; it was the general sentiment of antiquity that a ceremonial uncleanness attached even to the chastest sexual connection.

16 And it came to pass on the third day in the morning, that there were thunders and lightnings and a thick cloud upon the mount, and the voice of the trumpet exceeding loud, so that all the people who were in the camp trembled.

— there were thunders, and lightnings, and a thick cloud upon the mount; so that all the people that was in the camp trembled, at the sound of it being so loud and terrible, it pierced their ears and hearts;

17 And Moses brought forth the people out of the camp to meet with God, and they stood at the nether part of the mount. — out of the camp; an open space outside the camp before the mountain into which Moses led the representatives of the people, their officials so bringing them as near to God as was permitted.

18 And Mount Sinai was altogether in smoke, because the Lord descended upon it in fire; and the smoke thereof ascended as the smoke of a furnace, and the whole mount quaked greatly. — the whole mount quaked greatly, as in Psalm 68:8, “The earth shook, the heavens also dropped at the presence of God: even Sinai itself was moved at the presence of God.”

— because the Lord descended upon it in fire; in flaming fire, as the Targum says, which set the mountain on fire, and caused this prodigious smoke; for if he, who is a consuming fire, but toucheth the hills and mountains, they smoke, Psalm 104:32;

the Targum:

And all the mount of Sinai was in flame; for the heavens had overspread it, and He was revealed over it in flaming fire, and the smoke went up as the smoke of a furnace, and all the mountain quaked greatly.

19 And when the voice of the trumpet sounded long and waxed louder and louder, Moses spoke, and God answered him by a voice.

— Moses spake; what he said is not here recorded; it is highly probable, as has been observed by some, that he uttered those words related of him in Hebrews 12:21 “I exceedingly fear and quake”: such an impression did this loud and strong voice of the trumpet make upon him:

— and God answered him by a voice; a still and gentle one, in order to encourage and comfort him; and so the Targum of Jonathan paraphrases it, “with a gracious and majestic voice, and pleasant and gracious words.”

20 And the Lord came down upon Mount Sinai, on the top of the mount; and the Lord called Moses up to the top of the mount, and Moses went up. — and the Lord called Moses up to the top of the mount; who either was at the bottom of it with the people, or in a higher ascent of it between God and them;

21 And the Lord said unto Moses, “Go down. Charge the people, lest they break through to gaze unto the Lord, and many of them perish. — charge the people, lest they break through unto the Lord to gaze; to see if they could observe any similitude or likeness of God,

— that they might make an image like unto it; to prevent which, the Lord, knowing the vanity and curiosity of their minds, ordered Moses to give them a strict charge not to transgress the bounds set them, or whatever was placed for bounds;

22 And let the priests also, who come near to the Lord, sanctify themselves, lest the Lord break forth upon them.” — and let the priests also, which come near unto the Lord; either the firstborn, as the Jews generally interpret it, or the sons of Aaron, who should be, and were potentially, though not official actually priests;

23 And Moses said unto the Lord, “The people cannot come up to Mount Sinai; for Thou charged us, saying, ‘Set bounds about the mount and sanctify it.’” — for thou chargedst us, saying, set bounds about the mount, and sanctify it; and accordingly bounds have been set,

— that the people may not go up it, and the place has been declared sacred, that so none will presume to do it, according to the solemn charge that has been given;

24 And the Lord said unto him, “Away! Get thee down, and thou shalt come up, thou and Aaron with thee; but let not the priests and the people break through to come up unto the Lord, lest He break forth upon them.”

— but let not the priests and the people break through to come up unto the Lord, lest he break forth upon them; it required the immediate presence of Moses below, and immediate care was to be taken by him;

— lest the priests and people, led by a vain curiosity, should attempt to ascend the mount, and come to where God was, to see if they could observe any likeness of him; which would so provoke him, that in just retaliation, as they had broke through the bounds set, he would break forth on them by inflicting sudden death upon them.

25 So Moses went down unto the people and spoke unto them. — and spake unto them: charging them to keep their distance, and not presume to pass the line he had drawn, or the fence he had made.

Exodus 20

1 And God spoke all these words, saying: — ‘I am the Lord thy God, which have brought thee out of the land of Egypt.’ God speaks to the nation as a whole, establishing a special relation between Himself and them, which is founded on His redeeming act, and is reciprocal, requiring that they should be His people, as He is their God;

Today’s Golden Calf: the 2024 Paris Olympics has gone full Woke dystopian with transgend*r mockery of the Last Supper, the Golden Calf idol,
and even the Pale Horse from the Book of Revelation

“I am the Lord thy God, who have brought thee out of the land of Egypt, out of the house of bondage. — which have brought thee out of the land of Egypt: where they had been afflicted many years, and reduced to great distress, but were brought forth with an high hand;

— out of the house of bondage: where they had been servants and slaves, but now were made free, and were become a body politic, a kingdom of themselves, under their Lord, King, Lawgiver.

— the Targum of Jonathan reveals it isn’t just sound; it’s sparks, lightning and fire, saying

“The First Word (Commandment), when it went forth from the mouth of the Holy One—blessed be His name—was like sparks, and like lightnings, and like flames of fire. A lamp of light was at His right hand, and a lamp of fire at His left.

“It flew and soared through the air of the heavens, and returned and was seen over the camps of Israel. Then it returned and became engraved upon the Tablets of the Covenant that were placed in the hands of Moses, turning itself upon them from side to side.

“And then it cried out and said: ‘My people, children of Israel, I am the Lord your God, who redeemed and brought you out redeemed from the land of the Egyptians, from the house of the bondage of slaves.'”

“Thou shalt have no other gods before Me. — there shall not be to thee another god, or other gods, to wit, idols, which others have, esteem, and worship as gods;

— again, the Targum of Jonathan reveals there are sparks, lightning and fire, saying

“The Second Word (Commandment), when it went forth from the mouth of the Holy One—blessed be His name—was like sparks, and like lightnings, and like flames of fire. A lamp of light was at His right hand, and a lamp of fire at His left.

“It flew and soared through the air of the heavens, returned and was seen over the camps of Israel, and returned and became engraved upon the Tablets of the Covenant, turning itself upon them from side to side.

“And then it cried out and said: ‘My people, House of Israel, you shall have no other god besides Me.'”

“Thou shalt not make unto thee any graven image, or any likeness of anything that is in heaven above, or that is in the earth beneath, or that is in the water under the earth. — anything that is in heaven; as of God, Deu 4:15 Isaiah 44:9,20, angels, sun, moon, or stars, which the heathens worshipped, Deu 4:19 17:3.

— or in the earth; as of men, and beasts; or in the water; as of fishes, such as Dagon was; or serpents, crocodiles, and such other Egyptian deities; although Moses only speaks of idols, there is no doubt that by implication he condemns all the forms of false worship, which men have invented for themselves.

Thou shalt not bow down thyself to them, nor serve them; for I, the Lord thy God, am a jealous God, visiting the iniquity of the fathers upon the children unto the third and fourth generation of them that hate Me, — unto the third and fourth generation of them that hate me; as all idolaters must be thought to do;

— “the third and fourth generation” of them that hate me, the term is a strong one, and denotes those who persistently and defiantly oppose themselves to God, because sometimes parents lived to see these, and so with their eyes beheld the punishment inflicted upon their posterity for their sins.

and showing mercy unto thousands of them that love Me and keep My commandments. — showing mercy unto thousands; rather, to the thousandth generation, as is distinctly expressed in Deuteronomy 7:9.

“Thou shalt not take the name of the Lord thy God in vain, for the Lord will not hold him guiltless that taketh His name in vain. — the Lord will not hold him guiltless; punishment will assuredly overtake the perjured man, if not in this life, then in another.

“Remember the Sabbath day, to keep it holy. — it is taken for granted, that the sabbath was instituted before. God’s blessing and sanctifying a seventh day is derivedn right from the beginning, (Genesis 2:3) so that this was not the enacting of a new law, but the reviving of an old law.

Six days shalt thou labor and do all thy work; — that all should be done on the six days that could possibly be done, and nothing left to be done on the seventh.

10 but the seventh day is the Sabbath of the Lord thy God. In it thou shalt not do any work, thou, nor thy son, nor thy daughter, thy manservant, nor thy maidservant, nor thy cattle, nor thy stranger that is within thy gates.

— resting from every work is the basis of the observance of the Sabbath; it shall be a day of holy rest from things worldly, and of devotion to things heavenly.

11 For in six days the Lord made heaven and earth, the sea, and all that in them is, and rested the seventh day. Therefore the Lord blessed the Sabbath day and hallowed it. — the Lord blessed the sabbath day, that is, made it a day of blessing; as of conferring his blessings and favours upon those that religiously observe it.

12 “Honor thy father and thy mother, that thy days may be long upon the land which the Lord thy God giveth thee. — that thy days may be long, that their, that is, thy parents, may prolong thy days, or the days of thy parents’ life;

13 “Thou shalt not kill. — from the peculiar duties owed by children to their parents, the Divine legislator went on to lay down those general duties which men owe to their fellow-men;

— the Targum of Jonathan expounds these few verses, saying

“My people, children of Israel, do not be murderers, nor friends or partners with murderers. Let there not be seen in the congregations of Israel [fellowship] with murderers, so that your children who arise after you do not learn to be with murderers. For because of the sin of murderers, the sword (war) goes out upon the world.

“My people, children of Israel, do not be adulterers (giyurin), nor friends or partners with adulterers… so that your children do not learn… For because of the sin of adultery, death (pestilence) goes out upon the world.

“My people, children of Israel, do not be thieves, nor friends or partners with thieves… so that your children do not learn… For because of the sin of thieves, famine goes out upon the world.

“My people, children of Israel, do not be witnesses of falsehood against your neighbors, nor friends or partners with false witnesses… so that your children do not learn… For because of the sin of false witnesses, clouds rise but rain does not descend, and drought comes upon the world. Exodus 20:13-16 Jonathan

14 “Thou shalt not commit adultery. — thou shalt not commit adultery; this commandment forbids all acts of uncleanness, with all those desires which produce those acts and war against all kinds of filthiness, as bestiality, sodomy, whoredom, fornication.

15 “Thou shalt not steal. — either by deceit or violence, or without his knowledge and consent, take away another man’s goods;

16 “Thou shalt not bear false witness against thy neighbor. — this forbids; speaking falsely in any matter, laying false charges, lying, equivocating, and any way devising and designing to deceive our neighbour.

17 “Thou shalt not covet thy neighbor’s house; thou shalt not covet thy neighbor’s wife, nor his manservant, nor his maidservant, nor his ox, nor his ass, nor anything that is thy neighbor’s.”

— thou shalt not covet; the foregoing commands implicitly forbid all desire of doing that which will be an injury to our neighbour.

18 And all the people saw the thunderings and the lightnings, and the noise of the trumpet and the mountain smoking; and when the people saw it, they removed and stood afar off. — and when the people saw it, they retreated and stood afar off; their minds terrified and distressed, and their bodies shook with fear;

— but they could not stand their ground, but were obliged to retreat further, and gaze and see what they could; the Targum of Jonathan says the people stood twelve miles off.

19 And they said unto Moses, “Speak thou with us and we will hear; but let not God speak with us, lest we die.” — let not God speak with us, lest we die; the phenomena of thunder and lightning had been one of the plagues so fatal to Egypt, and as they heard God speaking to them now, they were apprehensive of instant death also.

20 And Moses said unto the people, “Fear not; for God has come to test you, and that His fear may be before your faces, that ye sin not.”

— fear not; that is, think not that this thunder and fire are designed to consume you; but that his dreadful manifestation of his majesty and justice, may be now and ever before your eyes, and in your memories, as an effectual preservative from straying away from him.

21 And the people stood afar off, and Moses drew near unto the thick darkness where God was. — the Targum says in verse 18 above, the distance was twelve miles off;

— and Moses drew near to the thick darkness where God was; the thick cloud, and so Moses passed through the darkness, and the cloud, to the thick darkness where יְהוָה Yehovah was;

22 And the Lord said unto Moses, “Thus thou shalt say unto the children of Israel: ‘Ye have seen that I have talked with you from heaven.

— ye have seen that I have talked with you from heaven; descending on Mount Sinai in a cloud and fire, and talked with them out of the cloud and fire, and delivered to them with an audible voice the above ten commands;

23 Ye shall not make with Me gods of silver, neither shall ye make unto you gods of gold. — to make Gods of silver and gods of gold are specially forbidden, because it was idolatry of the same kind; the golden calf or any molten images is no isolated phenomenon;

— Jeroboam set up molten images at Dan and Bethel for the northern Ten Tribes but there were no uprising! “Dead fish goes with the flow!”

24 An altar of earth thou shalt make unto Me, and shalt sacrifice thereon thy burnt offerings and thy peace offerings, thy sheep and thine oxen. In all places where I record My name I will come unto thee, and I will bless thee.

— in all places where I record my name; or where my name is recorded; or, “cause it to be mentioned” that is, where I am worshipped in sincerity; I will come unto thee, and will bless thee;

Note the Five types of Offerings summarised in Leviticus:

Leviticus 1:2 “Speak unto the children of Israel and say unto them: ‘If any man of you bring an offering unto the Lord

Leviticus 1:3 ‘If his offering be a burnt sacrifice
Leviticus 2:1 ‘And when any will offer a meat offering
Leviticus 3:1 ‘And if his oblation be a sacrifice of peace offering
Leviticus 4:3 ‘If the priest … a young bullock … for a sin offering
Leviticus 5:6 ‘And he shall bring his trespass offering

Compare to the Five types of Offerings during the Millennium in Ezekiel:

Ezekiel 46:12 ‘Now when the prince prepares a voluntary burnt offering, or peace offerings unto the Lord
Ezekiel 44:29 ‘They shall eat the meat offering and the sin offering and the trespass offering

25 And if thou wilt make Me an altar of stone, thou shalt not build it of hewn stone; for if thou lift up thy tool upon it, thou hast polluted it.

— thou hast polluted it; and so made it unfit for use: how this should be done hereby is not easy to understand; no good reason seems easy to human understanding but probably the will and pleasure of God (Gill);

— the real object was that altars should not be elaborately carved with objects that might superinduce idolatry: Pulpit Commentary;

— the Targum of Jonathan

And you, the priests, who stand to minister before Me, shall not ascend to My altar by steps, but by (sloping) bridges; that thy shame may not be seen thereupon.

26 Neither shalt thou go up by steps unto Mine altar, that thy nakedness be not uncovered thereon.’ — Neither shalt thou go up by steps unto mine altar; but afterward God appointed an altar ten cubits high. One can speculate they went not up to that by steps, but by a sloping ascent.

MSG

God said to Moses, “Give this Message to the People of Israel: ‘You’ve experienced firsthand how I spoke with you from Heaven. Don’t make gods of silver and gods of gold and then set them alongside me. Make me an earthen Altar. Sacrifice your Whole-Burnt-Offerings, your Peace-Offerings, your sheep, and your cattle on it.

Every place where I cause my name to be honored in your worship, I’ll be there myself and bless you. If you use stones to make my Altar, don’t use dressed stones. If you use a chisel on the stones you’ll profane the Altar. Don’t use steps to climb to my Altar because that will expose your nakedness.’”

King Charles’ warns Trump could be speaking French

•May 1, 2026 • Leave a Comment
Battle of Quebec, 1759, Fighting between the British and the French forces, Quebec City, along the Plains of Abraham

Why did King Charles’ subtle but striking warning to America that they could be speaking French?

King Charles’s striking remark that Americans could be “speaking French” was a sharp-witted historical retort aimed at President Donald Trump during a White House state dinner on Tuesday, April 28, 2026.

The comment was a direct counterpoint to President Trump’s previous assertions that without American intervention in World War II, Europeans would be “speaking German and a little Japanese.” King Charles cleverly flipped this logic by referencing the 18th-century colonial rivalry between Britain and France for control of North America.

The Context of the Exchange

The King used the state dinner to blend diplomacy with humor, addressing the “special relationship” between the two nations despite underlying geopolitical tensions, such as those regarding the war in Iran.

  • The “Speaking French” Quip: Charles remarked, “You recently commented, Mr President, that if it were not for the United States, European countries would be speaking German. Dare I say that, if it wasn’t for us, you’d be speaking French.”
  • The Historical Reference: This jab referred to the Seven Years’ War (specifically the French and Indian War), where British victory prevented France from becoming the dominant colonial power in North America.
The theatre of the Seven Years’ War fought in North America as France defeated

The Seven Years’ War

The Seven Years’ War (1756–1763) is often described as the first truly global conflict, involving every major European power and spanning five continents. It essentially consisted of two distinct struggles that merged into one: a continental battle for territory in Europe and a colonial rivalry for global empire.

The Two Major Struggles

  • Austria vs. Prussia: In Europe, the conflict was a continuation of the rivalry over Silesia. Austria, Russia, and France allied against Prussia, led by Frederick the Great. Despite being heavily outnumbered, Frederick survived through tactical genius and financial support from Great Britain.
  • Britain vs. France: This theater (known as the French and Indian War in North America) focused on colonial and commercial supremacy. Britain utilized its superior navy to blockade France, cutting off their colonies from reinforcements.

Global Theaters and Key Battles

The war was fought across diverse regions with significant shifts in power:

TheaterKey Events & BattlesOutcome
North AmericaBattle of Quebec (1759); Fall of LouisbourgBritish conquered Canada and all land east of the Mississippi.
EuropeBattles of Rossbach, Leuthen, and KunersdorfPrussia established itself as a major military power.
IndiaBattle of Plassey (1757); Battle of WandiwashBritish East India Company effectively expelled French influence.
Global NavalCapture of Senegal (Africa); Seizure of Cuba & Philippines (Spain)Britain consolidated its status as the world’s dominant naval power.

How it Ended

The war concluded in 1763 with two separate treaties:

  1. Treaty of Paris: Ended the war between Britain, France, and Spain. France lost almost all its North American territory and its dominant position in India.
  2. Treaty of Hubertusburg: Ended the war between Austria and Prussia, largely restoring pre-war borders but confirming Prussia’s possession of Silesia.

Long-Term Impact

  • British Dominance: Britain emerged as the world’s leading colonial power but was left with massive debt.
  • The American Revolution: To pay off war debts, Britain imposed new taxes on its American colonies, directly fueling the resentment that led to the American Revolution.
  • Prussian Rise: Prussia’s survival against a massive coalition established it as a top-tier European power, eventually leading to the unification of Germany.

All these are part and parcel of prophecies being fulfilled

“Reuben, thou art my firstborn, my might, and the beginning of my strength, the excellency of dignity, and the excellency of power. Genesis 49:3

— Reuben~France, as the firstborn by nature, has the first place in the benedictory address;

— the Targum reveals how France lost his birthright

“Reuben, you are my firstborn, the head of my strength, the beginning of my service, and the start of the city of my thoughts.

“It was fitting for you to have the Birthright, the High Priesthood, and the Kingdom.

“But because you sinned, my son, the Birthright was given to Joseph, the Kingdom to Judah, and the Priesthood to Levi.” Genesis 49:3 Jonathan

France was to be blessed with great honor and power; the birthright was yours, the priesthood was yours, the kingship was yours, but now that you sinned, the birthright was given to Joseph, the priesthood to Levi, and the kingship to Judah.

The Battle of Waterloo, June 1815; the French Imperial Army under the Command of Napoleon was defeated by Arthur Duke of Wellington

Today, these sons of Joseph are the Five Eyes, and their nerve center runs through Washington DC, not London.

(1) The Irony of a Birthright (2) Ephraim preferred over Manasseh (3) Ephraim as the Thirteenth Tribe (4) Who is this lying Ephraim? (5) The Ox with horns of a Unicorn

Exodus (17-18)

•May 1, 2026 • Leave a Comment
“I am thy shield!” the Lord said, “Unto thy seed have I given this land, from the river of Egypt unto the great river, the River Euphrates” (Genesis 15

Exodus 17

1 And all the congregation of the children of Israel journeyed from the Wilderness of Sin after their journeys, according to the commandment of the Lord, and pitched camp in Rephidim; and there was no water for the people to drink. — being a sandy desert place there was no water for the people to drink.

Therefore the people chided Moses and said, “Give us water that we may drink.” And Moses said unto them, “Why chide ye me? Why do ye tempt the Lord?” — and Moses said unto them, why chide ye with me? as if I was he that brought you hither,

— whereas it is the Lord that goes before you in the pillar of cloud and fire, and as if I kept water from you, or could give it you at pleasure; how unreasonable, as well as how ungenerous is it in you to chide with me on this account;

And the people thirsted there for water; and the people murmured against Moses and said, “Why is this that thou hast brought us up out of Egypt to kill us and our children and our cattle with thirst?” — to kill us and our children and our cattle with thirst: which is intolerable to any, and especially to children and cattle, which require frequent drinking;

And Moses cried unto the Lord, saying, “What shall I do unto this people? They are almost ready to stone me!” — they be almost ready to stone me; this is the first which we hear of stoning as a punishment.

And the Lord said unto Moses, “Go on before the people, and take with thee of the elders of Israel; and thy rod with which thou smotest the river, take in thine hand and go. — go on before the people, lead them on nearer to Mount Sinai or Horeb, within sight of which they now were; “and see if they will stone thee.”

Behold, I will stand before thee there upon the rock in Horeb; and thou shalt smite the rock and there shall come water out of it, that the people may drink.” And Moses did so in the sight of the elders of Israel. — I will stand before thee there, in my cloudy pillar, which shall stand over that place.

And he called the name of the place Massah [that is, Temptation], and Meribah [that is, Chiding], because of the chiding of the children of Israel, and because they tempted the Lord, saying, “Is the Lord among us or not?”

— Is the Lord among us or not? to protect and provide for us according to his word; will he be as good as his word, or will he not? Words which implied that to them it was very doubtful.

Then came Amalek and fought with Israel in Rephidim. — then came Amalek, a grandson of Esau; the Amalekites had not been previously (except in the anticipatory flashforwarding in Genesis 14:7) mentioned as a tribe or nation;

— their hatred could be the old grudge of the children of Esau returning against the children of Israel; because of the affair of the birthright and blessing which Jacob stole from Esau, who were now on their march for the land of Canaan, claiming their birthright land which came to children of Esau thereby.

And Moses said unto Joshua, “Choose us out men, and go out, fight with Amalek. Tomorrow I will stand on the top of the hill with the rod of God in mine hand.” — Joshua; he was a prince of the tribe of Ephraim; chosen as a leader to fight the Amalekites.

10 So Joshua did as Moses had said to him, and fought with Amalek; and Moses, Aaron, and Hur went up to the top of the hill.

— Hur; according to Josephus (Ant. Jud., iii. 2, § 4) Hur was the husband of Miriam, and so the brother-in-law of Moses and Aaron. He was a descendant of Judah through Pharez and Hezron;

— to the top of the hill; to the top of Mount Sinai or Horeb, not so much to see the battle fought, as to be seen by Joshua and his warriors.

11 And it came to pass, when Moses held up his hand, that Israel prevailed; and when he let down his hand, Amalek prevailed. — Moses was getting old and was tired; his strongest arm will fail with being long held out; but it is God only whose hand is stretched out still.

12 But Moses’ hands were heavy; and they took a stone and put it under him, and he sat thereon. And Aaron and Hur held up his hands, the one on the one side and the other on the other side; and his hands were steady until the going down of the sun.

— both the Targums of Jonathan and Jerusalem paraphrase the words, “when Moses lift up his hands in prayer, the house of Israel prevailed, but when he restrained his hands from prayer, the house of Amalek prevailed.”

13 And Joshua discomfited Amalek and his people with the edge of the sword. — Amalek being distinguished from “his people” has established a strong sense that Amalek was the title of their king, or chief of the army (hence Chief Amalek in Genesis 36:16), and that it became the title to the kings of that nation of the Amalekites, as Pharaoh was to the kings of Egypt, or Caesar to Rome;

— that’s a significant truth; a truth during Moses time during the Exodus; more probable, later, is that the name Agag had evolved into a title for their king in place of Amalek; as stated by Balaam, employed by the king of the Moabites, to pronounce a ‘curse:’ 

“He (the children of Israel) shall pour the water out of his buckets, and his seed shall be in many waters; and his king shall be higher than Agag (hence, used in this way, it is more likely that Agag is the title of a king rather than the name of one king; and Agag was named as the king of the Amalekites in Samuel’s experience: 1 Samuel 15:8), and his kingdom (of Israel) shall be exalted” Numbers 24:7.

14 And the Lord said unto Moses, “Write this for a memorial in a book, and recount it in the ears of Joshua; for I will utterly put out the remembrance of Amalek from under heaven.” — I will utterly put out the remembrance of Amalek; the extermination of Amalek, here prophesied, was partly accomplished in part by Saul (1 Samuel 15:8) and David (1 Samuel 30:17);

— Moses must write what had been done, what Amalek had done against Israel; write their bitter hatred; write their cruel attempts; let them never be forgotten, nor what God had done for Israel in saving them from Amalek.

15 And Moses built an altar, and called the name of it Jehovahnissi [that is, The Lord my banner]; — Moses built an altar; primarily, no doubt, to sacrifice thank-offerings upon it, as an acknowledgment of the Divine help in giving Israel the victory.

16 for he said, “Because the Lord hath sworn that the Lord will have war with Amalek from generation to generation.” — the Lord will have war with Amalek from generation to generation; until they are utterly destroyed; and so in fact he had, and thus it was;

— the Targum of Jonathan says

“And he said, Because the Word of the Lord hath sworn by the throne of His glory, that He by his word will make war against those that are of the house of Amalek, and destroy them to three generations, from the generation of this world, from the generation of the Messiah, and from the generation of the world to come.”

Moses with the two tablets written in the original Hebrew

Exodus 18

1 When Jethro, the priest of Midian, Moses’ father-in-law, heard of all that God had done for Moses and for Israel His people, and that the Lord had brought Israel out of Egypt,

— Jethro, the priest and prince of Midian, as both the Amalekites and Midianites were descended from Abraham, and stood in blood-related to Israel.

then Jethro, Moses’ father-in-law, took Zipporah, Moses’ wife, after Moses had sent her back — upon his calling and mission to Egypt, Moses took his wife and children with him; but upon an affair which occurred in the inn by the way, he sent them back again to his father-in-law;

and her two sons (of whom the name of the one was Gershom [that is, A stranger there], for he said, “I have been an alien in a strange land;”

— for he said, I have been an alien in a strange land; meaning, not the land of Egypt, where he was born, and had lived forty years; but in the land of Midian, where he was when this son of his was born;

and the name of the other was Eliezer [that is, My God is a help], “For the God of my father,” said he, “was my help and delivered me from the sword of Pharaoh;”

and Jethro, Moses’ father-in-law, came with his sons and his wife unto Moses into the wilderness, where he encamped at the mount of God. — is there a possibility that Caleb as a young man met an aging Moses “in the land of Midian?”

— Caleb the son of Jephunneh the Kenizzite Numbers 32:12; these were chiefs of the sons of Esau: Eliphaz, Teman, Omar, Zepho, Kenaz; and could the Kenizzites be the sons of Kenaz? Genesis 36:15

And he said unto Moses, “I, thy father-in-law Jethro, have come unto thee and thy wife and her two sons with her.” — the Targum of Jonathan adds, “I, thy father-in-law Jethro, have come to thee to be a proselyte.”

And Moses went out to meet his father-in-law, and did obeisance and kissed him; and they asked each other of their welfare, and they came into the tent.

“I am thy shield,” the Lord said, “Unto thy seed have I given this land, from the river [Nile] of Egypt unto the great river, the River Euphrates” (Genesis 15)

And Moses told his father-in-law all that the Lord had done unto Pharaoh and to the Egyptians for Israel’s sake, and all the travail that had come upon them by the way, and how the Lord delivered them.

— and how the Lord delivered them; out of all this travail and trouble, and out of the hands of all their enemies, Egyptians and Amalekites.

And Jethro rejoiced for all the goodness which the Lord had done to Israel, whom He had delivered out of the hand of the Egyptians. — being a proselyte, Jethro, a Midianite, a descendant of Abraham by Keturah, rejoiced for all the goodness which the Lord had done to Israel;

10 And Jethro said, “Blessed be the Lord, who hath delivered you out of the hand of the Egyptians and out of the hand of Pharaoh, who hath delivered the people from under the hand of the Egyptians.

11 Now I know that the Lord is greater than all gods; for in the thing wherein they dealt proudly, He was above them.”

12 And Jethro, Moses’ father-in-law, took a burnt offering and sacrifices for God; and Aaron came, and all the elders of Israel, to eat bread with Moses’ father-in-law before God.

— Jethro took a burnt offering and sacrifices for God; Jethro had brought sacrifices with him, and now offered them in token of his thankfulness for God’s mercies towards himself and towards his kinsman;

— Jethro was a priest in Midian, and a worshipper of the true God, and the priesthood was not yet settled to be Aaron and his sons in Israel; and they did eat bread before God, indicating such an offering and feast was accepted by God.

13 And it came to pass on the morrow that Moses sat to judge the people, and the people stood by Moses from the morning unto the evening (hā·‘ā·reḇ). — it may be probable that numerous cases of difficulty arose out of the division of the spoil of the Amalekites.

14 And when Moses’ father-in-law saw all that he did for the people, he said, “What is this thing that thou doest for the people? Why sittest thou thyself alone, and all the people stand by thee from morning unto evening?” — why sittest thou thyself alone? the emphatic word is “alone.” Why dost thou not, Jethro means, to palm out some of the duty upon others?

15 And Moses said unto his father-in-law, “Because the people come unto me to inquire of God. — because the people come unto me to inquire of God; in doubtful cases, what was his will, and to desire Moses to inform them; which in later times was done by the Sanhedrin and Urim and Thummim; hence giving birth and growth of the Oral Law.

16 When they have a matter, they come unto me, and I judge between one and another, and I make them know the statutes of God and His laws.” — if the laws and statutes of God had yet been given on Mount Sinai, the people would be ignorant of them, and so needed not such daily judgement and instruction from Moses.

17 And Moses’ father-in-law said unto him, “The thing that thou doest is not good. — Moses was occupied from morning till evening in judging the people; hence it was not good for his health.

18 Thou wilt surely wear away, both thou and this people who are with thee. For this thing is too heavy for thee. Thou art not able to perform it thyself alone. — for this thing is too heavy for thee: it was too great a burden upon his shoulders, what his strength was not equal to.

19 Hearken now unto my voice! I will give thee counsel, and God shall be with thee: Be thou for the people to Godward, that thou mayest bring the causes unto God. — may Go be with thee; may he give thee wisdom to direct the right course.

20 And thou shalt teach them ordinances and laws, and shalt show them the way wherein they must walk and the work that they must do. — thou shalt teach them ordinances and laws; or “statutes and laws.”

21 Moreover thou shalt provide out of all the people able men, such as fear God — men of truth, hating covetousness — and place such over them to be rulers of thousands and rulers of hundreds, rulers of fifties and rulers of tens.

— the word “rulers” sometimes rendered “princes” is general, including all ranks of officials placed in command; the first requirement is the fear of God;

— second, men of truth; true men, sincere, upright, and faithful men, that love truth and hate lies and falsehood; third, hating covetousness; in themselves and others, filthy lucre, dishonest gain, and not to be bribed and corrupted.

22 And let them judge the people at all seasons; and it shall be that every great matter they shall bring unto thee, but every small matter they shall judge. So shall it be easier for thyself, and they shall bear the burden with thee.

— the people at all times; in their districts, whenever a matter between man and man arises, and let them judge impartially, and determine what is right and wrong, and execute judgment and justice truly; which would take off a great deal of business from the hands of Moses;

— and any affair of great importance, and difficult of determination, and about which the judges may have some doubt in their minds, and they are not clear as to the decision of it; this, they the judges, not the people, were to bring to Moses.

Today’s Golden Calf: the 2024 Paris Olympics has gone full Woke dystopian with transgender mockery of the Last Supper, the Golden Calf idol, and even the Pale Horse from the Book of Revelation

23 If thou shalt do this thing and God command thee so, then thou shalt be able to endure, and all this people shall also go to their place in peace.”

— then thou shall be able to endure; to continue in his office and post, and hold on for decades to come, God granting him life and health; whereas otherwise, his time would be wasted in ruin.

24 So Moses hearkened to the voice of his father-in-law, and did all that he had said. — so Moses hearkened to the voice of Jethro; considered what he said, weighed it well in his mind, and judged it good advice, and determined to put them into action.

25 And Moses chose able men out of all Israel and made them heads over the people: rulers of thousands, rulers of hundreds, rulers of fifties, and rulers of tens. — and made them heads over the people; rulers, governors, judges, and officials;

— according to the Targum of Jonathan, the rabbans or rulers of thousands were six hundred, rulers of hundreds 6000, rulers of fifties 12,000, and the rulers of tens 60,000.

26 And they judged the people at all seasons. The hard causes they brought unto Moses, but every small matter they judged themselves. — only those causes which seemed “hard” to the “rulers of thousands” were brought before Moses for decision.

27 And Moses let his father-in-law depart, and he went his way into his own land. — and Moses went his way into his own land; the land of Midian: the Targum of Jonathan, “he went to proselyte all the children of his own country.”

Ephraim preferred over Manasseh

•April 30, 2026 • Leave a Comment

Ephraim and Manasseh are the two sons of Joseph, born in Egypt. But who, in prophecy, is Ephraim and Manasseh? In the latter days, both should have a significant role to play in our current world affairs Genesis 48. And why did Jacob prefer Ephraim over Manasseh?

Jacob blessing upon Joseph; the Ox or Bull, the strength and fortitude of the United States; and its horns like that of a Unicorn, is the strength and fortitude of the Anglo-Saxons; together they push and dominate the world.

Joseph, upon learning that his father is on his deathbed, brings his two sons to visit him (Genesis 48:1) and that when Jacob sees them he proceeds to bless them (Gen 48:9).

Manasseh, the firstborn, was favored by Joseph to be the more prominent of the two and was groomed to succeed him; inevitably spending more time in the field with him. But when Jacob fell ill, it was Ephraim who went to inform Joseph, as he was more accustomed to studying the Torah with Jacob in the land of Goshen (Rashi Gen 48:1). 

Although Joseph positions Manasseh on Jacob’s right (Gen 48:13), Jacob crosses his hands, placing his right hand upon the head of the younger son, Ephraim (Gen 48:14). Joseph attempts to correct his father (Gen 48:18), but Jacob insists that he is acting deliberately and that Ephraim will be the greater of the two (Gen 48:19).

So Jacob blessed them that day, saying, “In thee shall Israel bless, saying, ‘God make thee as Ephraim and as Manasseh.’” And he placed Ephraim before Manasseh (Genesis 48:20).

“I know, my son, I know, and he shall also be great; but his younger brother [Ephraim] shall be greater than he” Genesis 48:19

More from Moses’ blessing on the identification of Ephraim and Manasseh by the indication of the Ox and the Unicorn:

Let the blessing come upon the head of Joseph, and upon the top of the head of him that was separated from his brethren. His glory is like the firstling of his ox (bullock), and his horns are like the horns of unicorns. With them he shall push the people together to the ends of the earth; and they are the ten thousands of Ephraim, and they are the thousands of Manasseh,” Deuteronomy 33:16-17.

In the above blessing, the Ox and Ephraim are named first, the firstborn of his (Joseph’s) “bullock is his glory,” the reference being to Ephraim; followed by Unicorn and Manasseh.

Although Manasseh was the firstborn, Joseph the father crossed his hands and placed Ephraim as firstborn, hence Ephraim, often known as the thirteenth tribe, represents not just the house of Joseph, but more often the house of the 10-tribes Northern Kingdom.

Today, the identities of Ephraim and Manasseh are proudly enshrined in their respective national Crests, Seals and Coats of Arms. They are all over the place, but the Poor, Blind and Naked couldn’t see, Revelation 3:17. Of course as being described as Laodiceans and being blinded and naked by God they wouldn’t be able to see their own wretchedness and nakedness.


Great Seal of the United States – thirteen Stars, thirteen Arrows, thirteen Leaves and thirteen Olives – hence the Seal of being the thirteenth tribe.

The thirteenth tribe arrived the latest, after all the other twelve tribes had been established and settled! Starting with thirteen states, the United States gained its independence in July 4, 1776 and, claiming Manifest Destiny, pushing westward and gaining additional states, it emerged into what is now the United States of America.

It also pushes southward with its hegemonic imperialism, known as the Monroe Doctrine; and this Doctrine is revealed by the Targum as the flame unto the house of Esau.

American foreign policy has since being oscillating between two extremes: the idealistic ‘City on a Hill,’ which seeks to convert the world through the Olive Branch of its values, and the pragmatism of the ‘Big Stick,’ which uses the Arrow approach to enforce its will via gunboat diplomacy. This dual-track system—one of inspiration and the other of coercion—exerts a profound influence over virtually all nations of the earth.

Enhance lighting, sharpness, and natural color
A Unicorn in the Royal Coat of Arms of the United Kingdom;
and Scotland’s national animal is the Unicorn (below)
But the Lion, or the three lions, is a symbol of Judah (Genesis 49:9): the United Kingdom incorporates the Royal line of King David.
Two Unicorns in the Royal Coat of Arms of Scotland in the United Kingdom.

“And it was, when Rachel had borne Joseph, that Jacob said by the Holy Spirit: ‘The House of Joseph is destined to be like a flame to consume those of the House of Esau.’ He said:

“‘From now on, I am not afraid of Esau and his legions.’ And he said to Laban: ‘Send me away, that I may go to my place and to my land'” Genesis 30:25 Jonathan

From Rashi and Rabbinic teachings: the myriads (ten thousands) slain by Joshua; and these are the ten thousands descended from Ephraim. Joshua, their leader, was of the tribe of Ephraim;

— and the thousands of Manasseh: these are the thousands slain by Gideon, who was of the tribe of Manasseh. These thousands descended from Manasseh are obviously far less than those descended from Ephraim.

In his blessings Moses ascribes to Ephraim ten thousands, and to Manasseh only thousands; thus foreshadowing, that Ephraim the younger was to be the more numerous of the two, as Moses had before prophesied of them, Deuteronomy 33:16-17

And here this Amazing Prophecy must be emphasized

A deeper Study of Genesis 30 regarding Joseph’s birth provides further insight:

And it came to pass, when Rachel had borne Joseph, that Jacob said unto Laban, “Send me away, that I may go unto mine own place and to my country” Genesis 30:25

The Targum of Jonathan reveals how, under the inspiration of the Holy Spirit, the posterity of Joseph, the birthright holder, and not any of the other tribes, were to be a yoke (Genesis 27:40) and a flame unto the house of Esau, saying

“Now the . . . birthright was given unto the sons of Joseph . . . For Judah prevailed above his brethren, and from him came the chief ruler, but the birthright was Joseph’s 1 Chronicles 5:1-2

The Yoke of Esau unto the house of Jacob; but more specifically to the House of Joseph

“And by thy sword shalt thou live, and shalt serve thy brother; and it shall come to pass when thou shalt have the dominion, that thou shalt break his yoke from off thy neck” Genesis 27:40

“And it was, when Rachel had given birth to Joseph, that Jacob said through the Holy Spirit that the House of Joseph is destined to be like flame to consume the House of Esau. He said: ‘From now on, I am not afraid of Esau and his legions.’ And he said to Laban: ‘Send me away, that I may go to my own place and to my own land’” Genesis 30:25 Jonathan.

Thus the burning Flame of Joseph had been prophecised together with the Heavy Yoke unto the long-suffering House of Esau right in the book of Genesis.

Jacob was afraid to return to Canaan because of his brother Esau; but this Jonathan version reveals through the Holy Spirit that Jacob knew Esau (the “stubble”) could only be defeated by the “flame” of Joseph (Jonathan narrative confirms in Obadiah 1:18). And so when Joseph was born, Jacob asked Laban to be sent back to his own country:

“And the house of Jacob shall be a fire, and the house of Joseph a flame, and the house of Esau for stubble; and they shall kindle them and devour them. And there shall not be any remaining of the house of Esau, for the Lord hath spoken it” Obadiah 1:18

A prophecy of Esau, Edom: the Targum identifies the Southland, Sepharad, as Spain, Obadiah 1:20. This prophecy is now playing a critical role in our modern era.

For an in-depth Study of Spain as Esau in prophecy, see Obadiah; but below is a brief summary of prophecy mingles with fulfilled history.

In July 1588, King Philip set sail the Spanish Armada to reclaim a troubling Protestant England under Elizabeth I and determined to restore Catholicism.

When Philip II became the Spanish king in January 1556, he controlled an established empire with territory across the globe. Spain was rich from the influx of gold from the New World, wielded one of the world’s most powerful militaries. Being passionate about promoting Catholicism, King Philip planned to seize the English throne and dismantle the Protestant Church of England.

When Elizabeth I took the throne upon her half-sister’s death, King Philip attempted to marry her. After all, he was technically the king of England already, but Elizabeth was not interested in giving either herself to King Philip, or her throne to Spain, or her country to the Catholics.

Queen Elizabeth I ruling the then Protestant nation, left England’s relationships with Europe’s Catholics tense. Not only were the treasure ships returning from the New World to Spain regularly plundered by the Royal Navy, but Elizabeth commissioned privateers and pirates to do the same.

Under King Philip of Spain, the Spanish Armada, with 130 ships and 30,000 men on board, set sail from Spain in July 1588, intending to overthrow the Protestant Queen and restore Catholic rule over England. But, met with a devastating Divine Wind, the Spanish Armada were destroyed by the British Navy, which were lighter, faster and more maneuverable commander by Sir Francis Drake.

Then came the Monroe Doctrine over two centuries later, when the then President James Monroe of the nascent United States issued a foreign policy statement on December 2, 1823 that all foreign powers in the New World would be an hostile act against the United States. It is an imperial ambition to hold all nations in the Western Hemisphere to the American grand strategy when this Monroe Doctrine was first articulated.

All foreign powers in the New World except the United Kingdom

In fact, when this Monroe doctrine was proclaimed, it was met with approval from Britain, who enforced it tactically as part of the wider Pax Britannica, claiming it to enforcing the freedom of the seas. And for many years after the doctrine was issued, the British Royal Navy was the sole nation enforcing it, as the United States Navy was then a small force.

From then on, these two nations, the United Kingdom and the United States, are the only two naval powers in the world, who would not permit that the New World to be given back to imperial Spain.

The Monroe Doctrine is more than just an United States foreign policy position that opposes European colonialism against all the Latin Countries in the Western Hemisphere, it is an excertion of the house of Joseph as start of a flame burning over the house of Esau.

. . . but were met with a devastating Divine Wind, and were destroyed decisively by the British Navy under Commander Sir Francis Drake.
Route taken by the Great White Fleet from December 1907 to February 1909

First, it was Joseph who would be blessed with the birthright, bestowed by Jacob, which had been taken from Reuben, the firstborn (Genesis 49:3 Jonathan).

Second, there’s again the revelation that Joseph, a son of Jacob and Rachel, who was bestowed with the Yoke of Jacob (Genesis 27:40-41) and a Flame (Genesis 30:25 Jonathan) against the house of Esau, the firstborn, who had forfeited his birthright.

“And it was, when Rachel had given birth to Joseph, that Jacob said through the Holy Spirit that the House of Joseph is destined to be like a flame to consume the House of Esau. He said: ‘From now on, I am not afraid of Esau and his legions.’ And he said to Laban: ‘Send me away, that I may go to my own place and to my own land.’” Genesis 30:25 Jonathan

The United States engagement with its Latin southern neighbors could be characterized by the second part of a two-pronged approach to global dominane: the first is the ‘City on a Hill’ paradigm, symbolized by the Olive Branch, serves as the primary mode of value-based leadership.

But the Monroe Doctrine, or the ‘Big Stick’ approach, the gunboat diplomacy, is represented by the Arrows in the American Seal. By alternating between ideological attraction and military deterrent, this framework effectively steers American global geopolitics ever since.

The rest is history; only that the Blind couldn’t see, for more, see

The “Monroe Doctrine” Is the Yoke of Jacob
Ephraim as the Thirteenth Tribe

For understanding who the modern tribes of Judah and Joseph are, the best book to have expounded this subject is “Judah’s Sceptre and Joseph’s Birthright” by J.H. Allen.

~~~

And lastly, this is the second in a series on the identities of Ephraim and Manasseh, for others, see (1) The Irony of a Birthright (2) Ephraim preferred over Manasseh (3) Ephraim as the Thirteenth Tribe (4) Who is this lying Ephraim? (5) The Ox with horns of a Unicorn

Exodus (15-16)

•April 30, 2026 • Leave a Comment

Exodus 15

1 Then sang Moses and the children of Israel this song unto the Lord, and spoke, saying, “I will sing unto the Lord, for He hath triumphed gloriously; the horse and his rider hath He thrown into the sea.

— then sang Moses and the children of Israel; the scene of this thanksgiving song is supposed to have been at the landing place on the eastern shore of the Red Sea, at Ayoun Musa, “the fountains of Moses,”

— the Targum of Jonathan says

“Then Moses and the children of Israel sang this song of praise before the Lord, and they spoke, saying:

“‘We shall thank and praise before the Lord, the Exalted One who is exalted over the proud, and is uplifted over the haughty. Anyone who exalts himself before Him—He, by His Word, exacts punishment from him.

“Because the wicked Pharaoh acted insolently before the Lord and was uplifted in his heart, and pursued after the people of Israel—their horses and their riders He threw and drowned in the Red Sea.'”

The Lord is my strength and song, and He has become my salvation; He is my God, and I will prepare Him a habitation; my father’s God, and I will exalt Him.

— the Targum of Jonathan says

“The Strength and the greatness of the praise of the Fearful One over all worlds is the Lord; He spoke by His Word and became for me a saving God.

“From their mothers’ breasts, the infants were pointing with their fingers to their fathers, saying: ‘This is our God, who gave us honey to suck from the rock and oil from the flinty stone,’ at the time when our mothers went out into the open field to give birth and left us there; and [God] sent an angel to wash us and wrap us. And now, we shall praise the God of our fathers and exalt Him.”

The Lord is a man of war; the Lord is His name. — God’s name is the four-letter Hebrew word יהוה‎ YHVH Yehovah (not Yahweh, since it is only used among the Samaritan communities; and not Jehovah since the letter J wasn’t around but only after the sixteenth century; (more on this at the end);

— the Targum of Jonathan says

“The children of Israel said: ‘The Lord is the Master who performs our battles in every generation,’ making His might known to His people, the House of Israel. The Lord is His name—as is His Name, so is His might. May His name be blessed for ever and ever.”

Pharaoh’s chariots and his host hath He cast into the sea; his chosen captains also are drowned in the Red Sea.

The depths have covered them; they sank into the bottom as a stone. — they sunk into the bottom as a stone; into the bottom of the sea, as a stone thrown into anybody of water sinks and rises not up again;

Thy right hand, O Lord, has become glorious in power; Thy right hand, O Lord, hath dashed in pieces the enemy. — thy right hand, O Lord, hath dashed in pieces the enemy; in a literal sense, Pharaoh and his host, the avowed enemies of Israel;

And in the greatness of Thine excellency Thou hast overthrown them that rose up against Thee; Thou sentest forth Thy wrath, which consumed them as stubble.

And with the blast of Thy nostrils the waters were gathered together, the floods stood upright as a heap, and the depths were congealed in the heart of the sea. — the blast of God’s nostrils corresponds to the east wind, which drove the waters back;

The enemy said, ‘I will pursue, I will overtake, I will divide the spoil; my lust shall be satisfied upon them. I will draw my sword; my hand shall destroy them.’

— the Targum of Jonathan says

“For the wicked Pharaoh, the hater and the adversary, said: ‘I will pursue after the people of Israel and I will come upon them while they are camping on the shore of the sea. I will arrange battle lines against them, and we shall slay among them a great and massive slaughter. We shall plunder from them great spoil and take from them many captives.

“I will divide their loot among my people, the makers of war; and when my soul is satiated with the blood of their slain, after that, I will draw my sword and destroy them with my right hand.'”

10 Thou didst blow with Thy wind, the sea covered them; they sank as lead in the mighty waters. — they sunk as lead in the mighty waters; which is a very heavy metal, and, being cast into the water, sinks to the bottom at once, as did the Egyptians in the Red sea;

11 “Who is like unto Thee, O Lord, among the gods? Who is like Thee, glorious in holiness, fearful in praises, doing wonders?

12 Thou stretchedst out Thy right hand; the earth swallowed them. — the earth swallowed them; the sea, which actually “swallowed them,” is a part of the earth.

— the Targum of Jonathan says

“The Sea and the Earth were litigating one with the other. The Sea said to the Earth: ‘Receive your children,’ and the Earth said to the Sea: ‘Receive your slain.’

“Neither the Sea wished to submerge them, nor the Earth wished to swallow them. The Earth was afraid to receive them, lest they be demanded from her on the Great Day of Judgment in the World to Come, just as the blood of Abel was demanded from her.

“Until You stretched out Your right hand, O Lord, in an oath to the Earth that they would not be demanded of her in the World to Come. Then the Earth opened her mouth and swallowed them.”

13 Thou in Thy mercy hast led forth the people whom Thou hast redeemed; Thou hast guided them in Thy strength unto Thy holy habitation.

14 “The people shall hear and be afraid; sorrow shall take hold on the inhabitants of Palestina. — the peoples: all the various tribes of the desert of Palestine—the Amalekites, Edomites, Philistines, Moabites, Amorites—

15 Then the chiefs of Edom shall be amazed; the mighty men of Moab, trembling shall take hold upon them; all the inhabitants of Canaan shall melt away.

— let the Edomites of Mount Seir be confounded and the Moabites be seized with fear and gave Israel a free passage through their borders (Deuteronomy 2:4-8, 18, 29), being afraid to oppose them;

— all the inhabitants of Canaan shall melt away; as their hearts did, through fear, when they heard what God did for Israel against the Egyptians and the Amorites, and understood that they were upon the march to their land to dispossess them.

16 Fear and dread shall fall upon them. By the greatness of Thine arm they shall be as still as a stone, till Thy people pass overya·‘ă·ḇōr5674, O Lord, till the people pass overya·‘ă·ḇōr5674, whom Thou hast purchased. — till thy people pass over (ya·‘ă·ḇōr5674); that is, cross the frontier of the Canaanites, and enter their country.

17 Thou shalt bring them in and plant them in the mountain of Thine inheritance, in the place, O Lord, which Thou hast made for Thee to dwell in, in the sanctuary, O Lord, which Thy hands have established. —in the mountain of thine inheritance; some suppose Mount Moriah to be especially intended;

— but it is better to understand Canaan generally, which is a country consisting almost entirely of mountains, with only two plains of any extent—those of Sharon and Esdraelon.

18 The Lord shall reign for ever and ever.” — the Lord shall reign; this concludes the whole song, by which Moses not only expresses his own faith and that of the people in God’s everlasting kingdom;

— the Targum of Jonathan says

“When the people of the House of Israel saw the miracles and the wonders that the Holy One—blessed be His name—performed for them at the Reed Sea (Red Sea), and the might of His hand, the children of the exiles answered and said to one another:

“‘Come, let us place the crown of majesty upon the head of our Redeemer, who causes all things to pass away but He does not pass away; who changes all things but He is not changed. For the crown of kingship is His! He is the King of Kings in this world, and His is the kingship in the World to Come, and His it is and shall be for ever and ever.'”

19 For the horse of Pharaoh went in with his chariots and with his horsemen into the sea, and the Lord brought again the waters of the sea upon them; but the children of Israel went on dry land in the midst of the sea.

— but the children of Israel went on dry land in the midst of the sea; which was a very wonderful thing, and was a just and sufficient reason for singing the above song to the Lord;

20 And Miriam the prophetess, the sister of Aaron, took a timbrel in her hand; and all the women went out after her with timbrels and with dances. — her name Miriam is the same as Mary; Miriam is called a prophetess, Numbers 12:2 because she and Aaron had evidently received divine communications.

21 And Miriam answered them: “Sing ye to the Lord, for He hath triumphed gloriously; the horse and his rider hath He thrown into the sea!”

— the Targum of Jonathan says

“And Miriam sang to them: ‘Let us thank and praise before the Lord, for strength and loftiness are His; He is exalted over the proud, and He is uplifted over the haughty. Because the wicked Pharaoh acted with presumption and pursued after the people, the children of Israel, He threw and submerged his horses and his chariots in the Sea of Reeds.'”

22 So Moses brought Israel from the Red Sea, and they went out into the Wilderness of Shur; and they went three days in the wilderness, and found no water. — and they went three days in the wilderness, and found no water; which must be very distressing to such a vast number of people and cattle, in a hot, sandy, desert;

23 And when they came to Marah, they could not drink of the waters of Marah, for they were bitter. Therefore the name of it was called Marah [that is, Bitterness].

24 And the people murmured against Moses, saying, “What shall we drink?”

25 And he cried unto the Lord; and the Lord showed him a tree, which when he had cast into the waters, the waters were made sweet. There He made for them a statute and an ordinance, and there He put them to the proof,

— the waters were made sweet, not so much by any virtue in that tree, as by the power of God, who used this rather as a sign to the Israelites, than as an instrument to himself in this work;

— the Targum of Jonathan says

“And [Moses] prayed before the Lord, and the Lord showed him a bitter tree of Oleander; and he wrote upon it the Great and Precious Name [of God] and cast it into the midst of the waters, and the waters became sweet.

There the Word of the Lord established for him the decree of the Sabbath, and the statute of honoring father and mother, the laws concerning wounds and injuries, and the fines imposed upon transgressors. And there [God] tested them with the tenth trial.”

26 and said, “If thou wilt diligently hearken to the voice of the Lord thy God, and wilt do that which is right in His sight, and wilt give ear to His commandments and keep all His statutes, I will put none of these diseases upon thee which I have brought upon the Egyptians; for I am the Lord that healeth thee.”

— for I am the Lord that healeth thee; both in body and soul; in body, by preserving from diseases, and by curing them when afflicted with them; and in soul, by pardoning their iniquities, which, in Scripture, is sometimes signified by healing;

— the Targum of Jonathan says

“And He said: ‘If you will diligently receive the Word of the Lord your God, and do what is right before Him, and listen to His commandments, and keep all His statutes—all the evil diseases that I placed upon the Egyptians, I will not place upon you.

And if you should transgress the words of the Torah, and [those diseases] are sent against you—if you return (repent), I will remove them from you; for I am the Lord your Healer.'”

27 And they came to Elim, where were twelve wells of water and threescore and ten palm trees; and they encamped there by the waters.

— they came to Elim. Elim was undoubtedly some spot in the comparatively fertile tract which lies south of the “wilderness of Shur,” intervening between it and the “wilderness of Sin.”

~~~

Exodus 16

And they took their journey from Elim, and all the congregation of the children of Israel came unto the Wilderness of Sin, which is between Elim and Sinai, on the fifteenth day of the second month after their departing out of the land of Egypt.

— they took their journey from Elim; the stay at Elim was probably for some days. “Sin” was reached on the fifteenth day of the second month, exactly one month after the departure from Egypt;

And the whole congregation of the children of Israel murmured against Moses and Aaron in the wilderness.

— murmured against Moses and Aaron in the wilderness; in the wilderness of Sin, where they were, and where no corn was to be had to make bread of; and their murmuring was not only against Moses, as before when they wanted water, but against Aaron also, who were jointly concerned in bringing them out of Egypt.

And the children of Israel said unto them, “Would to God we had died by the hand of the Lord in the land of Egypt, when we sat by the fleshpots and when we ate bread to the full! For ye have brought us forth into this wilderness to kill this whole assembly with hunger.”

— to kill this whole assembly with hunger; it is difficult to imagine that there could have been as yet any real danger of starvation. The sheep, the cattle, may have suffered in the passage through the wilderness of Shur, but the bulk of them would survive;

— would we died; they so undervalue their deliverance, that they wish they had died in Egypt; nay, and died by the hand of the Lord too; that is, by some of the plagues which cut off the Egyptians.

Then said the Lord unto Moses, “Behold, I will rain bread from heaven for you; and the people shall go out and gather a certain rate every day, that I may put them to the proof, whether they will walk in My law, or no.

— that I may prove them, whether they will walk in my law or no; by this single instance of their obedience to his will in going out every morning to gather their bread;

— that should be rained for them, he proposed to try and prove their obedience to his law in all other respects; what regard would be had to it when it should be given, and what might be expected from them, and likewise whether they would depend upon his providence in this case also.

And it shall come to pass that on the sixth day they shall prepare that which they bring in, and it shall be twice as much as they gather daily.” — on the sixth day; that is, the sixth day after the first giving of the manna;

— and it shall be twice as much as they gather daily: on that day should be rained double what fell on other days, and so twice as much should be gathered up; 

And Moses and Aaron said unto all the children of Israel, “At evening (ḇā·‘e·reḇ), then ye shall know that the Lord hath brought you out from the land of Egypt;

— at even (ḇā·‘e·reḇ), then ye shall know that the Lord hath brought you out from the land of Egypt: that they were brought out they knew, but they make this to be an act and deed of Moses and Aaron;

and in the morning, then ye shall see the glory of the Lord, for He heareth your murmurings against the Lord. And what are we, that ye murmur against us?” — and in the morning, then ye shall see the glory of the Lord; as displayed by raining bread around their tents;

And Moses said, “This shall be when the Lord shall give you in the evening flesh to eat and in the morning bread to the full, for the Lord heareth your murmurings which ye murmur against Him. And what are we? Your murmurings are not against us, but against the Lord.”

— Moses said, “You will know this when the Lord gives you meat to eat in the evening and bread in the morning to satisfy you;

And Moses spoke unto Aaron, “Say unto all the congregation of the children of Israel, ‘Come near before the Lord, for He hath heard your murmurings.’” — and Moses spake unto Aaron, who was his prophet and spokesman to the people: say unto all the congregation of the children of Israel;

10 And it came to pass, as Aaron spoke unto the whole congregation of the children of Israel, that they looked toward the wilderness, and behold, the glory of the Lord appeared in the cloud.

— and, behold, the glory of the Lord appeared in the cloud; which went before them; there was a more than common brightness in it, an effulgence and beam of light and glory shining in it.

11 And the Lord spoke unto Moses, saying, — and the Lord spake unto Moses, out of the bright and glorious cloud: saying;

12 “I have heard the murmurings of the children of Israel. Speak unto them, saying, ‘At evening ye shall eat flesh, and in the morning ye shall be filled with bread; and ye shall know that I am the Lord your God.’”

— at evening (bên hā·‘ar·bā·yim “between the two evenings,” which is from noon to sunset); ye shall know that I am the Lord your God;

— this gave proof of his power as the Lord, and his particular favour to them as their God; when God plagued the Egyptians, it was to make them know that he is the Lord; when he provided for the Israelites, it was to make them know that he was their God.

13 And it came to pass that at evening (ḇā·‘e·reḇ) the quails came up and covered the camp, and in the morning the dew lay round about the host.

— there are other meanings or applications for ḇā·‘e·reḇ but only one is revelant here, and that is, from noon to sunset; it was the time frame, the same time as bên hā·‘ar·bā·yim in the previous verse; yes in this case they mean the same or having the same time overlap;

some misguided would like to think that the Scriptures define what ḇā·‘e·reḇ and bên hā·‘ar·bā·yim are; but the Scripture is certainly not a dictionary; meanings of words could only be supplied by oral knowledge; for more, see the Oracles of God; which is further inferred here; but his misguided people reject these truths;

14 And when the dew that lay had gone up, behold, upon the face of the wilderness there lay a small round thing, as small as the hoarfrost on the ground. — when the dew that lay was gone up; the moisture which lay upon the herbage soon evaporated, drawn up by the sun; and then the miracle revealed itself.

15 And when the children of Israel saw it, they said one to another, “What is this?” For they knew not what it was. And Moses said unto them, “This is the bread which the Lord hath given you to eat.

16 This is the thing which the Lord hath commanded: ‘Gather of it every man according to his eating, an omer for every man, according to the number of your persons. Take ye every man for those who are in his tents.’” — each man was to gather according to his immediate need and that of his family. No one was to seek to accumulate a store.

17 And the children of Israel did so and gathered, some more, some less. — every one was to gather according to the necessities of his family;

18 And when they measured it with an omer, he that gathered much had nothing over, and he that gathered little had no lack; they gathered every man according to his eating. — when they did mete it with an omer;

— on returning to their tents, with the manna which they had collected, the Israelites proceeded to measure it with their own, or a neighbour’s, omer measure, when the wonderful result appeared, that, whatever the quantity actually gathered by any one, the result of the measurement showed, exactly as many omers as there were persons in the family.

19 And Moses said, “Let no man leave any of it until the morning.” — had nothing over; whatever quantity each person had gathered, when he measured it in his tent, he found that he had just as many omers as he needed for the consumption of his family.

20 Notwithstanding, they hearkened not unto Moses; but some of them left part of it until the morning, and it bred worms and stank. And Moses was wroth with them. — it bred worms; so that we must view the result spoken of as a punishment for disobedience;

21 And they gathered it every morning, every man according to his eating; and when the sun waxed hot, it melted. —it melted; this refers to the manna which was not gathered.

22 And it came to pass that on the sixth day they gathered twice as much bread, two omers for one man; and all the rulers of the congregation came and told Moses. — lying in a great quantity, they gathered as much as they could, or just two omers for one man.

23 And he said unto them, “This is that which the Lord hath said: ‘Tomorrow is the rest of the holy Sabbath unto the Lord. Bake that which ye will bake today, and boil what ye will boil; and that which remaineth over lay up for yourselves to be kept until the morning.’”

— introducing an explanation of something unexpected, that is, the Sabbath; to inculcate the preparation and observance of the Sabbath; which were introduced well before the law was given at Mount Sinai.

24 And they laid it up until the morning, as Moses bade; and it did not stink, neither was there any worm therein. — there was an interposition of divine Providence in the keeping of it to such a Day.

25 And Moses said, “Eat that today, for today is a Sabbath unto the Lord. Today ye shall not find it in the field. — a Sabbath unto the Lord, to be wholly consecrated to his service, and therefore not to be employed in servile works, introduced well before the law was given at Mount Sinai.

26 Six days ye shall gather it, but on the seventh day, which is the Sabbath, in it there shall be none.” — the practical observance of the Sabbath was formally instituted before the giving of other laws.

27 And it came to pass that there went out some of the people on the seventh day to gather, and they found none. — went out some of the people; this was an act of willful disobedience.

28 And the Lord said unto Moses, “How long refuse ye to keep My commandments and My laws? — how long refuse ye to keep my commandments? the people had already broken one of the positive precepts with respect to the manna (Exodus 16:20); now they broke another.

29 See, for the Lord hath given you the Sabbath; therefore He giveth you on the sixth day the bread for two days. Abide ye every man in his place. Let no man go out of his place on the seventh day.”

30 So the people rested on the seventh day.

31 And the house of Israel called the name thereof manna; and it was like coriander seed, white; and the taste of it was like wafers made with honey.

32 And Moses said, “This is the thing which the Lord commandeth: ‘Fill an omer with it to be kept for your generations, that they may see the bread wherewith I have fed you in the wilderness when I brought you forth from the land of Egypt.’”

— fill an omer of manna to be kept for your generations; the mere fact of such a multitude being fed for forty years in the wilderness;

33 And Moses said unto Aaron, “Take a pot, and put an omer full of manna therein, and lay it up before the Lord to be kept for your generations.” — in a place where the Lord would hereafter fix the symbol of his presence, the ark, cherubim and mercy seat;

— lay it up before the Lord; the “pot of manna” was laid up before the Lord with the “tables of the covenant,” and “Aaron’s rod that budded;” Hebrews 9:4;

34 As the Lord commanded Moses, so Aaron laid it up before the testimony, to be kept. — before the testimony; the testimony is not the Ark of the Covenant, but the Covenant itself, or the two tables of stone engraved by the finger of God;

35 And the children of Israel ate manna forty years, until they came to a land inhabited. They ate manna until they came unto the borders of the land of Canaan. — forty years; for thirty-nine years and nine months

— besides manna they had numerous flocks and herds, for milk, cheese and of course could be slaughtered for a constant supply of flesh.

36 Now an omer is a tenth part of an ephah.

~~~~

More on God’s name, Yehovah.

God’s name is the four-letter Hebrew word יהוה‎ YHVH Yehovah, which are embedded in the Masoretic text over 6000 times, yet when translated into our English language most had been translated as Lord, or LORD, which are titles, but not his name. His name is יהוה‎ Yehovah, or YEHOVAH (but there are no capital letters in Hebrew).

It wasn’t until 1524 that Gian Giorgio Trissino, an Italian Renaissance grammarian, invented the letter ‘J’ that this new letter started to take a hold in the writings of western Europe, including our English language. Even in 1611 when the first edition English Bible, the King James was published, the prophet Jeremiah was known as Ieremiah. Similarly, the name Jehovah is a very late comer.

But the Orthodox Jews have gone overboard, so holy is his name, they believe, thus they refrain from even calling his name, referring to him as Hashem, that is, “The Name,” which isn’t his name; just pointing, saying somewhat ‘you know what name I mean.’ His name is Yehovah, and is also not Yahweh, which is the Samaritan counterfeit version.

It is the same as the name Jesus we used today; if his name was used in his time two thousand years ago, he would have been known as Yeshua instead of Jesus. But never mind, as had often been the case, the essence is more important than the form.

His name Yehovah, is specifically stated, and should be used. Titles are okay, but sometimes He asked us pointedly to call on His name. The following verses translated as the LORD erred in presenting His name:

I am the LORD; that is My name. And My glory will I not give to another, neither My praise to graven images. Isaiah 42:8

And it shall come to pass, that whosoever shall call on the name of the LORD shall be delivered; for in Mount Zion and in Jerusalem shall be deliverance, as the LORD hath said, and in the remnant whom the LORD shall call. Joel 2:32

“I am sought of them that asked not for Me; I am found of them that sought Me not. I said, ‘Behold Me, behold Me,’ unto a nation that was not called by My name. Isaiah 65:1

When we call our God, the LORD, we err, because his name is not the LORD, which is a title. His name is YEHOVAH! May We all ask for his forgiveness, and may Our merciful God forgive us all.

Exodus (13-14)

•April 29, 2026 • Leave a Comment

~~~~

A parallel Exodus would reoccur during the endtime, which would far exceed that of the original Exodus led by Moses.

Therefore will I cast you out of this land into a land that ye know not, neither ye nor your fathers; and there shall ye serve other gods day and night, where I will not show you favor.’

“Therefore behold, the days come,” saith the Lord, “that it shall no more be said, ‘The Lord liveth who brought up the children of Israel out of the land of Egypt,’

but, ‘the Lord liveth who brought up the children of Israel from the land of the north, and from all the lands whither He had driven them.’ And I will bring them back into their land that I gave unto their fathers. Jeremiah 16:13-15.

So severe shall be their bondage that their deliverance from it shall be a far greater Deliverance than that out of Egypt where they spent 210 years in slavery under their Egyptian taskmasters!

For more, see

For more into another Captivity: see Ezekiel 4 – 390/40 Years Timeline

For more about the South, a prophecy of Esau or Edom, see Obadiah

More enemy of the South, The Flaming Sword and Fire from the South!

Exodus 13

And the Lord spoke unto Moses, saying, — God spoke to Moses on the day of the Exodus, at the first station, namely, Succoth;

“Sanctify unto Me all the firstborn, whatsoever openeth the womb among the children of Israel, both of man and of beast; it is Mine.” — sanctify unto me all the firstborn; that is, of males, as the Targum of Jonathan adds, for those, and not females, were desinated to be either sacrificed or redeemed;

And Moses said unto the people, “Remember this day in which ye came out from Egypt, out of the house of bondage; for by strength of hand the Lord brought you out from this place. There shall no leavened bread be eaten. — Remember this day; the 15th of Abib in which ye came out of Egypt,

This day came ye out, in the month Abib. — this day came ye out of Egypt, on the fifteenth of Nisan, as the Targum of Jonathan says;

“And it shall be when the Lord shall bring thee into the land of the Canaanites and the Hittites and the Amorites and the Hivites and the Jebusites, which He swore unto thy fathers to give thee, a land flowing with milk and honey, that thou shalt keep this service in this month.

— the full number of the Canaanitish nations was seven, five of which are enumerated here; the other two were the Perizzites and the Girgashites, which seem to have been the least important.

Seven days thou shalt eat unleavened bread, and in the seventh day shall be a feast to the Lord. — and in the seventh day shall be a feast to the Lord; an holy convocation, in which no work was to be done, except what was necessary for preparing food to eat, Exodus 12:16.

Unleavened bread shall be eaten seven days; and there shall no leavened bread be seen with thee, neither shall there be leaven seen with thee in all thy quarters.

— they begin before the passover, with all the diligence and care they can, to put away any leaven, or anything that hath had leaven in it, out of their houses; searching all their cupboards and bins.

And thou shalt show thy son in that day, saying, ‘This is done because of that which the Lord did unto me when I came forth out of Egypt.’

— when you shall be come into the land of Canaan, you shall instruct your children in the meaning of your killing the lamb, and abstaining from leaven, that so you and they may be excited to gratitude to God for his goodness.

And it shall be as a sign unto thee upon thine hand, and for a memorial between thine eyes, that the Lord’S law may be in thy mouth; for with a strong hand hath the Lord brought thee out of Egypt.

— the use of phylacteries among them, parchment inscribed with sentences of their law, bound upon their left hand, and placed upon their foreheads between their eyes.

10 Thou shalt therefore keep this ordinance in his season from year to year. — this ordinance the Israelites were to keep למועדהּ, “at its appointed time;” some see this as from the 15th to the 21st Abib; “from days to days,” in this season, spring, from year to year;

— but the Targum of Jonathan reveals another perspective, saying,

“And you shall guard this covenant of Tefillin at the time appropriate for it: on workdays, but not on Sabbaths or Festivals; and during the day, but not during the night.”

11 “And it shall be when the Lord shall bring thee into the land of the Canaanites, as He swore unto thee and to thy fathers, and shall give it to thee, — the land of the Canaanites, under which general name all the other nations are contained, as being all the children of Canaan.

12 that thou shalt set apart unto the Lord all that openeth the womb, and every firstling that cometh from a beast which thou hast; the males shall be the Lord’S.

— the males shall be the Lord’s; which explains what sort of firstborn of man and beast were to be set apart for his use, not females, though the first that opened the womb; but males.

13 And every firstling of an ass thou shalt redeem with a lamb; and if thou wilt not redeem it, then thou shalt break his neck; and all the firstborn of man among thy children shalt thou redeem. — break its neck; unless redeemed, it could not be retained for use by its owner;

— it was not to be killed by shedding of blood, because in old Israel ‘the slaughter of an animal in the ordinary way implied a sacrifice, which was impossible in the case of an ass;

14 And it shall be when thy son asketh thee in time to come, saying, ‘What is this?’ that thou shalt say unto him, ‘By strength of hand the Lord brought us out from Egypt, from the house of bondage.

— which is added to teach parents in all succeeding ages, that it is their duty to instruct their children in the word and works of God, and in the nature and reasons of every particular kind or part of God’s worship and service.

15 And it came to pass, when Pharaoh would hardly let us go, that the Lord slew all the firstborn in the land of Egypt, both the firstborn of man and the firstborn of beast; therefore I sacrifice to the Lord all that openeth the womb, being males; but all the firstborn of my children I redeem.’

— firstborn of man; the price of redemption was fixed at five shekels of the sanctuary: Numbers 3:47;

— the Targum of Jonathan says

“And it was when the Memra (Word) of the Lord hardened the heart of Pharaoh against releasing us, that the Lord killed every firstborn in the land of Egypt, from the firstborn of man to the firstborn of beast; therefore, I sacrifice before the Lord every firstling of the womb that is male, and every firstborn of my sons I shall redeem with silver.”

16 And it shall be as a token upon thine hand, and as frontlets between thine eyes; for by strength of hand the Lord brought us forth out of Egypt.” — it shall be for a token upon thine head, and for frontlets between thine eyes;

— these laws setting apart the firstlings of their beasts, the redemption of the firstbon, will be as easily and as clearly discerned as anything upon a man’s forehead may be seen by another;

17 And it came to pass, when Pharaoh had let the people go, that God led them not through the way of the land of the Philistines, although that was near; for God said, “Lest perhaps the people repent when they see war, and they return to Egypt.”

— when they see war; for the Philistines were viewed as one of the most warlike people of the time; while the Israelites after two centuries of slavery would have been an ill match for the Philistines;

— the Targum of Jonathan reveals an earlier misadventure by the tribe of Ephraim, saying

“And it was when Pharaoh released the people, that the Lord did not lead them by the way of the land of the Philistines, although it was near; for the Lord said, ‘Lest the people be dismayed when they see their brothers who died in battle—two hundred thousand armed men of the tribe of Ephraim, grasping shields, spears, and weapons of war.

“They went down to Gath to plunder the livestock of the Philistines; and because they transgressed against the decree of the Memra (Word) of the Lord and left Egypt thirty years before the [appointed] end, they were delivered into the hands of the Philistines, who killed them.

“These were the ‘dry bones’ that the Word of the Lord brought to life through the hand of Ezekiel the prophet in the Valley of Dura. If [the Israelites] see this, they will be afraid and return to Egypt.'”

— the details of this eposode was recorded by the book of Jasher, Chapter 75, where after 180 years in Egypt, the tribe of Ephraim, thirty thousand valiant men on foot, who trusted in their own strength, went out of Egypt to fight against the Philistines before their appointed time; “but the Lord delivered the children of Ephraim into the hands of the Philistines,” leaving only ten men to report back what a disaster it had been;

— “And Ephraim their father mourned many days, and his brethren came to comfort him,” I Chronicles 7:22

18 But God led the people about, through the way of the wilderness of the Red Sea; and the children of Israel went up by five in a rank out of the land of Egypt.

— through the wilderness of the Red Sea; perhaps indicative of the countries of Edom (“red”); including the gulf of Akaba;

19 And Moses took the bones of Joseph with him; for he had strictly sworn the children of Israel, saying, “God will surely visit you, and ye shall carry up my bones away hence with you.” — Moses took the bones of Joseph; Joseph’s body had been embalmed according to the Egyptian fashion;

Rashi thinks that the bones of all the tribes, or of the sons of Jacob, were carried with them, but they does not appear on the record.

20 And they took their journey from Succoth, and encamped in Etham on the edge of the wilderness. — they took their journey from Succoth, and encamped in Etham;

— the exact positions of both Succoth and Etham are uncertain, and can only be conjectured; but they probably lay to the southeast of Tanis, between that city and the Bitter Lakes.

21 And the Lord went before them by day in a pillar of a cloud to lead them the way, and by night in a pillar of fire to give them light, to go by day and night. — by day in a pillar of a cloud, to lead them the way; through the Red Sea, and the wilderness, at the edge of which they now were, which was untrodden, and trackless;

— and by night in a pillar of fire, to give them light; whenever they travelled by night, and in those hot countries it maybe refleshing; and this pillar of fire gave them light when the moon wasn’t shining, and showing the direction they ought to go.

22 He took not away the pillar of the cloud by day nor the pillar of fire by night from before the people. — the Lord went before them; by a visible token of His presence, the Shekinah, in a majestic cloud.

Exodus 14

1 And the Lord spoke unto Moses, saying, — and the Lord spake unto Moses; perhaps out of the pillar of the cloud in which he went before them;

“Speak unto the children of Israel, that they turn and encamp before Pihahiroth, between Migdol and the sea, opposite Baalzephon; before it shall ye encamp by the sea. — at Pi-hahiroth, Pharaoh and his servants repent for letting the people go; pursue and intend to overtake the Israelites;

— the Targum of Jonathan says

“Speak to the children of Israel, that they shall turn back and camp before Pumei Chiratha (Pi-hahiroth)—the crouching figures that were created in the likenesses of human beings, male and female, with open eyes.

“This is the place of Tanis, which is between Migdol and the sea, before the Idol of Zephon—the only one remaining of all the idols of Egypt.

“[It remained] so that the Egyptians would say: ‘Baal-zephon is the chosen one among all the idols, for he remains and was not struck.’ This is so they will come to worship him and find you camping opposite it by the shore of the sea.”

“The Statues of Pi-hahiroth” in modern archaeology

For Pharaoh will say of the children of Israel, ‘They are entangled in the land, the wilderness hath shut them in.’ — Pharaoh will say they are entangled; presuming that they are hemmed in between the rocks and the sea.

And I will harden Pharaoh’s heart, that he shall follow after them; and I will be honored above Pharaoh, and above all his host, that the Egyptians may know that I am the Lord.” And they did so.

— while Pharaoh gratified his malice and revenge, he furthered the bringing to pass God’s counsels concerning him. Though with the greatest reason he had let Israel go, yet now he was angry with himself for it.

And it was told the king of Egypt that the people fled; and the heart of Pharaoh and of his servants was turned against the people, and they said, “Why have we done this, that we have let Israel go from serving us?”

— God stired the envy and rage of a nation against his people, thus “Pharaoh and of his servants was turned against the people” a torment to themselves.

And he made ready his chariot and took his people with him, — he made ready his chariot; his preparations for an immediate and hot pursuit are here described;

and he took six hundred chosen chariots and all the chariots of Egypt and captains over every one of them. — a difference is made between “the chosen chariots” and “the chariots of Egypt.”

— the first evidently composed the king’s guard, amounting to six hundred chariots, and they are called “chosen,” literally, “third men”; three men being allotted to each chariot, the charioteer and two warriors, hence totally 1800 personel;

— as to “the chariots of Egypt,” the common cars contained only two persons, one for driving and the other for fighting; sometimes only one person was in the chariot, the driver lashed the reins round his body and fought; and of course, foot soldiers.

And the Lord hardened the heart of Pharaoh king of Egypt, and he pursued after the children of Israel; and the children of Israel went out with a high hand. — and the Lord hardened the heart of Pharaoh king of Egypt; as he said he would;

— with an high hand; confidently, boldly, perhaps somewhat proudly, as having brought the Egyptians to entreat them to take their departure.

But the Egyptians pursued after them, all the horses and chariots of Pharaoh, and his horsemen and his army, and overtook them encamping by the sea beside Pihahiroth, before Baalzephon. — and overtook them encamping by the sea, beside Pihahiroth, before Baalzephon; where they had pitched their camp by divine appointment.

10 And when Pharaoh drew nigh, the children of Israel lifted up their eyes, and behold, the Egyptians marched after them; and they were sore afraid; and the children of Israel cried out unto the Lord.

— and they were sore afraid; being an unarmed people, though numerous, and so unable to defend themselves against armed and disciplined troops.

11 And they said unto Moses, “Because there were no graves in Egypt, hast thou taken us away to die in the wilderness? Why hast thou dealt thus with us, to carry us forth out of Egypt?

— because there were no graves in Egypt; spoken in bitter irony, doubtless, but scarcely with any conscious reference to Egypt as “a land of tombs.” They meant simply to say: “Might we not as well have died there as here?”

12 Is not this the word that we told thee in Egypt, saying, ‘Let us alone, that we may serve the Egyptians’? For it had been better for us to serve the Egyptians, than that we should die in the wilderness.”

— let us alone; this is a gross exaggeration, yet not without a semblance of truth: for although the Israelites welcomed the message of Moses at first, they gave way completely at the first serious trial.

13 And Moses said unto the people, “Fear ye not. Stand still, and see the salvation of the Lord, which He will show to you today; for the Egyptians whom ye have seen today, ye shall see them again no more for ever. — fear ye not, stand still; let not your hearts fail, or sink or stagger, through unbelief: but with quiet minds look up to God;

— the Targum of Jonathan says,

“Four factions were formed by the Israelites on the shore of the Red Sea:

One said: ‘Let us descend into the sea.’ One said: ‘Let us return to Egypt.’ One said: ‘Let us set up battle arrays against them.’ And one said: ‘Let us shout against them and confuse them.’

To the faction that said, ‘Let us descend into the sea,’ Moses said: ‘Do not fear; stand ready and see the salvation of the Lord which He will perform for you today.’

To the faction that said, ‘Let us return to Egypt,’ Moses said: ‘Do not return; for just as you have seen the Egyptians today, you shall never see them again forever.’

14 The Lord shall fight for you, and ye shall hold your peace.” — and ye shall hold your peace; be still and quiet, and easy in your minds, and forbear saying or doing anything;

15 And the Lord said unto Moses, “Why criest thou unto Me? Speak unto the children of Israel, that they go forward. — speak unto the children of Israel, that they go forward; a little further until they were come to the sea shore.

16 But lift thou up thy rod, and stretch out thine hand over the sea and divide it; and the children of Israel shall go on dry ground through the midst of the sea. — with his rod, he hearkened to it, and touched the water with it, and so it divided, as it is said it did;

17 And I, behold, I will harden the hearts of the Egyptians, and they shall follow them; and I will get Myself honor above Pharaoh and above all his host, above his chariots and above his horsemen.

— and I will get me honour upon Pharaoh, and upon all his host, upon his chariots, and upon his horsemen: by their utter destruction in just retaliation for the many innocent infants that had been drowned by them in the river Nile.

18 And the Egyptians shall know that I am the Lord when I have gotten Myself honor above Pharaoh, above his chariots, and above his horsemen.”

— when I have gotten me honour upon Pharaoh, upon his chariots, and upon his horsemen; by casting them into the sea, and drowning them there, thereby showing himself to be mightier than he.

19 And the angel of God, who went before the camp of Israel, removed and went behind them; and the pillar of the cloud went from before their face and stood behind them. — and the pillar of the cloud went from before their face, and stood behind them;

— the Targum adds, “because the Mizraee (Egyptians) threw darts and stones at the Israelites, but the Cloud intercepted them;” whereby the Israelites were protected from receiving any injury from them.

20 And it came between the camp of the Egyptians and the camp of Israel; and it was a cloud and darkness to them, but it gave light by night to these, so that the one came not near the other all the night.

— it was a cloud and darkness to the Egyptians, to whom it brought their former horrible darkness to mind, and did both exceedingly affright them, and altogether hinder them from motion or action, as that also did for three days; but it gave light by night to the Israelites, as the opposition showeth.

21 And Moses stretched out his hand over the sea; and the Lord caused the sea to go back by a strong east wind all that night and made the sea dry land, and the waters were divided. — the waters were divided;

— the waters of the Bitter Lakes were for a time separated completely from those of the Red Sea. By gradual elevation and desiccation the channel over which the Israelites passed has probably now become dry land;

— the Targum of Jonathan says,

“And Moses inclined his hand over the sea with the great and glorious staff that was created from the beginning; and upon it was engraved and explicitly carved the Great and Glorious Name [of God], and the ten signs (letters) with which he struck the Egyptians, and the three patriarchs of the world, and the six matriarchs, and the twelve tribes of Jacob.

“And immediately, the Lord drove the sea with a powerful east wind all night, and made the sea dry land; and the waters were split into twelve divisions, corresponding to the twelve tribes of Jacob.”

— the Targum emphasizes that the staff wasn’t just an ordinary piece of wood. It was created at the very beginning of the world (during the twilight of the first Friday) and passed down through the generations

The Engravings: The staff served as a “divine ledger.” It contained:

  • The Tetragrammaton: The essential Name of God.
  • The Ten Plagues: Represented by initials or symbols.
  • The Ancestors: The three Fathers (Abraham, Isaac, Jacob) and the six Mothers (Sarah, Rebecca, Rachel, Leah, Bilhah, and Zilpah).

Twelve Paths: A famous Midrashic tradition included here is that the sea didn’t just open into one wide path, but into twelve distinct tunnels. This allowed each tribe to march through its own dedicated path, maintaining their unique identity and order even in the midst of the miracle.

22 And the children of Israel went into the midst of the sea upon the dry ground, and the waters were a wall unto them on their right hand and on their left. — some Jewish writers say that the tribe of Judah went in first, and then the other tribes followed;

23 And the Egyptians pursued, and went in after them to the midst of the sea, even all Pharaoh’s horses, his chariots, and his horsemen.

— the Egyptians went in after them into the midst of the sea; they thought, Why might they not venture where Israel did? They were more advantageously provided with chariots and horses, while the Israelites were on foot.

24 And it came to pass that in the morning watch the Lord looked unto the host of the Egyptians through the pillar of fire and of the cloud, and troubled the host of the Egyptians.

— the Lord looked through the cloud, and troubled them; with the most terrible and prodigious winds, and rains, and lightnings, and both claps and bolts of thunder;

25 And He took off their chariot wheels, that they drove them heavily, so that the Egyptians said, “Let us flee from the face of Israel, for the Lord fighteth for them against the Egyptians.” — and the Lord took off their chariot wheels;

Rashi renders it “And He removed the wheels of their chariots: With the fire the wheels were burned, and the chariots dragged, and those sitting in them were moved to and fro, and their limbs were wrenched apart.”

26 And the Lord said unto Moses, “Stretch out thine hand over the sea, that the waters may come again upon the Egyptians, upon their chariots, and upon their horsemen.”

— that the waters may come again upon the Egyptians, upon their chariots, and upon their horsemen; the waters which stood upright as a wall, on the right and left, might be no longer kept in such a position, but fall down upon the Egyptians, their chariots and horsemen.

27 And Moses stretched forth his hand over the sea, and the sea returned to his strength when the morning appeared. And the Egyptians fled against it, and the Lord overthrew the Egyptians in the midst of the sea.

— and the Lord overthrew the Egyptians in the midst of the sea; or shook them “off” or “out” out of their chariots, blew them out with the wind;

28 And the waters returned, and covered the chariots and the horsemen and all the host of Pharaoh that came into the sea after them. There remained not so much as one of them. — there remained not so much as one of them;

— wherefore it must be a falsehood which is related by some, that Pharaoh himself was preserved, and afterwards reigned in Nineveh, since not one was saved; they all perished;

29 But the children of Israel walked upon dry land in the midst of the sea, and the waters were a wall unto them on their right hand and on their left.

— but the children of Israel walked upon dry land in the midst of the sea; the bottom of it becoming so through the strong east wind, which blew all night until they came to the opposite shore;

30 Thus the Lord saved Israel that day out of the hand of the Egyptians, and Israel saw the Egyptians dead upon the seashore. — saw their dead bodies floating upon the waters; it is likely, however, that the bodies of some were cast on shore, and became food to the beasts and birds of prey that frequent the wilderness;

31 And Israel saw that great work which the Lord did upon the Egyptians; and the people feared the Lord, and believed the Lord and His servant Moses.

— and the Israelites feared the Lord; had an awe of his power and greatness upon their minds, and a sense of his goodness to them upon their hearts, which influenced their fear of the Lord, and caused them to fear him with a filial and godly fear.

~~~~

A parallel Exodus would reoccur during the endtime, which would far exceed that of the original Exodus led by Moses.

Therefore will I cast you out of this land into a land that ye know not, neither ye nor your fathers; and there shall ye serve other gods day and night, where I will not show you favor.’

“Therefore behold, the days come,” saith the Lord, “that it shall no more be said, ‘The Lord liveth who brought up the children of Israel out of the land of Egypt,’ 

but, ‘the Lord liveth who brought up the children of Israel from the land of the north, and from all the lands whither He had driven them.’ And I will bring them back into their land that I gave unto their fathers. Jeremiah 16:13-15; so emphatic is such a scene that it is repeated in Jeremiah 23:6-8.

So severe shall be their bondage that their deliverance from it shall be a far greater Deliverance than that out of Egypt where they spent 210 years in slavery under their Egyptian taskmasters!

For more see,

For more into another Captivity: Ezekiel 4 – 390/40 Years Timeline

For more about the South, a prophecy of Esau or Edom, see Obadiah

More of the South, see The Flaming Sword and Fire from the South!

Exodus (11-12)

•April 28, 2026 • Leave a Comment

A parallel Exodus would reoccur during the endtime, which would far exceed that of the original Exodus led by Moses.

Therefore will I cast you out of this land into a land that ye know not, neither ye nor your fathers; and there shall ye serve other gods day and night, where I will not show you favor.’

“Therefore behold, the days come,” saith the Lord, “that it shall no more be said, ‘The Lord liveth who brought up the children of Israel out of the land of Egypt,’

but, ‘the Lord liveth who brought up the children of Israel from the land of the north, and from all the lands whither He had driven them.’ And I will bring them back into their land that I gave unto their fathers. Jeremiah 16:13-15.

So severe shall be their bondage that their deliverance from it shall be a far Greater Deliverance than that out of Egypt where they spent 210 years in slavery under their Egyptian taskmasters!

For related in-depth Study see,

More into another Captivity: Ezekiel 4 – 390/40 Years Timeline

More about the South, a prophecy of Esau or Edom, see Obadiah

More on the South, The Flaming Sword and Fire from the South!

Exodus 11

1 And the Lord said unto Moses, “Yet will I bring one plague more upon Pharaoh and upon Egypt. Afterwards he will let you go hence. When he shall let you go, he shall surely thrust you out hence altogether.

— he shall surely thrust you out hence altogether; absolutely, entirely, without any exception or limitation, them, their wives, their children, their flocks and herds, without any restraint upon them and without any condition of return;

— or fixing any time for it, but the dismission should be general, unlimited, and unconditional; or “in thrusting he shall thrust you out,” with force and vehemence, with urgency and in great haste.

Speak now in the ears of the people, and let every man borrow from his neighbor, and every woman from her neighbor, jewels of silver and jewels of gold.” — let every man ask; not borrow, of his neighbour;

— jewels of silver, jewels of gold; to ornament themselves with at the feast they were going to keep: the Samaritan and Septuagint versions add, and clothing or raiment, and such are anything of value.

And the Lord gave the people favor in the sight of the Egyptians. Moreover the man Moses was very great in the land of Egypt in the sight of Pharaoh’s servants and in the sight of the people.

— therefore they complied with their request, not only out of love to the people, but out of fear to Moses, lest he should punish them severely in case of refusal.

And Moses said, “Thus saith the Lord: ‘About midnight will I go out into the midst of Egypt;

and all the firstborn in the land of Egypt shall die, from the firstborn of Pharaoh who sitteth upon his throne, even unto the firstborn of the maidservant who is behind the mill, and all the firstborn of beasts.

— and all the firstborn in the land of Eygpt shall die; by the destroying angel; however, it was sudden and immediate death, and which was universal, reaching to all the firstborn that were in the families of the Egyptians in all parts of the kingdom;

And there shall be a great cry throughout all the land of Egypt, such as there was none like it, nor shall be like it any more.

— shall be a great cry throughout all the land; in the case of a death, people set up loud wailings, and imagination may conceive what “a great cry” would be raised when death would invade every family in the kingdom.

But against any of the children of Israel shall not a dog move his tongue, against man or beast, that ye may know how the Lord doth put a difference between the Egyptians and Israel.’

— shall not a dog move his tongue; a proverbial expression, importing all should be peace and quietness among the Israelites;

And all these thy servants shall come down unto me and bow down themselves unto me, saying, ‘Get thee out, and all the people who follow thee!’ And after that I will go out.” And he went out from Pharaoh in a great anger.

— in a great anger; in heat of anger, burning with indignation.

And the Lord said unto Moses, “Pharaoh shall not hearken unto you, that My wonders may be multiplied in the land of Egypt.”

— that my wonders may be multiplied in the land of Egypt; of the smiting of the firstborn, dividing the waters of the Red sea, and the destruction of Pharaoh and his host in it; but since these words were said before any of the plagues, were inflicted, it may refer to them all.

10 And Moses and Aaron did all these wonders before Pharaoh; and the Lord hardened Pharaoh’s heart, so that he would not let the children of Israel go out of his land. — and the Lord hardened Pharaoh’s heart: one time after another, and yet more and more;

— so that he would not let the children of Israel go out of his land; until the last plague, the slaying of the firstborn, was brought upon him and his people, related in the following chapter.

Exodus 12

The Passover of the Exodus; and the Targum of Jonathan is extremely in understanding the Concept and Timing of the Passover.

The Targum, which originated in the Aramaic language and is strongly linked to the work of Ezra, holds significance for shedding light on biblical concepts. When the Masoretic Text can be vague, uncertain, or unclear, the Targum often offers clearer meaning, broader insight, and deeper understanding.

Yes, sometimes the Targum clarifies metaphors and interprets idioms or difficult passages instead of translating them literally, which often makes no sense. Such an endeavor should be highly commended rather than criticized.

For example, the Targum interprets natural imagery—like cedars, cypresses, oaks, forests, and fire—as metaphors for political political and social structures, especially kings, rulers, governors, and wealthy elites. Such imagery can be sweeping: forests laid waste, lions roaring as their habitat is destroyed, and power structures crumbling. Fire symbolizes divine punishment, sweeping through defenses and dismantling the very foundations of their power.

Foremost in the next chapter, Exodus 12, the Targum of Jonathan reveals an idiom for midnight, “the divide of the night;” that is, the midnight of the fifteenth, where the Israelites were to flee Egypt, Exodus 12:29. Another idiom is “between the [two] evenings; which, in Hebrew, is “`ben ha arbayim,” and would be better explained throughout the following chapter.

Translating such natural imagery literally could convey limited information or even distort it, but Ezra was determined to share their true meaning. He was a righteous man, for God had prepared his heart to seek the law of the Lord, to follow it, and to teach the statutes and judgments in Israel Ezra 7:10.

~~~~

Exodus 12

1 And the Lord spoke unto Moses and Aaron in the land of Egypt, saying, — the Lord spoke; according to these Scriptural record, neither Moses nor Aaron introduced any legislative power of their own, either at this time or later;

— the whole system, religious, political, and ecclesiastical, was received by Divine Revelation, commanded by God, hence the term the “law of Moses” is misleading, used by those misguided;

“This month shall be unto you the beginning of months; it shall be the first month of the year to you. — again, the starting of a month or a year is by Divine Revelation; not for mere man to determine for themselves when the month or year to start;

— the Targum of Jonathan says,

This month is ordained to be to you the beginning of the months; and from it you shall begin to number for festivals, and times, and cycles; it shall be to you the first of the number of the months of the year.

Speak ye unto all the congregation of Israel, saying, ‘On the tenth day of this month they shall take for themselves every man a lamb, according to the house of their fathers, a lamb for a house. — a lamb; the word used (śeh) is a vague one, applied equally to sheep and goats, of any age and of either sex;

— in the tenth day of this month; it was necessary they should now begin to prepare the passover four days before, because otherwise it would have been difficult to get ready so many lambs in Egypt, especially as they were to depart in haste;

— the Targum of Jonathan says,

“Speak with all the congregation of the children of Israel, saying: On the tenth of this month—this time is fixed for this occasion and not for [future] generations—and they shall take for themselves a lamb for the family house; and if there are many in number, they shall take a lamb for the house.”

— not necessarily for later generation, thus implied by the Targum Jonathan: “not for (coming) generations.” Perhaps the service was not to be a domestic one; and the growth of population would make such a practice unmanagable to confine a lamb for a single family;

— also, they were commanded to sprinkling with a bunch of hyssop upon the lintel, and upon the two side posts, and was eaten with haste, but the passover in later ages were to be kept during all the seven days so that no leaven (of malice) should be found in their houses.

And if the household be too little for the lamb, let him and his neighbor next unto his house take it according to the number of the souls; every man according to his eating shall make your count for the lamb.

— the Targum of Jonathan says,

“And if the people of the household are too few for the number of ten, [which is] the amount for eating a lamb, then he and his neighbor who is near to his house shall take [it] according to the number of souls; each man according to the amount of his eating, you shall reckon (or slaughter) the lamb.”

Your lamb shall be without blemish, a male of the first year; ye shall take it out from the sheep, or from the goats. — more apecifics of the lamb or from the goats (śeh from verse 3 above) is revealed here: a male of the first year, and without blemish.

The 6 hours at the top right “afternoon” is also known as “`ben ha arbayim

And ye shall keep it up until the fourteenth day of the same month, and the whole assembly of the congregation of Israel shall kill it in the evening. — evening (`ben ha arbayim); “between the [two] evenings;

— “between the evenings” – the first evening was to begin with the decline of the sun from the zenith, and the second begins with sunset.

Evidence of progressive Revelation on how to keep the Passover:

1. The first Passover was slaughtered by the whole congregation of Israel, but later it was slaughtered by priests and Levites at the sanctuary and still later, only at the Temple precinct.

2. Introduction of the second passover; Numbers 9:9 And the Lord spoke unto Moses, saying, 10 “Speak unto the children of Israel, saying: ‘If any man of you or your posterity shall be unclean by reason of a dead body, or be in a journey afar off, yet he shall keep the Passover unto the Lord.

11 The fourteenth day of the second month at evening they shall keep it, and eat it with unleavened bread and bitter herbs. 12 They shall leave none of it unto the morning, nor break any bones of it. According to all the ordinances of the Passover they shall keep it.

And they shall take of the blood, and strike it on the two side posts and on the upper door post of the houses wherein they shall eat it. — such practices of taking the blood and strike it on both sides of the doorposts and lintel were not mentioned in later years;

— regarding keeping of the second Passover by King Hezekiah in II Chronicles 30

15 Then they killed the Passover lamb on the fourteenth day of the second month; and the priests and the Levites were ashamed, and sanctified themselves and brought in the burnt offerings into the house of the Lord.

16And they stood in their place according to their order, according to the law of Moses the man of God. The priests sprinkled the blood which they received from the hand of the Levites. II Chronicles 30:15-16

— in later years, this killing of the Passover lamb could only be done near the Temple, or at the Temple precinct, so as to sprinkle the blood of the Lamb at the base of the altar, Exodus 29:12, which was not in the original Exodus.

— again, with King Josiah, another good king, at the Temple, II Chronicles 35:

10 So the service was prepared, and the priests stood in their place and the Levites in their courses, according to the king’s commandment. 11 And they killed the Passover lamb, and the priests sprinkled the blood from their hands, and the Levites flayed them.

12 And they removed the burnt offerings, that they might give according to the divisions of the families of the people to offer unto the Lord, as it is written in the Book of Moses. And so did they with the oxen. 13 And they roasted the Passover lamb with fire according to the ordinance. II Chronicles 35:10-13

And they shall eat the flesh in that night, roasted with fire; and with unleavened bread and with bitter herbs they shall eat it.

The Targum Jonathan translates and explains the eating of the Passover from the Hebrew in Exodus 12 into the vernacular, in a very simple language, and verse 8 is extremely clear: “And you shall eat the flesh on that night, the fifteenth of Nisan . . . without leaven,” Exodus 12

— this eating of the Passover is during the night of the fifteenth. If this is the night of the fourteenth, there shouldn’t be any need to take unleavened bread; neither was there any unleavened bread available.

Eat not of it raw, nor boiled at all with water, but roasted with fire — his head with his legs and with the viscera thereof.

10 And ye shall let nothing of it remain until the morning (בֹּקֶר bôqer, H1242), and that which remaineth of it until the morning (בֹּקֶר bôqer, H1242) ye shall burn with fire.

Gen 1:5 And God called the light Day, and the darkness he called Night. And the evening and the morning H1242 were the first day. Morning is thus a 12-hours period, starting at midnight. This means they were to burn any roasted remains before they left. And they left probably around 1-2 pm, burning any remains before they go.

Targum: Nor shall any be left of it till the morning; but what may remain of it in the morning you shall cover over, and in the daylight of the sixteenth day burn with fire; for you may not burn the residue of a holy oblation on the feast day.

Rashi: and whatever is left over of it until morning-: What is the meaning of “until morning” a second time? [This implies] adding one morning to another morning, for morning starts with sunrise, and this verse is here to make it [the prohibition] earlier, [i.e.,] that it is forbidden to eat it [the leftover flesh] from dawn. This is according to its apparent meaning.

Another midrashic interpretation is that this teaches that it may not be burnt on Yom Tov but on the next day, and this is how it is to be interpreted: and what is left over from it on the first morning you shall wait until the second morning and burn it. — [from Shab. 24b]

11 And thus shall ye eat it: with your loins girded, your shoes on your feet, and your staff in your hand; and ye shall eat it in haste; it is the Lord’S Passover H6453.

“WHAT FOLLY!” some misguided like one Fred Coulter would preach to convey this meaning: “And you shall eat it in trepidation” that is, with dread and apprehension but no readiness for fleeing! If so what would be the point, “with your loins girded, your shoes on your feet, and your staff in your hand; and ye shall eat it in haste?”

12 For I will pass through the land of Egypt this night, and will smite all the firstborn in the land of Egypt, both man and beast; and against all the gods of Egypt I will execute judgment: I am the Lord.

— the Targum of Jonathan says,

“And I will be revealed in the land of Egypt in the Shekhinah of My Glory on this night, and with Me ninety thousand myriads of destroying angels; and I will kill every firstborn in the land of Egypt, from man unto beast.

“And upon all the idols of the Egyptians I will execute four judgments: idols of metal shall melt, idols of stone shall be hewn down, idols of clay shall be shattered into shards, and idols of wood shall be turned to ashes; so that the Egyptians shall know that I am the Lord.”

Targum Jonathan: ninety thousand myriads of destroying angels; a myriad is generally a unit of ten thousand; but usually this expression is taken to mean an innumerable number.

13 And the blood shall be to you for a token upon the houses where ye are; and when I see the blood, I will pass over H6452 you, and the plague shall not be upon you to destroy you when I smite the land of Egypt.

— flashing forward, the blood of the Lamb of God, Christ, in around AD 31, were to save mankind from the penalty of death; when the Angel of Death came to smite the land of ‘Egypt.’

— the lamb was to be without blemish; the Lord Yeshua offered himself for humanity as the Lamb of God without spot. Not a bone of it must be broken. Despite they couldn’t find any fault with him, the chief priests went on to condemn Christ;

— the Targum of Jonathan says,

“And the blood of the Passover sacrifice and the matter of the circumcision shall be mingled for you, to make of them a sign upon the houses where you dwell; and I will see the merit of the blood and I will spare you; and the Angel of Death, to whom power was given to destroy, shall not have dominion over you when I kill in the land of Egypt.”

14 “‘And this day (this day is when the death plague occurred) shall be unto you for a memorial, and ye shall keep it a feast to the Lord throughout your generations; ye shall keep it a feast by an ordinance for ever. — this day is still referring to the time the Death Angel passed over the houses;

— a memorial, it’s a feast and an ordinance – this should be the same night as the night to be much observed as stated in verse 42, not a separate night as most CoGs erred, who hail largely from their original home, Samaria, would thinks so! 

Rashi: and you shall celebrate it: The day that is a memorial for you-you shall celebrate it. But we have not yet heard which is the day of memorial. Therefore, Scripture states: “Remember this day, when you went out of Egypt” (Exod. 13: 3), we learn that the day of the Exodus is the day of memorial.

Now on what day did they go out [of Egypt]? Therefore, Scripture states: “On the day after the Passover, they went out” (Num. 33:3). I must therefore say that the fifteenth of Nissan is the day of the festival, because the night of the fifteenth they ate the Passover sacrifice, and in the morning they went out.

15 Seven days shall ye eat unleavened bread. Even the first day ye shall put away leaven out of your houses; for whosoever eateth leavened bread from the first day until the seventh day, that soul shall be cut off from Israel.

Rashi: For seven days: Heb. שִׁבְעַתיָמִים, seteyne of days, i.e., a group of seven days. 

Rashi: For seven days you shall eat unleavened cakes-: But elsewhere it says: “For six days you shall eat unleavened cakes” (Deut. 16:8). This teaches [us] regarding the seventh day of Passover, that it is not obligatory to eat matzah, as long as one does not eat chametz. How do we know that [the first] six [days] are also optional [concerning eating matzah]?

This is a principle in [interpreting] the Torah: Anything that was included in a generalization [in the Torah] and was excluded from that generalization [in the Torah] to teach [something] it was not excluded to teach [only] about itself, but it was excluded to teach about the entire generalization.

[In this case it means that] just as [on] the seventh day [eating matzah] is optional, so is it optional in [the first] six [days]. I might think that [on] the first night it is also optional. Therefore, Scripture states: “in the evening, you shall eat unleavened cakes” (Exod. 12:18). The text established it as an obligation. — [from Mechilta]

16 And in the first day there shall be a holy convocation, and in the seventh day there shall be a holy convocation to you. No manner of work shall be done in them, save that which every man must eat, that only may be done by you.

17 And ye shall observe the Feast of Unleavened Bread, for in this selfsame day have I brought your armies out of the land of Egypt. Therefore shall ye observe this day in your generations by an ordinance for ever.

— the notion that the First Day as a holy day for an assembly during the Exodus were not practiced like practising Jews have today. Perhaps they assembled in haste to flee; more details were added later, like as the issue that there was no wave sheaf offering during the Exodus; that was also added later as in Leviticus 23; which is another evidence of progressive revealing of God’s laws through further revelation.

18 In the first month, on the fourteenth day of the month at evening (`ereb), ye shall eat unleavened bread until the one and twentieth day of the month at evening (`ereb).

Leviticus 23:5 In the fourteenth day of the first month at even (h6153`ben ha arbayim or between the evenings) is the LORD’S passover. (h6153 ben ha arbayim is also used in Ex 12:6; 16:12; 29:39,41; 30:8; Lev 23:5; Num 9:3,5,11; 28:4,8)

The composite Feast combining the Passover and the Days of Unleavened Bread is already evidenced above.

Genesis 1:5 And God called the light Day (h3117 יוֹם yowm), and the darkness he called Night (h3915 לַיִל layil). And the evening (h6153 עֶרֶב`ereb) and the morning (h1242 בֹּקֶר boqer) were the first day (h3117 יוֹם yowm). Evening and Morning are both a 12-hour period.

If we use even (‘ereḇ), as the beginning of a day for Atonement, in Leviticus 23:32, we must keep Atonement for two days on the 9th and 10th – contrary to the scriptures. Also, If we use even (‘ereḇ) as the beginning of the fourteenth for Unleavened Bread in Exodus 12:18, we must keep the Days of Unleavened Bread for 8 days – again, contrary to the scriptures.  

— the Targum of Jonathan says,

“In Nisan, on the fourteenth day of the month, you shall slaughter the Passover [sacrifice]; and on the evening of the fifteenth, you shall eat unleavened bread until the twenty-first day of the month; on the evening of the twenty-second, you shall eat leavened bread.”

19 Seven days shall there be no leaven found in your houses; for whosoever eateth that which is leavened, even that soul shall be cut off from the congregation of Israel, whether he be a stranger or born in the land.

20 Ye shall eat nothing leavened; in all your habitations shall ye eat unleavened bread.’”

21 Then Moses called for all the elders of Israel and said unto them, “Draw out and take you a lamb according to your families, and kill the Passover. — and to kill the PassoverH6453; to eat the Passover; hence Passover is an event, not a day; you couldn’t kill a day;

— you kill the Passover (a sacrifice) at even (ben ha arbayim) on the fourteenth of Nisan (the time when Christ died); but you eat the Passover at night on the fifteenth;

22 And ye shall take a bunch of hyssop, and dip it in the blood that is in the basin, and strike the lintel and the two side posts with the blood that is in the basin; and none of you shall go out from the door of his house until the morning.

During the first Passover, they were to stay in their houses, but later on they were not allowed to stay within their gates, which certainly include their houses. It says in Deuteronomy 16:5

“Thou mayest not sacrifice the Passover within any of thy gates which the Lord thy God giveth thee.” — this is proof that God makes adjustments in later years to the observance of ordinances from the original instructions given in Egypt.

23 For the Lord will pass through to smite the Egyptians; and when He seeth the blood upon the lintel and on the two side posts, the Lord will pass over H6452 the door and will not suffer the destroyer to come in unto your houses to smite you.

24 And ye shall observe this thing as an ordinance to thee and to thy sons for ever.

25 And it shall come to pass, when ye come to the land which the Lord will give you, according as He hath promised, that ye shall keep this service.

26 And it shall come to pass, when your children shall say unto you, ‘What mean ye by this service?’

27 that ye shall say, ‘It is the sacrifice of the Lord’S Passover H6453, who passed over H6452 the houses of the children of Israel in Egypt when He smote the Egyptians and delivered our houses.’” And the people bowed their heads and worshiped.

The LORD’s “Passover” vs the Death Angel “passed over” the house. Which is the real Passover? So both the fourteenth and fifteenth were to be memorialized for a remembrance for the Children of Israel.

28 And the children of Israel went away, and did as the Lord had commanded Moses and Aaron; so did they.

29 And it came to pass, that at midnight the Lord smote all the firstborn in the land of Egypt, from the firstborn of Pharaoh who sat on his throne, unto the firstborn of the captive who was in the dungeon, and all the firstborn of cattle.

— the Targum of Jonathan reveals an idiom for midnight, “the divide of the night;” that is, the midnight of the fifteenth, saying

“And it was at the divide of the night of the fifteenth, and the Memra (Word) of the Lord killed every firstborn in the land of Egypt, from the firstborn of Pharaoh who was destined to sit upon the throne of his kingdom, unto the firstborn of the kings who were taken captive and were held in the dungeon as collateral by Pharaoh; and because they had rejoiced over the enslavement of Israel, they also were struck; and all the firstborn of the cattle died, which the Egyptians used to worship.”

30 And Pharaoh rose up in the night, he and all his servants and all the Egyptians; and there was a great cry in Egypt, for there was not a house where there was not one dead.

31 And he called for Moses and Aaron by night and said, “Rise up, and get you forth from among my people, both ye and the children of Israel! And go, serve the Lord, as ye have said.

— the Targum of Jonathan reveals

“And the boundary of the land of Egypt was a journey of four hundred pharsee; and the Land of Goshen, where Moses and the children of Israel were, was in the middle of the land of Egypt. The royal palace of the house of Pharaoh’s kingdom was at the entrance of the land of Egypt.

“And when he called to Moses and Aaron on the night of Passover, his voice was heard as far as the Land of Goshen; Pharaoh was entreating with a sorrowful voice, and thus he said: ‘Arise, go out from among my people, both you and the children of Israel; and go, worship before the Lord, just as you have said.'”

32 Also take your flocks and your herds, as ye have said; and be gone, and bless me also.”

33 And the Egyptians were urgent upon the people, that they might send them out of the land in haste; for they said, “We are all dead men.”

Numbers 9:11 The fourteenth day of the second month at evening they shall keep it, and eat it with unleavened bread and bitter herbs.

12 They shall leave none of it unto the morning (בֹּקֶר bôqer, H1242), nor break any bones. According to all the ordinances of the Passover they shall keep it.

The Israelites could have left around 1-2 am, which is early morning. It may even be slightly later at 2-3 am but it would still be in the morning, bôqer.

34 And the people took their dough before it was leavened, their kneading troughs being bound up in their clothes upon their shoulders.

35 And the children of Israel did according to the word of Moses [for they had already] borrowed from the Egyptians jewels of silver and jewels of gold and raiment.

Indications are that there are at least fourteen days between the ninth and tenth plagues, for the chapter starts with the beginning of the month, until Passover, the killing of the lamb;

In Exodus 11:2 “Speak now in the ears of the people, and let every man borrow from his neighbor, and every woman from her neighbor, jewels of silver and jewels of gold,”

ESV The people of Israel had also done as Moses told them, for they had asked the Egyptians for silver and gold jewelry and for clothing.

Actually the spoilings have occurred much earlier, throughout the ten plagues: Exodus 3:19 “And I am sure that the king of Egypt will not let you go, no, not by a mighty hand.”

And then more specifically in Exodus 3:22, “and every woman shall borrow of her neighbor and of her that sojourneth in her house jewels of silver and jewels of gold and raiment.”

Hence verses 35-36 is a flashback, for the spoiling had already began much earlier. 

36 And the Lord gave the people favor in the sight of the Egyptians, so that they lent unto them such things as they required. And they despoiled the Egyptians.

For they had already plundered the Egyptians. In the previous chapter,

Exodus 11:1 And the Lord said unto Moses, “Yet will I bring one plague more upon Pharaoh and upon Egypt. Afterwards he will let you go hence. When he shall let you go, he shall surely thrust you out hence altogether.

2 Speak now in the ears of the people, and let every man borrow from his neighbor, and every woman from her neighbor, jewels of silver and jewels of gold.” So the plundering of the Egyptians had been happening for at least 13 days earlier!

37 And the children of Israel journeyed from Rameses to Succoth, about six hundred thousand on foot who were men, besides children.

Targum says from Pilusin towards Succoth, a hundred and thirty thousand “sons,” — supposingly to total 600,000;

Rashi: from Rameses to Succoth: They were 120 “mil” [apart]. Yet they arrived there instantly, as it is said: “and I carried you on eagles’ wings.” – [from Mechilta]

Numbers 33:3 And they departed from Rameses in the first month, on the fifteenth day of the first month. On the morrow after the Passover the children of Israel went out with a high hand in the sight of all the Egyptians,

4 for the Egyptians buried all their firstborn, whom the Lord had smitten among them. Upon their gods also the Lord executed judgments. 5 And the children of Israel removed from Rameses and pitched camp in Succoth.

Since one lamb is for two or three families, some of the families could have moved earlier from Goshen to Rameses in preparation for the signal to flee. Houses in Goshen could be quite empty.

38 And a mixed multitude went up also with them, and flocks and herds, even very much cattle.

— the Targum of Jonathan reveals

“And also many foreigners—two hundred and forty ribvan (2,400,000)—went up with them; and sheep and oxen and very much livestock.”

39 And they baked unleavened cakes of the dough which they brought forth out of Egypt; for it was not leavened because they were thrust out of Egypt and could not tarry, neither had they prepared for themselves any victual.

The thrusting out of Egypt was carried out immediately after the killing of the firstborn, not the day after. Exodus 12:31-33, otherwise the urgency “with your loins girded, your shoes on your feet, and your staff in your hand; and ye shall eat it in haste (verse 11)” made no sense.

Actually the Israelites were not thrusted out of Egypt until about a week later. Perhaps they could be better described “they began to be thrust out of Egypt.” And until they crossed the Red Sea they were really being thrusted out.

Also, the Israelites didn’t  tarry, they didn’t wait for another 24 hours to start moving.

40 Now the sojourning of the children of Israel who dwelt in Egypt was four hundred and thirty years. — Targum: “the days of the dwelling of the sons of Israel in Mizraim were thirty weeks of years, (thirty times seven years)” which is 210 years;

— the Targum of Jonathan explains how the 430 years came about, saying

“And the days that the children of Israel dwelt in Egypt were thirty sabbatical cycles (shmitin) of years, the sum of which is two hundred and ten years (210 years). But the count of four hundred and thirty years is from the time the Lord spoke to Abraham—from the hour He spoke with him on the fifteenth of Nisan between the divided pieces—until the day they went out of Egypt.”

41 And it came to pass at the end of the four hundred and thirty years, even on the selfsame day it came to pass, that all the hosts of the Lord went out from the land of Egypt.

— the Targum of Jonathan explains how the 400 years came about, saying

“And it was at the end of thirty years from when this decree was decreed until Isaac was born, [and] until they went out redeemed from Egypt, four hundred years. And it was on this very day that all the hosts of the Lord went out, redeemed, from the land of Egypt.”

The 6 hours at the top right “Afternoon” is also known as “`ben ha arbayim

42 It is a night to be much observed unto the Lord for bringing them out from the land of Egypt. This is that night of the Lord to be observed by all the children of Israel in their generations.

— the night to be much observed is the night when they ate the Passover, when a few hours later, the Death Angel came and slaughtered the Egyptians, which made such a night so memorable that it should be kept;

Deuteronomy 16:1 “Observe the month of Abib, and keep the Passover unto the Lord thy God; for in the month of Abib the Lord thy God brought thee forth out of Egypt by night. . .

4 And there shall be no leavened bread seen with thee in all thy borders seven days, neither shall there anything of the flesh, which thou sacrificed the first day at evening, remain all night until the morning.

Night (from 6 pm to 6 am) and morning (from midnight to 6 am) overlaps morning by 6 hours. So they left after midnight around 1-2 am which is night as well as in the morning.

— the Targum of Jonathan explains this night as the “Poem of the Four Nights”

“Four nights are written in the Book of Remembrances before the Lord of the World:

The First Night: When He was revealed to create the world. The Second Night: When He was revealed unto Abraham. The Third Night: When He was revealed in Egypt; His hand was killing all the firstborn of Egypt, and His right hand was sparing the firstborn of Israel. The Fourth Night: When He will be revealed to redeem the people, the House of Israel, from among the nations.

And all of them He called ‘A Night of Watching.’ Therefore, Moses explained and said: ‘It is a night of watching for redemption from before the Lord, to bring the people of the children of Israel out from the land of Egypt.’ This is the night that is guarded from the Destroying Angel for all the children of Israel who were in Egypt, and likewise for their redemption from their exiles throughout their generations.”

43 And the Lord said unto Moses and Aaron, “This is the ordinance of the Passover. There shall no stranger eat thereof; — this is the ordinance of the passover; as before delivered, and these the laws and rules, according to which it is to be observed, as now related, both with respect to the lamb, and to the unleavened bread;

— and the following is an account of the persons that were to partake of it: there shall no stranger eat thereof, anyone uncircumcised that is of another country.

44 but every man’s servant who is bought for money, when thou hast circumcised him, then shall he eat thereof. — if a stranger wished to join, he would need to be circumcised for himself and all the males of his family.

45 A foreigner and a hired servant shall not eat thereof. — similarily, if a foreigner, bought as a slave into an Israelitish family, may eat of it, if he is made a member of their community by circumcision.

46 In one house shall it be eaten; thou shalt not carry forth any of the flesh abroad out of the house, neither shall ye break a bone thereof.

— neither shall ye break a bone thereof; any of its tender bones to get out the marrow; and so the Targum of Jonathan adds, “that ye shall not eat that which is in the midst of it.”

47 All the congregation of Israel shall keep it. — all Israelites are to keep the Passover;

48 And when a stranger shall sojourn with thee and will keep the Passover H6453 to the Lord, let all his males be circumcised, and then let him come near and keep it; and he shall be as one that is born in the land, for no uncircumcised person shall eat thereof.

49 One law shall be for him that is homeborn and for the stranger who sojourneth among you.” — one set of law shall be to him that is homeborn and would be the same unto the stranger;

50 Thus did all the children of Israel; as the Lord commanded Moses and Aaron, so did they.

51 And it came to pass the selfsame day that the Lord brought the children of Israel out of the land of Egypt by their armies. — this is a reminder that the children fled out of Egypt on the fifteenth of Nisan, and as that night was such a spectacular event, it was to be a night to be much remembered in later generations.

~~~~

A parallel Exodus would reoccur during the endtime, which would far exceed that of the original Exodus led by Moses.

Therefore will I cast you out of this land into a land that ye know not, neither ye nor your fathers; and there shall ye serve other gods day and night, where I will not show you favor.’

“Therefore behold, the days come,” saith the Lord, “that it shall no more be said, ‘The Lord liveth who brought up the children of Israel out of the land of Egypt,’ 

but, ‘the Lord liveth who brought up the children of Israel from the land of the north, and from all the lands whither He had driven them.’ And I will bring them back into their land that I gave unto their fathers. Jeremiah 16:13-15; so emphatic is such a scene that it is repeated in Jeremiah 23:6-8.

So severe shall be their bondage that their deliverance from it shall be a far greater Deliverance than that out of Egypt where they spent 210 years in slavery under their Egyptian taskmasters!

For more see,

For more into another Captivity: see Ezekiel 4 – 390/40 Years Timeline

For more about the South, a prophecy of Esau or Edom, see Obadiah

More enemy of the South, The Flaming Sword and Fire from the South!

Exodus (9-10)

•April 27, 2026 • Leave a Comment
Moses before Pharaoh, “Thus saith the Lord God of the Hebrews: Let My people go.”

Exodus 9

Then the Lord said unto Moses, “Go in unto Pharaoh and tell him, ‘Thus saith the Lord God of the Hebrews: Let My people go, that they may serve Me.

— let my people go, that they may serve me; this demand had been made repeatedly; and, though reasonable, was refused.

For if thou refuse to let them go and wilt hold them still,

behold, the hand of the Lord is upon thy cattle which are in the field, upon the horses, upon the asses, upon the camels, upon the oxen, and upon the sheep. There shall be a very grievous pestilence.

— the hand of the Lord; immediately, without the stretching out of Aaron’s hand; is upon the cattle; many of which, some of all kinds, should die by a sort of pestilence; a disease would be sent among all the flocks and herds of the Egyptians;

— the Targum of Jonathan renders it a “with a very mighty death” as the Jews commonly call a pestilence, whether on man or beast, because it generally sweeps away large numbers.

And the Lord shall distinguish between the cattle of Israel and the cattle of Egypt; and there shall nothing die of all that belong to the children of Israel.’” — nothing shall die of the children’s of Israel; this was the greater miracle,

— because the Israelites and the Egyptians were mingled together in the land of Goshen; so that their cattle breathed the same air, and drank the same water. By which it appeared that this pestilence was not natural, but proceeded from the immediate hand of God.

And the Lord appointed a set time, saying, “Tomorrow the Lord shall do this thing in the land.” — saying, tomorrow the Lord shall do this thing in the land;

— thus giving him time and space to consider the matter well, repent of his obstinacy, and dismiss the people of Israel, and so prevent the plague coming upon the cattle, as threatened.

And the Lord did that thing on the morrow; and all the cattle of Egypt died, but of the cattle of the children of Israel died not one. — but of the cattle of the children of Israel died not one; at least of the murrain or a pestilential disease, or by the hand of God.

And Pharaoh sent, and behold, there was not one of the cattle of the Israelites dead. And the heart of Pharaoh was hardened, and he did not let the people go.

— and the heart of Pharaoh was hardened, and he did not let the people go; though this plague was so heavy upon him and his people, and the loss they sustained so great:

— in the other plagues of the water, the frogs, lice, and flies, though very troublesome and terrible, yet the loss was not very great; but here much damage was done to their property, yet this did not make his heart relent, or cause him to yield to let Israel go.

And the Lord said unto Moses and unto Aaron, “Take to you handfuls of ashes from the furnace, and let Moses sprinkle it toward the heaven in the sight of Pharaoh. — and the heart of Pharaoh was hardened, and he did not let the people go,

— in the other plagues of the water, the frogs, lice, and flies, though very troublesome and terrible, yet the loss was not very great; but here much damage was done to their property, yet this did not make his heart relent, or cause him to yield to let Israel go.

And it shall become small dust in all the land of Egypt, and shall be a boil breaking forth with blains, upon man and upon beast throughout all the land of Egypt.” — upon man and throughout all the land of Egypt;

— so that, as the last plague affected their property, substance, and riches, which in those times greatly lay in cattle, this, besides that, would affect their persons, and give them exceeding great pain, though it might not issue in death.

10 And they took ashes from the furnace and stood before Pharaoh, and Moses sprinkled it up toward heaven; and it became boils breaking forth with blains upon man and upon beast. — the sixth plague smote man and beast with;

— these failing down in the manner before described, on whomsoever they lighted, whether man or beast, produced sore boils and inflammations, and raised blisters and blotches.

11 And the magicians could not stand before Moses because of the boils, for the boils were upon the magicians and upon all the Egyptians. — the magicians; this time are not only not able to imitate the plague, but are themselves attacked by it;

— for the boil was upon the magicians, and upon all the Egyptians; but not upon Moses and Aaron, nor upon any of the Israelites;

12 And the Lord hardened the heart of Pharaoh, and he hearkened not unto them, as the Lord had spoken unto Moses. — their priests and magicians were so far from being able to shelter the king from this plague by their secret arts, that they were attacked by them themselves,

— were unable to stand before Moses, and were obliged to give up all further resistance. But Pharaoh did not take this plague to heart, and his heart was hardened further.

13 And the Lord said unto Moses, “Rise up early in the morning, and stand before Pharaoh and say unto him, ‘Thus saith the Lord God of the Hebrews: Let My people go, that they may serve Me.

14 For I will at this time send all My plagues upon thine heart, and upon thy servants and upon thy people, that thou mayest know that there is none like Me in all the earth.

— for I will at this time send all my plagues upon thine heart; the plague of the hail, which next follows, so called, because it consisted of various things, as hail, rain, lightning and thunder;

15 For now I will stretch out My hand, that I may smite thee and thy people with pestilence, and thou shalt be cut off from the earth. — and thou shall be cut off from the earth; or “thou hadst been or wouldest have been cut off from the earth.”

16 And in very deed, for this cause have I raised thee up: to show in thee My power, and that My name may be declared throughout all the earth.

— and that my name may be declared throughout all the earth; as it has been more by that last action than by all the rest of the plagues; though, in all, his sovereignty, wisdom, power, patience, longsuffering and justice, are most visibly displayed and glorified.

17 As yet exaltest thou thyself against My people, that thou wilt not let them go? — as yet exaltest thou thyself against my people; and so against God himself, disobeying his commands, despising his messengers, and hardening his heart against him and refusing to let Israel go;

18 Behold, tomorrow about this time I will cause it to rain a very grievous hail, such as hath not been in Egypt since the foundation thereof even until now.

— I will cause it to rain a very grievous hail; which should fall very thick, and the hailstones be very numerous and heavy, and the storm last long;

19 Send therefore now, and gather thy cattle and all that thou hast in the field, for upon every man and beast which shall be found in the field and shall not be brought home, the hail shall come down upon them, and they shall die.’”

— a very grievous hail; the seventh plague which Pharaoh’s hardened heart was provoked; a phenomenon which must have produced the greatest astonishment and consternation in Egypt as rain and hailstones, accompanied by thunder and lightning, to kill both men and beasts.

20 He that feared the word of the Lord among the servants of Pharaoh made his servants and his cattle flee into the houses, — he that feared the word of the Lord among the servants of Pharaoh; it is a new fact that any of the Egyptians had been brought to “fear the word of Yehovah;”

— probably, the effect of the plagues had been gradually to convince a considerable number, not so much that Yehovah was the one True God as that he was a great and powerful god, whose chastisements were to be feared.

21 and he that regarded not the word of the Lord left his servants and his cattle in the field. — left his servants and cattle in the field; let them remain there, and took no thought about them, and so took no methods to preserve them; to his own detriment and loss.

22 And the Lord said unto Moses, “Stretch forth thine hand toward heaven, that there may be hail in all the land of Egypt, upon man and upon beast and upon every herb of the field, throughout the land of Egypt.”

— stretch forth thine hand toward heaven; the action was appropriate, as the plague was to come from the heaven.

23 And Moses stretched forth his rod toward heaven; and the Lord sent thunder and hail, and the fire ran along upon the ground; and the Lord rained hail upon the land of Egypt.

— the fire ran along upon the ground, devouring both herbs and cattle which were upon it; and came at the exact time he had foretold it should; all which were very extraordinary.

24 So there was hail and fire mingled with the hail, very grievous, such as there was none like it in all the land of Egypt since it became a nation.

— so there was hail, and fire mingled with the hail; which was a miracle within a miracle; and very wonderful indeed it was, that the hail did not quench the fire, nor the fire melt the hail.

25 And the hail smote throughout all the land of Egypt all that was in the field, both man and beast; and the hail smote every herb of the field and broke every tree of the field.

— the hail smote throughout all the land of Egypt; it is to the hail and not to the fire nor lightning that the great destruction of men and beasts is attributed;

— perhaps the fire and lightning are destined for the endtime? “Like fire that burns the forest and like a flame that sets the mountains on fire.” – Psalm 83:14

26 Only in the land of Goshen, where the children of Israel were, was there no hail. — only in the land of Goshen, where the children of Israel were, was there no hail;

— so that such Egyptians as might dwell among them, they, their servants, their cattle, and their fruits, escaped this plague; and oftentimes do wicked men fare the better for the people of God that are among them.

27 And Pharaoh sent and called for Moses and Aaron, and said unto them, “I have sinned this time. The Lord is righteous, and I and my people are wicked.

— the Lord is righteous, and I and my people are wicked; which was well spoken, had it been serious and from his heart; for God is righteous in his nature, and in all his works;

— and in all those judgments he had inflicted upon him; he and his people were using the Israelites in such a cruel manner, and in detaining them when it had been promised them again and again that they should have leave to go, especially in rebelling against God and disobeying his commands.

28 Entreat the Lord (for it is enough), that there be no more mighty thunderings and hail; and I will let you go, and ye shall stay no longer.” — mighty thunderings; literally, as in the margin, “voices of God.” Thunder was regarded by many nations of antiquity as the actual voice of a god.

29 And Moses said unto him, “As soon as I have gone out of the city, I will spread abroad my hands unto the Lord; and the thunder shall cease, neither shall there be any more hail, that thou mayest know that the earth is the Lord’S.

— that thou mayest know how that the earth is the Lord’s; that the whole earth is his, and therefore he can do, and does in it whatever he pleases; as the heavens also are his, and therefore can cause thunder, lightning, hail, and rain, and stop them when he thinks fit;

30 But as for thee and thy servants, I know that ye will not yet fear the Lord God.” — but as for thee, and thy servants, notwithstanding the confession of sin he had made, Moses know that they haven’t fear the Lord God yet;

31 And the flax and the barley were smitten; for the barley was in the ear, and the flax was in bolls. — and the flax and the barley was smitten; with the hail, thunder and lightning, and were beat down, bruised, broken, and blasted and destroyed;

32 But the wheat and the rye were not smitten, for they were not grown up. — they haven’t grown up yet; Heb, they were late or hidden. The ear was undeveloped, and lay hid in the low tufts that grew like grass.

33 And Moses went out of the city from Pharaoh, and spread abroad his hands unto the Lord; and the thunder and hail ceased, and the rain was not poured upon the earth. — Moses went out of the city, that, being solitary, he might pour forth his heart in fervent prayers.

34 And when Pharaoh saw that the rain and the hail and the thunder had ceased, he sinned yet more and hardened his heart, he and his servants.

— but even this plague did not lead Pharaoh to alter his mind; as soon as it had ceased on the intercession of Moses, he and his servants continued sinning and hardening their hearts.

35 And the heart of Pharaoh was hardened, neither would he let the children of Israel go, as the Lord had spoken by Moses.

— hardened; fifferent words in the Hebrew. In Exodus 9:34 the word means “made heavy,” that is, obtuse, incapable of forming a right judgement; in Exodus 9:35 it is stronger, and implies a stubborn resolution.

Exodus 10

1 And the Lord said unto Moses, “Go in unto Pharaoh; for I have hardened his heart and the heart of his servants, that I might show these My signs before him;

— go in unto Pharaoh, for I have hardened his heart; that I might shew these my signs before him; and others that were to be done;

and that thou mayest tell in the ears of thy son and of thy son’s son what things I have wrought in Egypt, and My signs which I have done among them, that ye may know that I am the Lord.” — and that thou mayest tell; of thy son, and of thy son’s son;

— there was a further and higher reason for the infliction of those awful judgements, namely, that the knowledge of them there, and the permanent record of them still, might furnish a salutary and impressive lesson to others down to the latest ages.

And Moses and Aaron came in unto Pharaoh and said unto him, “Thus saith the Lord God of the Hebrews: ‘How long wilt thou refuse to humble thyself before Me? Let My people go, that they may serve Me.

— how long wilt thou refuse to humble thyself before me? to acknowledge his offence, lie low before God, and be subject to his will; he had humbled himself for a moment;

— but then this did not continue what God expected of him, and complains of the want of, was such a continued humiliation before him, and such a subjection to him, as would issue in complying with what he had so often demanded of him;

Else, if thou refuse to let My people go, behold, tomorrow will I bring the locusts into thy border. — locusts, a well-known plague throughout the Middle-East and neighbouring countries;

And they shall cover the face of the earth, that one shall not be able to see the earth; and they shall eat the residue of that which has escaped, which remaineth unto you from the hail, and shall eat every tree which groweth for you out of the field.

— and shall eat every tree which groweth for you out of the field; such fruit trees as escaped the hail, and such boughs and branches of them which were not broken off by it;

— “When their swarms appear, everything green vanishes instantaneously from the fields, as if a curtain were rolled up; the trees and plants stand leafless, and nothing is seen but naked boughs and stalks.”

And they shall fill thy houses and the houses of all thy servants and the houses of all the Egyptians — which neither thy fathers nor thy fathers’ fathers have seen since the day that they were upon the earth unto this day.’” And he turned himself, and went out from Pharaoh.

— thy houses shall be filled; they entered the inmost recesses of the houses, were found in every corner, stuck to their clothes, and infested their food;

And Pharaoh’s servants said unto him, “How long shall this man be a snare unto us? Let the men go, that they may serve the Lord their God. Knowest thou not yet that Egypt is destroyed?” — knowest thou not yet that Egypt is destroyed?

— as good as ruined, by the plagues and boils upon the cattle, which destroyed great quantities, and by the hail which had smitten their flax and their barley; or “must thou first know that Egypt is destroyed?” before thou wilt let the people go;

And Moses and Aaron were brought again unto Pharaoh; and he said unto them, “Go, serve the Lord your God. But who are they that shall go?” — but who are they that shall go? or, “who and who”? for Pharaoh was unwilling that they should all go, but would have some retained as pledges of their return;

And Moses said, “We will go with our young and with our old, with our sons and with our daughters, with our flocks and with our herds will we go, for we must hold a feast unto the Lord.”

— with our flocks and with our herds will we go; which were requisite for the sacrifices, not knowing which they were to sacrifice, and with which to serve God, till they came to the place where they were to sacrifice;

10 And he said unto them, “Let the Lord be so with you, as I will let you go, and your little ones. Look to it, for evil is before you.

— and the Pharaoh said unto Moses and Aaron, let the Lord be so with you, as I will let you go, and your little ones; either as mocking them, let the Lord you talk of be with you if he will, and let him deliver you if he can, as I shall let you go with your children, which I never will;

— look to it, for evil is before you; which is either a charge of an evil design upon them, and intended to raise a mutiny, make an insurrection, and form a rebellion against them.

11 Not so! Go now ye that are men, and serve the Lord, for that ye did desire.” And they were driven out from Pharaoh’s presence. — not so; you shall not go with your children as you propose;

12 And the Lord said unto Moses, “Stretch out thine hand over the land of Egypt for the locusts, that they may come up upon the land of Egypt and eat every herb of the land, even all that the hail hath left.”

— and eat every herb of the land, even all that the hail hath left; the wheat and the rye, or rice, the grass, herbs, and plants, it had beat down, but not utterly destroyed, as well as some boughs and branches of trees which were left unbroken by it.

13 And Moses stretched forth his rod over the land of Egypt, and the Lord brought an east wind upon the land all that day and all that night; and when it was morning, the east wind brought the locusts.

— the Lord brought an east wind. Locusts generally come with a wind; and, indeed, cannot fly far without one; an east wind would in this case have brought them from northern Arabia, where they are often bred in large numbers.

14 And the locusts went up over all the land of Egypt, and rested in all the borders of Egypt. Very grievous were they; before them there were no such locusts as they, neither after them shall be such. — and rested in all the coasts of Egypt; in every part of it where the Egyptians dwelt;

— and where there were meadows, pastures, fields, gardens, orchards; here they lighted and fed, excepting the land of Goshen, where Israel dwelt.

15 For they covered the face of the whole earth, so that the land was darkened; and they ate every herb of the land and all the fruit of the trees which the hail had left, and there remained not any green thing in the trees or in the herbs of the field through all the land of Egypt.

— the land was darkened; either by their flying in vast numbers, and so darkening the air, as they have ofttimes done; or by covering the green and lightsome herbs and productions of the earth with their dark and direful bodies.

16 Then Pharaoh called for Moses and Aaron in haste, and he said, “I have sinned against the Lord your God, and against you. — I have sinned against the Lord your God; against the Lord by disobeying his command, in refusing to let Israel go, when he had so often required it of him; and against Moses and Aaron his ambassadors;

17 Now therefore forgive, I pray thee, my sin only this once, and entreat the Lord your God, that he may take away from me this death only.”

— Pharaoh desires their prayers that this death only might be taken away, not this sin: pretending that he would never offend any more, and if he did, he did not desire it should be forgiven him, but that due punishment should be inflicted on him.

18 And he went out from Pharaoh and entreated the Lord. — intreated the Lord; Moses complied, though Pharaoh had this time made no distinct promise of releasing the people.

19 And the Lord turned a mighty, strong west wind, which took away the locusts and cast them into the Red Sea. There remained not one locust in all the borders of Egypt. — there remained not one locust in all the coasts of Egypt; so that the removal of them was as great a miracle as the bringing them at first;

20 But the Lord hardened Pharaoh’s heart, so that he would not let the children of Israel go. — but the Lord hardened Pharaoh’s heart; for as yet he had not brought all his judgments on him he designed to bring;

21 And the Lord said unto Moses, “Stretch out thine hand toward heaven, that there may be darkness over the land of Egypt, even darkness which may be felt.” — the plague of darkness brought upon Egypt was a dreadful plague;

22 And Moses stretched forth his hand toward heaven, and there was a thick darkness in all the land of Egypt three days. — it was darkness which might be felt, so thick were the fogs. It astonished and terrified. It continued three days; six nights in one;

23 They saw not one another, neither rose any from his place for three days; but all the children of Israel had light in their dwellings. — it was darkness which might be felt, so thick were the fogs; it continued three days; six nights in one; so long the most lightsome palaces were dungeons;

24 And Pharaoh called unto Moses and said, “Go ye, serve the Lord; only let your flocks and your herds be stayed. Let your little ones also go with you.” — go ye, serve the Lord, only let your flocks and your herds be stayed; stopped or remained behind, as a pledge and security of their return;

25 And Moses said, “Thou must give us also sacrifices and burnt offerings, that we may sacrifice unto the Lord our God. — but Moses said, thou must give us also sacrifices and burnt offerings: sheep, rams, and goats for sacrifices, and oxen for burnt offerings;

26 Our cattle also shall go with us. There shall not a hoof be left behind; for thereof must we take to serve the Lord our God, and we know not with what we must serve the Lord until we come thither.”

— the Israelites’ own cattle must go as well: because until they reach their destination they do not know how many sacrifices will be required.

27 But the Lord hardened Pharaoh’s heart, and he would not let them go. — but the Lord hardened Pharaoh’s heart; yet more and more, and he would not let them go;

28 And Pharaoh said unto him, “Get thee from me! Take heed to thyself! See my face no more, for in that day thou seest my face thou shalt die!” — see my face no more; neither here nor elsewhere: for in that day thou seest my face thou shalt die; this was a foolish as well as a wicked speech;

29 And Moses said, “Thou hast spoken well. I will see thy face again no more.”

— knowing by a spirit of prophecy that he should be no more sent unto him, and that Pharaoh should in a little time be drowned in the Red sea, when he would be seen no more by him nor any other; for as for what is said in the following chapter.

Exodus (7-8)

•April 26, 2026 • Leave a Comment

The names of these magicians of Egypt, Janis and Jamberes, were mentioned in the Exodus 7:11 Jonathan

But also being mentioned earlier in Exodus 1:15 Jonathan, introduced as the chief of the magicians; but also picked up by Paul

“Now as Jannes and Jambres withstood Moses, so do these also resist the truth — men of corrupt minds, reprobate concerning the faith.” II Timothy 3:8

Aaron and Moses before Pharaoh, then the chief magicians, Jannes and Jambres

Exodus 7

1 And the Lord said unto Moses, “See, I have made thee a god (’ĕ·lō·hîm) to Pharaoh, and Aaron thy brother shall be thy prophet. — a god ’ĕ·lō·hîm to Pharaoh;

— “a god” that is, he was to act in this business as God’s representative, God’s envoy, to act and speak in His name and to perform things beyond the ordinary course of nature;

— any messenger (mal·’āḵ) is also an angel; and God gives authority for an messenger to carry God’s name, “for My name is in him;”

“Behold, I send a messenger (mal·’āḵ) before thee to keep thee in the way, and to bring thee into the place which I have prepared;

Have regard for him, and obey his voice. Provoke him not, for he will not pardon your transgressions, for My name is in him. Exodus 23:20-21

— the Targum of Jonathan reveals another dimension, saying,

“And the Lord said to Moses: ‘Why are you afraid? Behold, I have already placed you as a terror to Pharaoh, as if you were his god; and Aaron your brother shall be your prophet.'”

Thou shalt speak all that I command thee; and Aaron thy brother shall speak unto Pharaoh, that he send the children of Israel out of his land.

— that he send the children of Israel out of his land; this was the principal thing to be insisted upon; and all that was said or done to him was to bring about this end, the dismission of the children of Israel out of Egypt.

And I will harden Pharaoh’s heart, and multiply My signs and My wonders in the land of Egypt. — but I will harden his heart, that he shall not let the people go; that is, not until all the wonders are wrought, and plagues inflicted him;

— Pharaoh first hardening his own heart against God; leaving him to strong delusions, to believe the lying miracles of his magicians: this the Lord thought fit to acquaint Moses with, lest he should be discouraged by his refusal to dismiss Israel.

But Pharaoh shall not hearken unto you, that I may lay My hand upon Egypt and bring forth Mine armies and My people, the children of Israel, out of the land of Egypt by great judgments.

— that I may lay mine hand upon Egypt; the inhabitants of Egypt, smiting them with one plague after another; and particularly with slaying their firstborn; every plague was a stroke of his hand, and an effect of his mighty power and vengeance, and more especially that;

And the Egyptians shall know that I am the Lord, when I stretch forth Mine hand upon Egypt and bring out the children of Israel from among them.”

— and the Egyptians shall know; these great judgement, and Israel’s triumphant exodus, will teach the Egyptians Yehovah’s might, and His superiority to their own gods.

And Moses and Aaron did as the Lord commanded them; so did they. — their reluctance and resistance from this time ceased.

And Moses was fourscore years old, and Aaron fourscore and three years old when they spoke unto Pharaoh. — and Moses was eighty years old; at this time, which is partly to show how long Israel had been afflicted in Egypt;

— for their great troubles and miseries began about the time of the birth of Moses, or a little before, as appears from the above history;

And the Lord spoke unto Moses and unto Aaron, saying,

“When Pharaoh shall speak unto you, saying, ‘Show a miracle for yourselves,’ then thou shalt say unto Aaron, ‘Take thy rod and cast it before Pharaoh, and it shall become a serpent.’”

— thy rod; this Moses ordinarily held in his hand, but the rod is now called Aaron’s, because Moses had entrusted him with it;

— the Targum of Jonathan reveals

“When Pharaoh speaks with you, saying: ‘Provide a wonder for yourselves,’ you shall say to Aaron: ‘Take your staff and cast it down before Pharaoh; it shall become a venomous basilisk/serpent.

“For all the inhabitants of the earth are destined to hear the sound of the cry of the Egyptians when I break them, just as all creatures heard the sound of the cry of the serpent when it was stripped (of its legs/skin) at the beginning [of creation].'”

10 And Moses and Aaron went in unto Pharaoh, and they did so as the Lord had commanded; and Aaron cast down his rod before Pharaoh and before his servants, and it became a serpent.

— it became a serpent; not only to affect Pharaoh with wonder, but to strike a terror upon him, because it was also an Egyptian deity.

11 Then Pharaoh also called the wise men and the sorcerers. Now the magicians of Egypt, they also did in like manner with their enchantments.

— the names of these magicians of Egypt, Janis and Jamberes, were already incorporated in the Targum of Jonathan

But Pharoh called the hachems and magicians; and they also, Janis and Jamberes, magicians of Mizraim, did the same by their burnings of divination.

— also being mentioned in Exodus 1:15 Jonathan, introduced as the chief of the magicians; but also picked up by Paul

“Now as Jannes and Jambres withstood Moses, so do these also resist the truth — men of corrupt minds, reprobate concerning the faith.” II Timothy 3:8

Their Egyptian magicians, Jannes and Jambres, also know how to play snakes

12 For they cast down every man his rod, and they became serpents; but Aaron’s rod swallowed up their rods. — swallowed up their rods and so gave proof of Aaron’s superiority to the magicians; though this miracle made no impression upon Pharaoh.

13 And He hardened Pharaoh’s heart, that he hearkened not unto them, as the Lord had said. — he hardened Pharaoh’s heart; or, “notwithstanding the heart of Pharaoh was hardened” though he saw the rods of his magicians devoured by rod;

— or “therefore” his heart was hardened, because he saw that the rods of his magicians became serpents as well as Aaron’s; that he hearkened not unto them; to Moses and Aaron, and comply with their demand, to dismiss the people of Israel;

14 And the Lord said unto Moses, “Pharaoh’s heart is hardened; he refuseth to let the people go. — Pharaoh’s heart is hardened; or “heavy,” dull and stupid, stiff and inflexible, cannot lift up his heart, or find in his heart to obey the will of God;

15 Get thee unto Pharaoh in the morning. Lo, he goeth out unto the water, and thou shalt stand by the river’s brink until he come; and the rod which was turned to a serpent shalt thou take in thine hand.

— and thou shall stand by against the brink of the river Nile, in order to meet him; and the rod which was turned to a serpent shalt thou take in thine hand; as a terror to Pharaoh.

16 And thou shalt say unto him, ‘The Lord God of the Hebrews hath sent me unto thee, saying, “Let My people go, that they may serve Me in the wilderness”; and behold, hitherto thou wouldest not hear.

— saying, let my people go, that they may serve me in the wilderness; the demand is once more renewed, before any punishment is inflicted for refusal.

17 Thus saith the Lord: “In this thou shalt know that I am the Lord: Behold, I will smite with the rod that is in mine hand upon the waters which are in the river, and they shall be turned to blood.

— water turned to blood, which was a very grievous plague to them; both because it was an eternal dishonour to their religion, and because from hence they had both their drink and their meat; and if this river was their god;

18 And the fish that are in the river shall die, and the river shall stink; and the Egyptians shall loathe to drink of the water of the river.”’”

— the water of the Nile has always been regarded by the Egyptians as a blessing unique to their land; now with the water changed into blood and stink, this was a severe calamity.

19 And the Lord spoke unto Moses, “Say unto Aaron, ‘Take thy rod and stretch out thine hand upon the waters of Egypt, upon their streams, upon their rivers, and upon their ponds, and upon all their pools of water, that they may become blood; and that there may be blood throughout all the land of Egypt, both in vessels of wood and in vessels of stone.’”

— both in vessels of wood, and in vessels of stone; fetched from the river; all which were to be turned into blood everywhere, in all parts of the land, immediately upon Aaron’s taking his rod, and smiting the waters with it in that part of the river that was before him.

20 And Moses and Aaron did so, as the Lord commanded; and he lifted up the rod and smote the waters that were in the river, in the sight of Pharaoh and in the sight of his servants; and all the waters that were in the river were turned to blood.

— and all the waters that were in the river were turned into blood; all the water that was in the river, wherever it flowed, and as far as it flowed in the land of Egypt.

21 And the fish that were in the river died; and the river stank, and the Egyptians could not drink of the water of the river; and there was blood throughout all the land of Egypt.

— the change in the water extended to “the streams,” or different arms of the Nile; or canals; “the ponds,” that is, every collection of water;

22 And the magicians of Egypt did so with their enchantments; and Pharaoh’s heart was hardened, neither did he hearken unto them, as the Lord had said. — the magicians could not act on this large scale; they could only operate, or seem to operate, on some small quantity of water.

23 And Pharaoh turned and went into his house, neither did he set his heart to this also. — neither did he set his heart (that is, pay attention); Pharaoh did not lay even this to heart; he passed it over as a slight matter, unworthy of much thought, and “turned, and went into his house.

24 And all the Egyptians dug round about the river for water to drink, for they could not drink of the water of the river. — for they could not drink of the waters of the river; it being turned into blood, and stunk so exceedingly;

— and though they might strain it, and make it in some measure, drinkable, and might make use of the juice of herbs, and other things, to extinguish their thirst, and the better sort might have a stock of wine, yet multitudes must be greatly distressed.

25 And seven days were fulfilled after the Lord had smitten the river. — and seven days were fulfilled; these words seem to mark the duration of the first plague.

Exodus 8

1 And the Lord spoke unto Moses, “Go unto Pharaoh and say unto him, ‘Thus saith the Lord: Let My people go, that they may serve Me.

— again, while the main purpose of the plague was to punish the nation by which Israel had been so long oppressed, the secondary object of throwing contempt upon their, religion was main-rained.

And if thou refuse to let them go, behold, I will smite all thy borders with frogs. — I will smite all thy borders with frogs: fill the whole land of Egypt with them, to the utmost borders thereof on every side.

And the river shall bring forth frogs abundantly, which shall go up and come into thine house, and into thy bedchamber and upon thy bed, and into the house of thy servants and upon thy people, and into thine ovens and into thy kneading troughs.

— abundantly everywhere: which must be very offensive and troublesome to them, their ugly shape, croaking noise and filthy smell, which must make it very nauseous and distasteful to them;

And the frogs shall come up both on thee and upon thy people and upon all thy servants.’” — even the king himself not exempted; his people, and servants, high and low, rich and poor, and upon the king’s ministers, courtiers, and nobles;

And the Lord spoke unto Moses, “Say unto Aaron, ‘Stretch forth thine hand with thy rod over the streams, over the rivers and over the ponds, and cause frogs to come up upon the land of Egypt.’”

— say unto Aaron, stretch forth thy hand with thy rod; for Aaron was to speak and to do whatever he ordered him from the Lord.

And Aaron stretched out his hand over the waters of Egypt, and the frogs came up and covered the land of Egypt. — and the frogs came and covered the land of Egypt: they came up at once, and in such multitudes everywhere, that the whole land was full of them;

And the magicians did so with their enchantments, and brought up frogs upon the land of Egypt. — the magicians would seem foolishishly to have been able to increase the plague, but not to remove it;

Then Pharaoh called for Moses and Aaron and said, “Entreat the Lord, that he may take away the frogs from me and from my people; and I will let the people go, that they may do sacrifice unto the Lord.”

— Pharaoh said, entreat the Lord; this is the man, who, not long ago, proudly said, Who is the Lord? Who is Jehovah? Now he begins to know something of Jehovah’s power and justice at least;

And Moses said unto Pharaoh, “Glory over me: When shall I entreat for thee and for thy servants and for thy people to destroy the frogs from thee and thy houses, that they may remain in the river only?” — when shall I entreat for thee, that they may remain in this river only?

10 And he said, “Tomorrow.” And Moses said, “Be it according to thy word, that thou mayest know that there is none like unto the Lord our God. — and he said, be it according to thy word, as if he had said, it shall be done as thou hast desired, and at the time fixed;

11 And the frogs shall depart from thee, and from thy houses and from thy servants and from thy people. They shall remain in the river only.”

12 And Moses and Aaron went out from Pharaoh; and Moses cried unto the Lord because of the frogs which He had brought against Pharaoh.

— and Moses cried unto the Lord: with a loud voice, most fervently entreating that the frogs might be removed on the morrow, as he had promised;

13 And the Lord did according to the word of Moses; and the frogs died out of the houses, out of the villages, and out of the fields. — so that the land stank with the odour of their putrefaction;

14 And they gathered them together upon heaps, and the land stank. — and the land stank; with the stench of the dead frogs, which was another proof and evidence of the reality of the miracle;

15 But when Pharaoh saw that there was respite, he hardened his heart and hearkened not unto them, as the Lord had said. — but when Pharaoh saw that there was respite; from his affliction; the plague was removed, and he found himself and his people at ease:

— or there was a “breathing” before he and his people were so oppressed, that they could scarce breathe, but now being delivered from the judgment on them with which they were straitened, were enlarged and at liberty, and in easy circumstances: he hardened his heart;

16 And the Lord said unto Moses, “Say unto Aaron, ‘Stretch out thy rod and smite the dust of the land, that it may become lice throughout all the land of Egypt.’” — it is observed by Hebrew commentators that the nine plagues are divided into three groups:

— distinct warnings are given of the first two plagues in each group; the third in each is inflicted without any previous notice; namely, the third, lice, the sixth, boils, the ninth, darkness.

17 And they did so; for Aaron stretched out his hand with his rod and smote the dust of the earth, and it became lice on man and on beast. All the dust of the land became lice throughout all the land of Egypt.

— that it may become lice throughout all the land of Egypt: not gnats, nor flies, but lice, though perhaps not of the common and ordinary sort, but new and extraordinary;

18 And the magicians so did with their enchantments to bring forth lice, but they could not; so there were lice upon man and upon beast.

— it was as easy for them to produce lice as frogs, but God forbid them, partly to confound them, and to show that what they did before was only by his consent, but to show them that even the dust of the earth obeys him.

19 Then the magicians said unto Pharaoh, “This is the finger of God.” And Pharaoh’s heart was hardened, and he hearkened not unto them, as the Lord had said. — the finger of God; the magicians meant to say, “This is beyond the power of man: it is supernatural;

20 And the Lord said unto Moses, “Rise up early in the morning and stand before Pharaoh. Lo, he cometh forth to the water, and say unto him, ‘Thus saith the Lord: Let My people go, that they may serve Me.

— cometh forth to the water; it is not improbable that on this occasion Pharaoh went to the Nile, and Moses was ordered to meet him while walking on the banks of the Nile and repeat his request for the liberation of Israel;

21 Else, if thou wilt not let My people go, behold, I will send swarms of flies upon thee, and upon thy servants and upon thy people and into thy houses; and the houses of the Egyptians shall be full of swarms of flies, and also the ground whereon they are.

— and the houses of the Egyptians shall be full of the swarms of flies, and also the ground whereon they are; their number would be so very great.

22 And I will sever in that day the land of Goshen in which My people dwell, that no swarms of flies shall be there, to the end thou mayest know that I am the Lord in the midst of the earth.

— and I will sever in that day the land of Goshen, in which my people dwell; distinguish it from other parts of the land of Egypt:

— but restricted to the place where Pharaoh lived, and to bound and limit such sort of creatures as flies, which move swiftly from place to place, and particularly to keep the land of Goshen clear of them;

23 And I will put a division between My people and thy people. Tomorrow shall this sign be.’”

24 And the Lord did so; and there came a grievous swarm of flies into the house of Pharaoh, and into his servants’ houses and into all the land of Egypt. The land was corrupted by reason of the swarm of flies. — into the house of Pharaoh, and into the houses of his servants;

— and into all the land of Egypt: into the palace of Pharaoh, and of his nobles, ministers and courtiers, and into the dwelling places of all his subjects, throughout the whole land, excepting the land of Goshen;

25 And Pharaoh called for Moses and for Aaron and said, “Go ye, sacrifice to your God in the land.” — the Pharaoh gave way before this plague ended and without waiting for any remonstrance on the part of the magicians or others, he “called for Moses.”

— and said, go ye, sacrifice to your God in the land; that is, in the land of Goshen, in the place where they were; he was willing to allow them the liberty of sacrificing to their God, which it seems they had before; but then he would not consent they should go out of the land to do it.

26 And Moses said, “It is not meet so to do; for we shall sacrifice the abomination of the Egyptians to the Lord our God. Lo, shall we sacrifice the abomination of the Egyptians before their eyes, and will they not stone us?

— the abomination of the Egyptians; that which the Egyptians abhor to kill, or to see killed; because they worshipped them as gods, as is notoriously known.

27 We will go three days’ journey into the wilderness and sacrifice to the Lord our God, as He shall command us.” — we will go three days’ journey into the wilderness; as was first insisted on, and from which demand they should not depart;

28 And Pharaoh said, “I will let you go, that ye may sacrifice to the Lord your God in the wilderness; only ye shall not go very far away. Entreat for me.” — for the first time Pharaoh shows his real objection to letting the Israelites go: he is afraid that they will escape him;

— so he suggests the compromise: entreat or petition for me; that they shall just enter the wilderness on his eastern border, remaining near the frontier, and therefore within his reach.

29 And Moses said, “Behold, I go out from thee, and I will entreat the Lord that the swarms of flies may depart from Pharaoh, from his servants and from his people tomorrow; but let not Pharaoh deal deceitfully any more in not letting the people go to sacrifice to the Lord.”

— let not Pharaoh deal deceitfully any more. God’s servants must rebuke even kings when they openly break any of their words; and told the Pharaoh not to deceive them again as he had done before;

30 And Moses went out from Pharaoh and entreated the Lord. — entreat for me; the words seem to be spoken in haste, and with great eagerness and vehemence.

31 And the Lord did according to the word of Moses, and He removed the swarms of flies from Pharaoh, from his servants, and from his people; there remained not one. — there remained not one; the meaning is not, not one swarm of flies, but not one fly, there was not one left;

32 And Pharaoh hardened his heart at this time also, neither would he let the people go. — again, it is after being impressed, and partially relenting, that Pharaoh hardens his own heart.

Exodus (5-6)

•April 25, 2026 • Leave a Comment
Aaron and Moses before Pharaoh

Exodus 5

1 And afterward Moses and Aaron went in and told Pharaoh, “Thus saith the Lord God of Israel: ‘Let My people go, that they may hold a feast unto Me in the wilderness.’”

— let my people go, that they may hold a feast unto me in the wilderness of Sinai or Horeb there, where they might keep it more freely and safely, without being disturbed by outsiders;

And Pharaoh said, “Who is the Lord, that I should obey his voice to let Israel go? I know not the Lord, neither will I let Israel go.”

— that I should obey his voice, to let Israel go? he knew of no superior monarch to him, whose orders he was obliged to obey in any respect, and particularly in this, the dismission of the people of Israel out of land;

— the Targum of Jonathan says,

“And Pharaoh said: ‘The Name of the Lord has not been revealed to me, that I should accept His word to release Israel. I have not found written in the Book of the Angels the Name of the Lord; of Him I am not afraid, and neither will I release Israel.'”

And they said, “The God of the Hebrews hath met with us. Let us go, we pray thee, three days’ journey into the desert and sacrifice unto the Lord our God, lest He fall upon us with pestilence or with the sword.”

— lest he fall upon us with pestilence, or with the sword: this they urge as a reason to have their request granted, taken from the danger they should be exposed unto, should they not be allowed to go and offer sacrifice to God;

— the Targum of Jonathan says,

“And they said: ‘The God of the Jews, His Name has been called upon us. Let us go now a journey of three days into the desert and sacrifice the festival sacrifices before the Lord our God; lest He meet us with death or with the sword.‘”

And the king of Egypt said unto them, “Why do ye, Moses and Aaron, delay the people from their work? Get you unto your burdens!” — wherefore do ye, Moses and Aaron, let the people from their works? The Pharaoh regards the pilgrimage as merely an excuse for a holiday;

— Get you to your burdens; these words were addressed to the Israelites, the elders of whom went with Moses, several others also probably following him, when he went in unto Pharaoh, impatient to see what the end would be.

And Pharaoh said, “Behold, the people of the land now are many, and ye make them rest from their burdens!” — they are already sufficiently numerous; and putting a stop to their labours could unsettle them, and make them dangerous to their masters.

And Pharaoh commanded the same day the taskmasters of the people and their officers, saying, — taskmasters and officers; taskmasters were Egyptians; “officers” (shoterim) supervisors or foremen, were undoubtedly Hebrews.

“Ye shall no more give the people straw to make brick, as heretofore. Let them go and gather straw for themselves. — let them go and gather straw: a mixture of clay, mud and straw; it has been estimated that this requirement would “more than double” the people’s toils;

And the tally of bricks which they made heretofore, ye shall lay upon them; ye shall not diminish any thereof. For they are idle; therefore they cry, saying, ‘Let us go and sacrifice to our God.’ — therefore they cry, let us go and sacrifice to our God;

— suggesting, that this request and cry of theirs did not proceed from a religious principle, or the great veneration they had for their God, but from the sloth and idleness they were addicted to.

Let there more work be laid upon the men, that they may labor therein, and let them not regard vain words.”

— vain words; those of Moses and Aaron, or lying words, which he claimed were vain, or false; that is, that they falsely pretended that their God had commanded them to go and worship, when it was only a crafty design of their own to advance themselves by raising sedition.

10 And the taskmasters of the people went out, and their officers, and they spoke to the people, saying, “Thus saith Pharaoh: ‘I will not give you straw. — and the taskmasters of the people went out of his court, to the respective places where they were set to see that the Israelites did their work;

— and their officers; the officers of the Israelites, who were under the taskmasters, and answerable to them for the work of the people, and their tale of bricks.

11 Go ye, get you straw where ye can find it; yet not any of your work shall be diminished.’” — “Let the work be heavy upon the people, and they shall stick to their work, and not look at lying words.”

12 So the people were scattered abroad throughout all the land of Egypt to gather stubble instead of straw. — to gather stubble instead of straw; straw not being easy to come at, they were obliged to gather stubble that was left in the fields, after the corn was gathered in.

13 And the taskmasters hastened them, saying, “Fulfill your works, your daily tasks, as when there was straw.” — and the taskmasters hasted them; kept them tight and close to their work, and were urgent on them to make quick dispatch of it;

14 And the officers of the children of Israel, whom Pharaoh’s taskmasters had set over them, were beaten and were demanded, “Why have ye not fulfilled your task in making brick both yesterday and today, as heretofore?”

— this makes it clear, not only that the taskmasters and officers were different persons, but that the one were Egyptians appointed by Pharaoh, and the other were Israelites;

— and were demanded, wherefore have ye not fulfilled your task in making brick, both yesterday and today, as before?

15 Then the officers of the children of Israel came and cried unto Pharaoh, saying, “Why dealest thou thus with thy servants? — “Why do you treat your servants like this?”

16 There is no straw given unto thy servants, and they say to us, ‘Make brick!’ And behold, thy servants are beaten, but the fault is in thine own people.” — the Egyptian task-masters, who, by sending us abroad to gather straw, hinder us from doing the work which they require;

— and so they are both unjust and unreasonable. They charge the task-masters, not the king, either in civility and duty, casting his fault upon the instruments; or because they did not know, or at best not believe, that this was the king’s act.

17 But he said, “Ye are idle, ye are idle! Therefore ye say, ‘Let us go and do sacrifice to the Lord.’ — but he said, ye are idle, ye are idle; instead of expressing indignation at the taskmasters, and relieving the officers and the people, he insults them, charging them with sloth and idleness;

— therefore ye say, let us go and do sacrifice to the Lord; suggesting that it was not so much the service and honour of God they regarded, as that they might have a leisure day from work and labour.

18 Go therefore now and work; for there shall no straw be given you, yet shall ye deliver the tally of bricks.”

19 And the officers of the children of Israel saw that they were in evil straits after it was said, “Ye shall not diminish any from your bricks of your daily task.”

— after it was said, ye shall not reduce your bricks of your daily task; after this had been said and confirmed by Pharaoh, they had no hope of being better with them, but looked upon their misfortune as irretrievable.

20 And they met Moses and Aaron, who stood in the way as they came forth from Pharaoh. — when the Israelitish overlookers saw that they were in an evil condition, they came to meet Moses and Aaron, waiting for them as they came out from the king, and reproaching them with only making the circumstances of the people worse.

21 And they said unto them, “The Lord look upon you and judge, because ye have made our savor to be abhorred in the eyes of Pharaoh and in the eyes of his servants, to put a sword in their hand to slay us.”

— a sword . . . to slay us; this the officers may have feared that their inability to enforce the Pharaoh’s impracticable demands would ultimately lead to their execution.

22 And Moses returned unto the Lord and said, “Lord, why hast Thou so evilly treated this people? Why is it that Thou hast sent me? — Moses returned unto the Lord; he could find nothing to say to the officers;

— the course of events had as much disappointed him as it had them. All that he could do was to complain to God, “must I, who hoped to be a blessing, become a scourge to them?”

23 For since I came to Pharaoh to speak in Thy name, he hath done evil to this people; neither hast Thou delivered Thy people at all.” — for since I came to Pharaoh to speak in thy name, the Pharaoh has done more evil to this people, and thus hast not delivered thy people any relief.

Exodus 6

1 Then the Lord said unto Moses, “Now shalt thou see what I will do to Pharaoh; for with a strong hand shall he let them go, and with a strong hand shall he drive them out of his land.”

— now shalt thou see what I will do to Pharaoh: in inflicting punishments on him: for with a strong hand shall he let them go; being forced upon him by the mighty hand of God;

And God spoke unto Moses and said unto him, “I am the Lord. — I am the Lord; that is, יהוה‎ YHVH Yehovah;

And I appeared unto Abraham, unto Isaac, and unto Jacob by the name of God Almighty, but by My name Jehovah was I not known to them. — and I appeared unto Abraham, Isaac and Jacob, by the name of God Almighty, El-Shaddai;

— “but by my name Yehovah was I not known to them?” God’s name is the four-letter Hebrew word יהוה‎ YHVH Yehovah (not Yahweh, since it is only used among the Samaritan communities; and not Jehovah since the letter J wasn’t around but only after the sixteenth century; (more on this at the end)

And I have also established My covenant with them, to give them the land of Canaan, the land of their pilgrimage, wherein they were strangers. — the land of their pilgrimage, wherein they were strangers; not being in actual possession of any part of it, but lived as pilgrims and strangers in it, as their posterity now did in another land not theirs;

And I have also heard the groaning of the children of Israel, whom the Egyptians keep in bondage; and I have remembered My covenant. — that covenent was with Abraham, “Unto thy seed have I given this land, from the river of Egypt [river Nile] unto the great river, the River Euphrates,” Genesis 15:18.

“Moses was to bring the children of Israel into a land ‘between the two rivers’ which I swore to give to Abraham, Isaac, and Jacob” Exodus 6:8.

Therefore say unto the children of Israel: ‘I am the Lord, and I will bring you out from under the burdens of the Egyptians, and I will rid you out from their bondage, and I will redeem you with an outstretched arm and with great judgments.

— and I will redeem you with a stretched out arm; with an arm stretched out from heaven to earth; by the exertion of his almighty power, openly and manifestly displayed in the lighting down of his arm upon the enemies of his people, and in delivering them out of their hands;

And I will take you to Me for a people, and I will be to you a God; and ye shall know that I am the Lord your God, who bringeth you out from under the burdens of the Egyptians. — and I will be to you a God, to be revered by you, and also to be your all-powerful leader, protector and benefactor.

And I will bring you in unto the land, concerning which I swore to give to Abraham, to Isaac, and to Jacob; and I will give it to you for a heritage: I am the Lord.’”

— to give it to Abraham, to Isaac, and to Jacob; where God has authority and power to dispose of lands and kingdoms as he please; and faithful to give them what he had promised.

And Moses spoke so unto the children of Israel, but they hearkened not unto Moses from anguish of spirit and from cruel bondage.

— but they hearkened not unto Moses; being disappointed of deliverance by him, and their afflictions being increased, and lying heavy upon them, they were heartless and hopeless;

10 And the Lord spoke unto Moses, saying, — at another time, and renewed his orders to him to go again to Pharaoh, and require their dismission;

11 “Go in, speak unto Pharaoh king of Egypt, that he let the children of Israel go out of his land.” — the second message was an advance upon the first;

— the first asked only for permission to enter the wilderness, much of which was within the limits of Egypt; the second was a demand that the Israelites should be allowed “to go out of the land.”

12 And Moses spoke before the Lord, saying, “Behold, the children of Israel have not hearkened unto me. How then shall Pharaoh hear me, who am of uncircumcised lips?”

— “uncircumcised” is used, according to the Hebrew idiom, for any imperfection which interferes with efficiency: “slow of speech and of a slow tongue.”

13 And the Lord spoke unto Moses and unto Aaron, and gave them a charge unto the children of Israel and unto Pharaoh king of Egypt to bring the children of Israel out of the land of Egypt.

— this time, no notice is taken of the objection of Moses, having been sufficiently answered before, and Aaron is joined with him in the following charge;

14 These are the heads of their fathers’ houses. The sons of Reuben the firstborn of Israel: Hanoch and Pallu, Hezron and Carmi; these are the families of Reuben.

— this genealogy describes here, to show the lineage of Moses and Aaron, by. whom this great work was to be effected. Only he promiseth in brief the genealogy of his two elder brethren. Reuben and Simeon;

15 And the sons of Simeon: Jemuel and Jamin, and Ohad and Jachin and Zohar, and Shaul the son of a Canaanite woman; these are the families of Simeon.

16 And these are the names of the sons of Levi according to their generations: Gershon and Kohath and Merari; and the years of the life of Levi were a hundred thirty and seven years.

17 The sons of Gershon: Libni and Shimi, according to their families.

18 And the sons of Kohath: Amram and Izhar, and Hebron and Uzziel; and the years of the life of Kohath were a hundred thirty and three years.

19 And the sons of Merari: Mahali and Mushi; these are the families of Levi according to their generations.

20 And Amram took Jochebed, his father’s sister, for a wife; and she bore him Aaron and Moses; and the years of the life of Amram were a hundred and thirty and seven years.

21 And the sons of Izhar: Korah and Nepheg and Zichri.

22 And the sons of Uzziel: Mishael and Elzaphan and Zithri.

23 And Aaron took Elisheba, daughter of Amminadab, sister of Nahshon, for a wife; and she bore him Nadab and Abihu, Eleazar and Ithamar.

24 And the sons of Korah: Assir and Elkanah and Abiasaph; these are the families of the Korahites.

25 And Eleazar, Aaron’s son, took one of the daughters of Putiel for a wife; and she bore him Phinehas; these are the heads of the fathers of the Levites according to their families.

26 These are that Aaron and Moses to whom the Lord said, “Bring out the children of Israel from the land of Egypt according to their armies.” — their armies; this expression is used here of the Israelites for the first time. It seems to refer to that organisation, of a quasi-military character,

— which was given to the people by the order of Moses during the long struggle with Pharaoh, and which enabled them at last to quit Egypt, not a disorderly mob, but “harnessed,” or “in military array” (Exodus 13:18). The expression is repeated in Exodus 7:4, 12:17, 12:51.

27 These are they who spoke to Pharaoh king of Egypt to bring out the children of Israel from Egypt. These are that Moses and Aaron. — this emphatic repetition shows the reason for inserting the genealogy;

— the names of Moses and Aaron are given twice and in a different order; probably to mark Aaron as the older in the genealogy, to denote the leadership of Moses.

28 And it came to pass on the day when the Lord spoke unto Moses in the land of Egypt, — and it came to pass indicates a time gap;

29 that the Lord spoke unto Moses, saying, “I am the Lord. Speak thou unto Pharaoh king of Egypt all that I say unto thee.” — speak thou unto Pharaoh king of Egypt all that I say unto thee; that he let Israel go;

— and that in case of refusal, that he would punish him and his people with this and the other plague, one after another, and at last slay him and their firstborn.

30 And Moses said before the Lord, “Behold, I am of uncircumcised lips, and how shall Pharaoh hearken unto me?” — of uncircumcised lips; as he had done, Exodus 6:13, and this is only a repetition of what is there said, in order to lead on to what is related in the following chapter.

~~ v3above ~~

More on God’s name, Yehovah.

God’s name is the four-letter Hebrew word יהוה‎ YHVH Yehovah, which are embedded in the Masoretic text over 6000 times, yet when translated into our English language most had been translated as Lord, or LORD, which are titles, but not his name. His name is יהוה‎ Yehovah, or YEHOVAH (but there are no capital letters in Hebrew).

It wasn’t until 1524 that Gian Giorgio Trissino, an Italian Renaissance grammarian, invented the letter J that this new letter started to take a hold in the writings of western Europe. Even in 1611 when the English Bible the King James has our subject of study by the prophet Jeremiah, he was known as Ieremiah. So Jehovah is a very late comer.

The following verses with the LORD erred in translation. His name Yehovah should be used:

I am the LORD; that is My name. And My glory will I not give to another, neither My praise to graven images. Isaiah 42:8

And it shall come to pass, that whosoever shall call on the name of the LORD shall be delivered; for in Mount Zion and in Jerusalem shall be deliverance, as the LORD hath said, and in the remnant whom the LORD shall call. Joel 2:32

“I am sought of them that asked not for Me; I am found of them that sought Me not. I said, ‘Behold Me, behold Me,’ unto a nation that was not called by My name. Isaiah 65:1

When we call our God, the LORD, we err, because his name is not the LORD, which is a title. His name is YEHOVAH! May We all ask for his forgiveness, and may Our merciful God forgive us all.

Is OpenAI going bankrupt?

•April 24, 2026 • Leave a Comment

OpenAI is burning billions — and an IPO won’t stave off bankruptcy

OpenAI’s business doesn’t begin to cover its costs, meaning it could be forced to file for bankruptcy as early as 2027

AsiaTimes • April 24, 2026 ~ TheConversation

OpenAI, the creator of ChatGPT, is gearing up to launch its initial public offering (IPO) this year. This financial maneuver would represent a pivotal shift for a project originally designed for the “common good” towards a market-driven logic.

Established in 2015, OpenAI started out amidst growing anxiety regarding artificial intelligence (AI). Founded by Sam Altman and Elon Musk, the tech company adopted a non-profit structure and made no secret of its goal to develop AI that is “beneficial to humanity” and prevent it from remaining in the hands of a few dominant players.

This ambition distinguished it from tech giants like Google, Microsoft, Meta, and Amazon, which were built on proprietary models and rent-seeking effects.

In contrast, OpenAI intended to champion general public interest by emphasising open research and sharing knowledge. However, this orientation – symbolized by its name – quickly collided with a structural constraint: the astronomical cost of generative AI.

Massive costs

Unlike traditional software, where marginal costs tend towards zero (for example, the millionth copy of Windows costs Microsoft nothing), generative AI requires massive infrastructure.

Every interaction mobilises computing resources, energy, and specialised equipment. A standard ChatGPT query, consisting of one question and one answer, costs between $0.01 and $0.10.

Similarly, generating a high-definition image can cost between $0.10 and $0.20. While these amounts seem negligible in isolation, they become staggering when scaled to the billions of daily queries seen in 2026.

This is explained by the underlying infrastructure, particularly the Graphics Processing Units (GPUs) supplied by players like Nvidia. These chips can cost tens of thousands of dollars to purchase and several dollars per hour via cloud access.

OpenAI, like its competitors, depends on tens of thousands of these GPUs running continuously in massive data centers. According to some estimates,the necessary investments will reach hundreds of billions by the end of this decade.

As early as the late 2010s, it became clear that a purely non-profit model could not meet such capital intensity. This is why OpenAI adopted a hybrid status in 2019, allowing it to raise funds while maintaining control through a foundation. It was a first foray into the market economy, albeit one tempered by the ambition to resist investor demands.

Brutal acceleration with ChatGPT

However, at the end of 2022, the chatbot ChatGPT radically changed the game, attracting 100 million users in just two months, before surpassing 900 million weekly users by early 2026.

OpenAI’s revenue surged from approximately $200 million in 2022 to over $10 billion in 2025 – a 60-fold increase in three years.

This exponential growth was accompanied by the implementation of a business model with multiple revenue streams. For individuals, OpenAI offers paid subscriptions (ranging from $20 to $200 per month).

However, the bulk of the revenue comes from enterprises, via subscriptions priced between $25 and $60 per user per month. A company with 10,000 employees thus represents several million dollars in annual revenue.

Corporate money

OpenAI additionally bills for the use of its models by companies that integrate them directly into their own solutions. Every use is metered, often on a massive scale. An application processing a million queries a day can generate tens of thousands of dollars in monthly billing.

Finally, a growing portion of revenue comes from strategic agreements, notably with Microsoft, which integrates OpenAI technologies into its products under the Copilot brand.

It is the sum of these flows – subscriptions, licenses, third-party usage, and partnerships – that allowed OpenAI to reach approximately $1 billion in monthly revenue in 2025. Yet, this commercial rise masks an intrinsic economic fragility.

A gigantic cash-burning machine

Despite sharply rising revenues, OpenAI remains structurally loss-making. In the first half of 2025, the company reportedly generated approximately $4.3 billion in revenue while recording losses between $7 billion and $13 billion – more than $2 billion in losses every month. In total, cumulative losses could exceed $140 billion between 2024 and 2029.

This drift is explained by the very nature of OpenAI’s business model, where every interaction incurs a cost alongside gargantuan necessary investments. Beyond infrastructure, Research and Development (R&D) is a major expense.

To stay in the technological race against an increasingly competitive environment, OpenAI reportedly invested nearly $16 billion in R&D in 2025 alone.

To this is added the cost of human resources, which is sometimes extraordinary. While base salaries for the most in-demand AI experts range from $250,000 – $700,000 per year, their total compensation – including stock and bonuses – frequently exceeds $1 million. In some cases, annual compensation even exceeds $10 million.

Here again, bidding wars from competitors like Meta force OpenAI to match these offers for fear of seeing its key talent vanish.

Nearing bankruptcy?

In short, OpenAI’s business is not enough to cover its costs, to the point that some analysts suggest that at this rate, it could be forced to file for bankruptcy as early as 2027. Recourse to external financing is therefore indispensable to cover these losses.

To sustain its growth, OpenAI has already raised approximately $58 billion since its inception, including more than $13 billion from Microsoft. In 2025, an exceptional funding round reportedly raised up to $40 billion more, pushing its valuation to several hundred billion dollars.

At the end of March 2026, a new $122 billion funding round – notably involving Amazon ($50 billion), Nvidia, and SoftBank ($30 billion each) – brought the valuation to $852 billion. Yet, these amounts remain insufficient given the requirements.

Industrial dependency

Dependency on industrial partners appears particularly problematic. Microsoft provides OpenAI with its cloud infrastructure via Azure, while Nvidia plays a key role upstream by providing GPUs.

Much like the Gold Rush era, when shovel sellers grew rich at the expense of prospectors, it is the infrastructure providers in the AI sector making a fortune, not the model designers.

In practice, every AI query generates revenue for infrastructure providers, amounting to a form of “invisible tax” captured upstream.

In 2025, Nvidia generated nearly $73 billion in net profit on approximately $130 billion in revenue, and its stock market valuation is 1.5 times higher than the entire Paris stock exchange!

Governance missteps

OpenAI’s economic tensions have spilled over into its corporate governance. The hybridization of a public interest mission with private financing mechanisms resulted in a complex structure.

A non-profit foundation controls a for-profit “public benefit corporation,” which is funded by investors and tasked with raising capital and developing activities – all while theoretically remaining subordinate to the foundation’s public interest mission. This construction, designed to avoid purely financial logic, quickly fuelled tensions between different stakeholders.

Elon Musk’s departure in 2018 was the first signal of a strategic disagreement. In 2020, several researchers left OpenAI to found Anthropic, citing differences over safety and governance.

However, it was primarily the crisis of November 2023 that fully revealed the system’s fragilities, when the board of directors suddenly announced the firing of Sam Altman, citing a lack of transparency in his communications.

Within hours, the situation spiralled into an open crisis. Nearly all employees threatened to leave the company if Altman was not reinstated. Microsoft, the main partner and investor, publicly supported Altman and even discussed the possibility of hiring him and his teams.

Faced with this pressure, the board was forced to reverse its decision within days. Sam Altman was reinstated, and the board’s composition was profoundly overhauled. This episode highlighted internal tensions, specifically the difficulty of making divergent logics coexist within the same company: ethical posturing, industrial imperatives and investor demands.

Intensifying competition

In addition to these internal constraints, competitive intensity is particularly fierce.

Google, the inventor of generative AI, is making rapid progress with Gemini. Anthropic, with Claude, has established itself in certain segments, particularly programming, while emphasizing safety.

China’s DeepSeek has claimed to use less expensive processors. France’s Mistral AI advocates for a frugal approach and European digital sovereignty. In a sign of this shifting landscape, Apple which initially partnered with OpenAI to include ChatGPT for certain Siri features – has chosen to replace it with Gemini.

In this context of ecosystem reorganisation, OpenAI’s position, while still central, is being challenged. Intensifying competition reinforces the need for ever-greater financial resources.

The stock market: lifeline or mirage?

OpenAI’s initial public offering (IPO) is presented as a response to these constraints: a way to fund massive investments and consolidate a weakened competitive position.

An IPO could raise between $50 billion and $100 billion by selling 10% to 20% of the capital. Such an operation would constitute one of the largest in the history of financial markets.

However, this transformation involves delicate trade-offs. A listed company is subject to profitability and transparency requirements that may clash with the experimental nature of artificial intelligence. Added to this is the persistent dependence on Microsoft and Nvidia, which limits the company’s strategic autonomy.

Most importantly, there is no indication that an IPO would suffice to resolve OpenAI’s structural problems. At best, without a significant shift in the business model, it would only delay its bankruptcy by a few years.

The economic model of generative AI remains fundamentally unstable today.

A question beyond OpenAI

Beyond the case of OpenAI, one can legitimately question the current functioning of an economy dominated by tech giants.

Artificial intelligence is establishing itself as an essential infrastructure whose effects far exceed the economic sphere. For some analysts, control over AI now carries the same geostrategic importance as the possession of nuclear weapons.

Consequently, a civilizational question arises: can we entrust the development and direction of such a technology solely to financial markets? Can we imagine Elon Musk or Mark Zuckerberg personally owning the equivalent of one or more atomic bombs?

OpenAI’s IPO will not provide the answer alone. However, it will constitute one of the first large-scale tests.

Exodus (3-4)

•April 24, 2026 • Leave a Comment

Exodus 3

1 Now Moses kept the flock of Jethro his father-in-law, the priest of Midian; and he led the flock to the back side of the desert and came to the mountain of God, even to Horeb.

— Horeb; also called Sinai, Exodus 19:1; that is, “dry,” “desert,” was the general name for the mountainous district in which Mount Sinai is situated;

— mountain of God; so named either according to Hebrew idiom from its great height, as “great mountains,” Hebrew, “mountains of God” (Ps 36:6); “goodly cedars,” Hebrew, “cedars of God” (Ps 80:10);

And the angel of the Lord appeared unto him in a flame of fire out of the midst of a bush; and he looked and, behold, the bush burned with fire, and the bush was not consumed. — the “angel of the Lord” is certainly not “the Lord” hence he is an angel;

— as the Targum of Jonathan reveals,

“And Zagnugael, the angel of the Lord, revealed himself to him in flames of fire from the midst of the bush; and he looked, and behold, the bush burned with fire, yet the bush was not burnt or consumed by the fire.”

— but sometimes the Son appears as an angel: Malakh or messenger; hence this being in the fire could be a created angel or he could be the Son;

And Moses said, “I will now turn aside and see this great sight, why the bush is not burnt.”

And when the Lord saw that he turned aside to see, God called unto him out of the midst of the bush and said, “Moses, Moses.” And he said, “Here am I.”

— the name of the Lord, יהוה, is comprised of 3 different letters that form the words for;

‘was’, היה, PAST
‘is’, הוה PRESENT
‘will be’, יהיה FUTURE

— as the Targum of Jonathan reveals,

“And it was revealed before the Lord that he [Moses] had turned to see; and the Lord called to him from the midst of the bush and said, ‘Moses, Moses!’ And he said, ‘Here am I.'”

And He said, “Draw not nigh hither. Put off thy shoes from off thy feet, for the place whereon thou standest is holy ground.”

— the Targum of Jonathan reveals Moses mission,

“And He said, ‘Do not draw near to here; remove your sandal from your foot, for the place upon which you are standing is a holy place; and upon it you are destined to receive the Torah to teach it to the children of Israel.'”

Moreover He said, “I am the God of thy father, the God of Abraham, the God of Isaac, and the God of Jacob.” And Moses hid his face, for he was afraid to look upon God.

— many commentators mistakenly identify this Being “the Lord” is the Son; but more events that followed were to revealed (regarding the Temple, even the Son says this is my Father’s House, not the Son’s; and as such the Being in the Holy of Holies, accepting the sacrificial blood sprinkled upon the Mercy Seat during the Day of Atonement) this Being is certainly the Father;

— the Targum of Jonathan says,

“And He said: ‘I am the God of your father, the God of Abraham, the God of Isaac, and the God of Jacob.’ And Moses hid (covered) his face, for he was afraid to look upon the brilliance of the glory of the Shekhinah (Divine Presence) of the Lord.”

And the Lord said, “I have surely seen the affliction of My people who are in Egypt, and have heard their cry by reason of their taskmasters, for I know their sorrows. — and have heard their cry, by reason of their taskmasters; who were set over them to see that they did their work;

— and to lay heavy burdens and afflict them by all manner of ways they could devise; who abused and beat them for not doing what was not to be done, which made them cry out because of their barbarous usage of them, and cry unto God for help and deliverance.

And I have come down to deliver them out of the hand of the Egyptians, and to bring them up out of that land unto a good land and a large, unto a land flowing with milk and honey, unto the place of the Canaanites and the Hittites, and the Amorites and the Perizzites, and the Hivites and the Jebusites.

— the enumeration of the nations here mentioned are only six of the ten whose land was promised to Abraham (Genesis 15:19-21) being expressly mentioned. One, however, that of the Hivites, is added;

— but the “the Kenites and the Kenizzites and the Kadmonites,” were not mentioned here; perhaps they, being the children of Esau, over four hundred years later, had already moved to Spain; for a more indepth study of Esau or Edom, see Obadiah;

Now therefore behold, the cry of the children of Israel hath come unto Me, and I have also seen the oppression wherewith the Egyptians oppress them. — and I have also seen the oppression wherewith the Egyptians oppress them; which is repeated to emphasis he took of their suffering;

10 Come now therefore, and I will send thee unto Pharaoh, that thou mayest bring forth My people, the children of Israel, out of Egypt.” — to deliver them out of the hand of the Egyptians, and to bring them up to a good and broad land, to the place of the Canaanites;

11 And Moses said unto God, “Who am I, that I should go unto Pharaoh, and that I should bring forth the children of Israel out of Egypt?”

— who am I, that I should go? the men most fit for great missions are apt to deem themselves unfit. When God called Jeremiah to be a prophet, his reply was, “O Lord God! Behold, I cannot speak, for I am a child” (Jeremiah 1:6).

12 And He said, “Certainly I will be with thee; and this shall be a token unto thee that I have sent thee: when thou hast brought forth the people out of Egypt, ye shall serve God upon this mountain.”

— God replies – “Thou wilt not be unfit, since I will be with thee – I will supply thy deficiencies;

13 And Moses said unto God, “Behold, when I come unto the children of Israel and shall say unto them, ‘The God of your fathers hath sent me unto you,’ and they shall say to me, ‘What is His name?’ what shall I say unto them?”

— what is his name; the meaning of this question is evidently: “By which name shall I tell them that the promise is confirmed?”

— Israel’s God had had no name that could be called a proper name more than any other. He had been known as “El,” “the High;” “Shad-dai,” “the Strong;” and “Yehovah,” “the Existent;” but these terms had all been felt to be descriptive epithets, and none of them had passed as yet into a proper name.

14 And God said unto Moses, “I Am That I Am.” And He said, “Thus shalt thou say unto the children of Israel, ‘I Am hath sent me unto you.’” — the name of the Lord, יהוה, is comprised of 3 different letters that form the words for;

‘was’, היה, PAST
‘is’, הוה PRESENT
‘will be’, יהיה FUTURE

— the true meaning of the Hebrew, אהיה אשׁר אהיה, ’Ehyeh ’ăsher ’ehyeh: Yehovah promises that He will be, to Moses and His people, what He will be—something which is undefined;

— thus shalt thou say unto the children of Israel, I AM hath sent me unto you; or as the Targum of Jonathan has it, “I am he that is, and that shall be.”

15 And God said moreover unto Moses, “Thus shalt thou say unto the children of Israel: ‘The Lord God of your fathers, the God of Abraham, the God of Isaac, and the God of Jacob hath sent me unto you.’ This is My name for ever, and this is My memorial unto all generations.

— the Lord God of your fathers; Hebrew, Yehovah, God of your fathers. The “I AM” of the preceding verse (‘ehyeh) is modified here into Yehovah, by a substitution of the third person for the first. The meaning of the name remains the same;

— lastly, God’s name in Hebrew is the four-letter Hebrew word יהוה‎ YHVH Yehovah (not Jehovah since the letter J wasn’t around but only after the sixteenth century);

16 Go, and gather the elders of Israel together, and say unto them, ‘The Lord God of your fathers, the God of Abraham, of Isaac, and of Jacob appeared unto me, saying, “I have surely visited you and seen that which is done to you in Egypt;

— the elders; either by age, or rather by office and authority. For though they were all slaves to the Egyptians, yet among themselves they retained some order and government, and had doubtless some whom they owned as their teachers and rulers, or heads of tribes and families;

17 and I have said I will bring you up out of the affliction of Egypt unto the land of the Canaanites and the Hittites, and the Amorites and the Perizzites, and the Hivites and the Jebusites, unto a land flowing with milk and honey.”’ — the same 6 tribes as mentioned in verse 8 above;

18 And they shall hearken to thy voice; and thou shalt come, thou and the elders of Israel, unto the king of Egypt, and ye shall say unto him, ‘The Lord God of the Hebrews hath met with us; and now let us go, we beseech thee, three days’ journey into the wilderness, that we may sacrifice to the Lord our God.’

— Moses does not confront Pharaoh as an isolated prophet but as the spokesperson of a unified leadership: they; the elders of Israel, and they appeared to be persuaded more unified in voice.

19 And I am sure that the king of Egypt will not let you go, no, not by a mighty hand. — no, not by a mighty hand; rather, not even under a mighty hand. Pharaoh, even when chastised by God’s mighty hand, will not voluntarily permit of their departure;

20 And I will stretch out My hand and smite Egypt with all My wonders which I will do in the midst thereof; and after that he will let you go. — and God will stretch out his hand; or he would exert his almighty power; and that God might show his power upon Pharaoh;

— and smite Egypt with all my wonders, which I will do in the midst thereof: with those wondrous plagues, the amazing effects of his almighty power, which were wrought by him in the midst of Egypt, by which their land, their rivers, their persons, and their cattle, were smitten;

— and after that he will let you go; this is said for their encouragement, that their faith and patience might hold out, who otherwise seeing him so obstinate and inflexible, might be ready to despair of ever succeeding.

21 And I will give this people favor in the sight of the Egyptians. And it shall come to pass that, when ye go, ye shall not go empty, — not only will the Egyptians then let the Israelites go, but God will give them favour in the eyes of the Egyptians, and they will bestow many valuables upon them.

22 but every woman shall borrow of her neighbor and of her that sojourneth in her house jewels of silver and jewels of gold and raiment; and ye shall put them upon your sons and upon your daughters, and ye shall despoil the Egyptians.”

— Egypt had spoiled Israel by the tributary labour so unjustly, and now Israel carried off the spoil of Egypt-a prelude to the victory which the people of God will one day obtain in their conflict with the power of the world;

— oppressed, wronged, down-trodden, miserably paid for their hard labour during centuries, the Israelites were to obtain at the last something like a compensation for their ill-usage; the riches of the Egyptians were to be showered on them.

Exodus 4

1 And Moses answered and said, “But, behold, they will not believe me, nor hearken unto my voice; for they will say, ‘The Lord hath not appeared unto thee.’” — they will say, The Lord hath not appeared; it is very probable that the people would have said this if Moses had not had any credentials to produce;

— this on the background that they had been no appearance of God to any one for over two hundred years in Egypt; and the Israelites, who had not seen Moses for forty years, would not know whether he was a veracious person or not;

And the Lord said unto him, “What is that in thine hand?” And he said, “A rod.”

— a rod; the word seems to denote the long staff, from three to six feet in length; such as shepherds use in the management of their flocks, for Moses was now feeding the flock of his father-in-law. It was usually made of acacia wood.

And He said, “Cast it on the ground.” And he cast it on the ground, and it became a serpent; and Moses fled from before it. — it changed into a fiery serpent; whereby it was intimated and frightful what and how pernicious his rod should be to the Egyptians.

And the Lord said unto Moses, “Put forth thine hand and take it by the tail.” And he put forth his hand and caught it, and it became a rod in his hand— — the tail was the dangerous part; whereby God would try Moses’s faith, and prepare him for the approaching difficulties.

“that they may believe that the Lord God of their fathers, the God of Abraham, the God of Isaac, and the God of Jacob hath appeared unto thee.”

— that they may believe; the sign was to convince the Israelites, in the first instance, and cause them to accept the mission of Moses. It was afterwards to be exhibited before Pharaoh, to try him and prove him, but not to convince him.

And the Lord said furthermore unto him, “Put now thine hand into thy bosom.” And he put his hand into his bosom; and when he took it out, behold, his hand was leprous as snow. — and when he took it out, behold, his hand was a leprosy of the white sort, the worst and most difficult to be cured;

And He said, “Put thine hand into thy bosom again.” And he put his hand into his bosom again and plucked it out of his bosom, and behold, it was turned again as his other flesh.

— it was turned again as his other flesh; the inflicting of this disease, and curing it in an instant, was so much the greater miracle, as the leprosy is a disease generally reckoned incurable by any human;

“And it shall come to pass, if they will not believe thee, neither hearken to the voice of the first sign, that they will believe the voice of the latter sign.

— that they will believe the voice of the latter sign; which had a voice in it commanding belief that he was a messenger of God; the first sign respects his rod, the other his hand, a miracle with leprosy.

And it shall come to pass, if they will not believe also these two signs, neither hearken unto thy voice, that thou shalt take of the water of the river and pour it upon the dry land; and the water which thou takest out of the river shall become blood upon the dry land.”

— and pour it upon the dry land, and the water which thou takest out of the river shall become blood upon the dry land; by which it would appear how easily the Lord could destroy the land of Egypt, and make it a barren land;

10 And Moses said unto the Lord, “O my Lord, I am not eloquent, neither heretofore nor since Thou hast spoken unto Thy servant; but I am slow of speech and of a slow tongue.”

— I am not eloquent; not able to deliver thy message acceptably and decently, either to Pharaoh or to the Israelites.

11 And the Lord said unto him, “Who hath made man’s mouth? Or who maketh the dumb or deaf, or the seeing or the blind? Have not I, the Lord? — God could and would have cured the defect in Moses’ speech, whatever it was;

— could and would have added eloquence to his other gifts, if he had even at this point yielded himself up unreservedly to his guidance and heartily accepted his mission; nothing is too hard for the Lord. He gives all powers – sight, and hearing, and speech included – to whom he will.

12 Now therefore go, and I will be with thy mouth and teach thee what thou shalt say.” — by my Spirit to direct and assist thee what and how to speak. Whence Moses, though he still seems to have remained slow in speech, yet was in truth mighty in words as well as deeds, Acts 7:22.

13 And he said, “O my Lord, send, I pray Thee, by the hand of him whom Thou wilt send.” — send by whom thou wilt send, by any but me; hence the anger of the Lord was kindled;

14 And the anger of the Lord was kindled against Moses, and He said, “Is not Aaron the Levite thy brother? I know that he can speak well. And also, behold, he cometh forth to meet thee; and when he seeth thee, he will be glad in his heart.

— Aaron; this is the first mention of Aaron; the words “he can speak well,” probably imply that Aaron had both the power and will to speak;

— he cometh forth to meet thee, by my instigation and direction; which, because I see thou art still diffident, I give thee for a new sign to strengthen thy belief that I will carry thee through this hard work.

15 And thou shalt speak unto him and put words in his mouth; and I will be with thy mouth and with his mouth, and will teach you what ye shall do.

— I will be with thy mouth and with his mouth; Even Aaron that could speak well, yet could not speak to purpose, unless God were with his mouth; without the constant aids of divine guidance, the best gifts will fail.

16 And he shall be thy spokesman unto the people; and he shall be, even he shall be to thee instead of a mouth, and thou shalt be to him instead of God. — instead of God; God did not speak to Aaron directly, but only through Moses;

— Aaron was to recognise in Moses God’s mouthpiece, and to consider what Moses told him as coming from God. Moses had still, therefore, the higher position.

17 And thou shalt take this rod in thine hand, wherewith thou shalt do signs.” — take this rod; the staff or crook he carried as a shepherd, that “This rod must be his staff of authority, and must be to him instead of either the sword or sceptre.

18 And Moses went and returned to Jethro his father-in-law, and said unto him, “Let me go, I pray thee, and return unto my brethren who are in Egypt and see whether they are yet alive.” And Jethro said to Moses, “Go in peace.”

— Jethro said, Go in peace; Jethro’s character is altogether one of which kindness and understanding are his main elements.

19 And the Lord said unto Moses in Midian, “Go, return into Egypt; for all the men are dead who sought thy life.” — all the men which sought thy life; as forty years had elapsed, and not only the Pharaoh, but the kindred of the murdered man, and the officials empowered by the Pharaoh to arrest Moses.

20 And Moses took his wife and his sons, and set them upon an ass, and he returned to the land of Egypt. And Moses took the rod of God in his hand.

— the Targum of Jonathan says,

“And Moses took his wife and his sons and mounted them upon the donkey and returned to the land of Egypt; and Moses took the staff which he had taken from the garden of his father-in-law.

“It was made of sapphire from the Throne of Glory, its weight was forty seahs, and upon it was engraved and explicitly written the Great and Glorious Name [of God], and by it the miracles were performed from before the Lord by his hand.”

21 And the Lord said unto Moses, “When thou goest to return into Egypt, see that thou do all those wonders before Pharaoh which I have put in thine hand; but I will harden his heart, that he shall not let the people go.

— but I will harden his heart, that he shall not let the people go; that is, not directly, not for some time, not until all the wonders are wrought, and plagues inflicted to bring him to it;

22 And thou shalt say unto Pharaoh, ‘Thus saith the Lord: Israel is My son, even My firstborn.

23 And I say unto thee, “Let My son go, that he may serve Me.” And if thou refuse to let him go, behold, I will slay thy son, even thy firstborn.’” — Israel is my son, even my firstborn; as dear to him as a man’s firstborn is, or as his only son;

24 And it came to pass, on the way at the inn, that the Lord met him and sought to kill him. — the Lord met him; both the Septuagint and the Targum, say “an angel of the Lord;“

— the Targum of Jonathan says,

“And it was on the way, at the lodging place, that an angel of the Lord met him and sought to kill him on account of Gershom his son; because he had not been circumcised, due to the business of Jethro his father-in-law, who had not allowed him to circumcise him. However, Eliezer had been circumcised by the condition that both of them had agreed upon.”

25 Then Zipporah took a sharp stone and cut off the foreskin of her son, and cast it at his feet and said, “Surely a bloody husband art thou to me.” — Zipporah took a sharp stone; she perceived, it seems, the danger of her husband;

— and he being disabled from performing the office, whether by some stroke of affliction, or the terror of so dreadful and unexpected an appearance, and a delay in a matter of such moment being dangerous, she performed the work herself;

— a bloody husband art thou to me; some think she spake to the child, whom she calls her spouse, as some late rabbins affirm the infant used to be called, when it was circumcised;

26 So He let him go; then she said, “A bloody husband thou art, because of the circumcision.” — so he let him go; God let Moses go, allowed him to recover; accepted Zipporah’s act as sufficient, albeit tardy, reparation, and spared the life of her husband.

27 And the Lord said to Aaron, “Go into the wilderness to meet Moses.” And he went and met him on the mount of God, and kissed him.

— the scene suddenly shifts. Moses is left in the wilderness to recover his strength and make such arrangements with respect to his wife and children as he thinks best under the circumstances.

28 And Moses told Aaron all the words of the Lord who had sent him, and all the signs which He had commanded him. — Aaron met him in the mount of God, and kissed him; after a separation of forty years, their meeting would be mutually happy.

29 And Moses and Aaron went and gathered together all the elders of the children of Israel. — all the elders; the Israelites retained their own national organization; their affairs were administered by their own elders, who called a public assembly Exodus 4:31 to hear the message brought by Moses and Aaron.

30 And Aaron spoke all the words which the Lord had spoken unto Moses, and did the signs in the sight of the people.

— Aaron did the signs; by the direction from Moses; hereby full proof was given to the people of the divine mission of Moses and their concurrence was gained before he applied to Pharaoh in their behalf.

31 And the people believed; and when they heard that the Lord had visited the children of Israel, and that He had looked upon their affliction, then they bowed their heads and worshiped. — then they bowed their heads, and worshipped;

— expressing their thankfulness for the notice he took of them, and signifying their readiness to obey all instructions and directions that should be given them.

Exodus (1-2)

•April 23, 2026 • Leave a Comment

The two hundred and ten years of Israel’s stay in Egypt were divided into two unequal periods, in the former and longer of which they were prosperous and favoured, while in the latter they were oppressed. Both periods had their uses and place in the shaping of the nation and its preparation for the Exodus.

Exodus 1

1 Now these are the names of the children of Israel who came into Egypt; every man and his household came with Jacob: — every man and his household came with Jacob; into Egypt, all excepting Joseph, and along with them their families, wives, children, and servants;

— though wives and servants are not reckoned into the number of the seventy, only such sons as came out of Jacob’s loins:

— the Targum of Jonathan says, “each with the men of his house,” as only male children were meant, the sons of Jacob and his grandsons;

Reuben, Simeon, Levi and Judah, — Reuben, Simeon, Levi, and Judah. The first sons of Jacob by Leah;

— the sons are arranged according to their mothers, as in Genesis 35:23-26, and the sons of the two maid-servants stand last. Leah has precedence over Rachel; Bilhah over Zilpah.

Issachar, Zebulun and Benjamin, —and Benjamin; who, though youngest of all, is placed before Dan, Naphtali, Gad and Ashe; because they were the children of the maidens.

Dan and Naphtali, Gad and Asher. — the children of each wife and concubine are given in order of seniority. The omission of Joseph from the list is explained in the last clause of Exodus 1:5.

And all the souls who came out of the loins of Jacob were seventy souls, for Joseph was already in Egypt. — on the number 70, in which Jacob is included; but not Joseph;

— seventy souls; Jacob himself, 1; his sons, 12; his daughter, Dinah, 1; his grandsons, 51; his grand-daughter Serah, 1; his great-grandsons, 4—Total, 70. His daughters, except Dinah, and his sons’ daughters, except Serah, spoken of in Genesis 46:7, are not included;

— if his female descendants were, at the time of his descent into Egypt, as numerous as the males, the entire number of those who “came out of his loins” could have been somewhere 132.

And Joseph died, and all his brethren, and all that generation. — Plant by plant the leaves drop, and the stem rots and its place is empty.

And the children of Israel were fruitful and increased abundantly, and multiplied, and waxed exceeding mighty; and the land was filled with them. — Seed by seed the tender green spikelets pierce the mould, and the field waves luxuriant in the breeze and the sunshine.

Now there arose up a new king over Egypt, who knew not Joseph. — “a new king” is a phrase not found elsewhere; perhaps to imply that he did not succeed his predecessor in the natural order of descent and inheritance;

— he “arose up over Egypt,” occupying the land, as if on different terms from the previous king whose place he took, either by usurpation or conquest.

And he said unto his people, “Behold, the people of the children of Israel are more and mightier than we. — “his people” no doubt they were his nobles, or, at any rate, his courtiers;

— ancient Egypt must have had a population of seven or eight millions, which would imply nearly two millions of adult males, whereas the adult male Israelites, near a century later, were no less than six hundred thousand (Exodus 12:37).

10 Come on, let us deal wisely with them, lest they multiply and it come to pass, when there befalleth any war, that they join also unto our enemies and fight against us, and so get them up out of the land.” — let us deal wisely; instead of open force, the king proposes stratagem;

— he thinks that he has hit upon a wise scheme, a clever plan, by which the numbers of the Israelites will be kept down, and they will cease to be formidable. The nature of the plan appears inthe next verse.

11 Therefore they set over them taskmasters to afflict them with their burdens. And they built for Pharaoh treasure cities, Pithom and Raamses. — Raamses is a place different from Ramesses, Genesis 47:11 and had its name from the then reigning Pharaoh, Ramesses Miamun;

— Raamses; Pi-Ramesu, the city of Rameses, was the ordinary seat of the Court during the earlier part of the nineteenth dynasty. It appears to have been a new name for Tanis, or for a suburb of Tanis, which overshadowed the old city;

— the Targum of Jonathan says

And they set over them work-masters to afflict them in their servitude; and they builded walled cities to become Pharoh’s treasure-places, Tanis and Pilusin.

12 But the more they afflicted them, the more they multiplied and grew; and they were grieved because of the children of Israel. — and they were grieved because their schemes for lessening them did not succeed; they were as thorns in their eyes;

13 And the Egyptians made the children of Israel to serve with rigor. — with rigour; forced labour of a very severe character; from morning to night under the rod of a task-master, which was freely applied to their legs or backs, if they rested their weary limbs for a moment.

14 And they made their lives bitter with hard bondage, in mortar and in brick and in all manner of service in the field; all their service wherein they made them serve was with rigor.

— all their service wherein they made them serve was with rigour; they not only put them to hard work, but used them in a very churlish manner, abusing them with their tongues, beating them with their hands;

15 And the king of Egypt spoke to the Hebrew midwives, of whom the name of one was Shiphrah, and the name of the other Puah. — Hebrew midwifes; or “midwives of the Hebrew women.”

— the Targum of Jonathan reveals another dream of the Pharaoh, saying

“And Pharaoh said: While I was sleeping, I saw in my dream, and behold, all the land of Egypt stood in one scale of a balance, and a young lamb was in the other scale of the balance; and the scale with the lamb in it outweighed [the other].

“Immediately, he sent and called all the magicians of Egypt and recounted his dream to them. Straightway, Jannes and Jambres, the chiefs of the magicians, opened their mouths and said to Pharaoh: ‘A certain son is destined to be born in the congregation of Israel, by whose hand all the land of Egypt is destined to be destroyed.’

“And because of this, Pharaoh, king of Egypt, took counsel against the Jewish midwives, the name of one being Shiphrah—she is Jochebed—and the name of the second Puah—she is Miriam, her daughter.”

16 And he said, “When ye do the office of a midwife to the Hebrew women and see them upon the birthstools, if it be a son then ye shall kill him; but if it be a daughter then she shall live.”

— if it be a son, then ye shall kill him; opinions are divided, however, what was the method of destruction which the king did recommend; short-term thinking: for he feared not them, but the males only;

17 But the midwives feared God, and did not do as the king of Egypt commanded them, but saved the men children alive. — but the midwives feared God; their faith inspired them with such courage as to risk their lives, by disobeying the mandate of a cruel tyrant;

18 And the king of Egypt called for the midwives and said unto them, “Why have ye done this thing, and have saved the men children alive?”

19 And the midwives said unto Pharaoh, “Because the Hebrew women are not as the Egyptian women; for they are lively, and are delivered ere the midwives come in unto them.”

— for they are lively; they are vigorous; a large proportion of the women deliver themselves; and the services of professional accoucheurs are very rarely called upon; or that they gave birth to their children before the midwives arrived.

20 Therefore God dealt well with the midwives, and the people multiplied and waxed very mighty. — God dealt well with the midwives; this represents God as rewarding them for keeping their faith.

21 And it came to pass, because the midwives feared God, that He made them houses. — that he made them houses; making houses for them, being moved by the Lord, to preserve them from the insults of the Egyptians; others of Pharaoh building houses for them;

22 And Pharaoh charged all his people, saying, “Every son who is born ye shall cast into the river, and every daughter ye shall save alive.” — every son that is born; the Targums and the Septuagint add “to the Hebrews,” as the context shows only Hebrew children are meant.

Exodus 2

1 And there went a man of the house of Levi, and took for a wife a daughter of Levi.

— the Targum of Jonathan reveals further who this man is

“And Amram, a man of the tribe of Levi, went and seated in a bridal canopy and a wedding chamber Jochebed his wife, whom he had divorced because of the decree of Pharaoh.

“And she was one hundred and thirty years old when he returned her to him; and a miracle was performed for her, and she returned to her youth, just as she was when she was young and called ‘the daughter of Levi.'”

And the woman conceived and bore a son; and when she saw that he was a goodly child, she hid him three months.

— there went a man of the house of Levi; Amram the husband, the son of Kohath, and grandson of Levi, as appears from Exodus 6:18; and Jochebed his wife; and their two children, Miriam and Aaron;

— Miriam, a daughter, born probably soon after their marriage, and Aaron, a son, born some twelve years later. Soon after the issue of the edict, Jochebed gave birth to her third child, a son;

And when she could no longer hide him, she took for him an ark of bulrushes, and daubed it with slime and with pitch, and put the child therein; and she laid it in the reeds by the river’s brink.

— Moses, was born, as the Jews say, in the thirty seventh year after the death of Levi, AM 2368; the ark was made of the papyrus which was commonly used by the Egyptians for light and swift boats.

And his sister stood afar off to learn what would be done to him. — and his sister stood afar off; this was Miriam, as the Targum of Jonathan expresses it; who is supposed to be about ten or twelve years of age;

And the daughter of Pharaoh came down to wash herself at the river, and her maidens walked along by the riverside; and when she saw the ark among the reeds, she sent her maid to fetch it.

— the princess would, of course, seek a part of the river which was reserved for females; probably Jochebed know where she was accustomed to bathe.

And when she had opened it, she saw the child; and behold, the babe wept. And she had compassion on him and said, “This is one of the Hebrews’ children.” — Jewish writers say, she knew it by its being circumcised, the Egyptians not yet using circumcision.

Then said his sister to Pharaoh’s daughter, “Shall I go and call to thee a nurse of the Hebrew women, that she may nurse the child for thee?” — the Hebrew women, that she may nurse the child for thee; for she perceived that she was desirous of having the child brought up as her own.

And Pharaoh’s daughter said to her, “Go.” And the maid went and called the child’s mother. — called the child’s mother; Jochebed must have been waiting near, eagerly expecting—perhaps, while concealed from sight, watching the result, and ready to appear the moment that she was summoned.

And Pharaoh’s daughter said unto her, “Take this child away and nurse it for me, and I will give thee thy wages.” And the woman took the child, and nursed it.

— take this child away, and nurse it for me, and I will give thee thy wages; by which means she, who was unknown to the princes, had not only the nursing of her own child, but was paid for it;

10 And the child grew, and she brought him unto Pharaoh’s daughter, and he became her son. And she called his name Moses [that is, Drawn out], and she said, “Because I drew him out of the water.”

— the child grew; in stature and in strength; Josephus regards these words as implying a growth that was strange, tall and extraordinary (Ant. Jud. ii. 9, § 6);

“Now Moses’s understanding became superior to his age, nay, far beyond that standard; and when he was taught, he discovered greater quickness of apprehension than was usual at his age, and his actions at that time promised greater, when he should come to the age of a man.

“God did also give him that tallness, when he was but three years old, as was wonderful. And as for his beauty, there was nobody so unpolite aswhen they saw Moses, they were not greatly surprised at the beauty of his countenance; nay, it happened frequently, that those that met him as he was carried along the road, were obliged to turn again upon seeing the child; that they left what they were about, and stood still a great while to look on him; for the beauty of the child was so remarkable and natural to him on many accounts, that it detained the spectators, and made them stay longer to look upon him.”

11 And it came to pass in those days, when Moses was grown, that he went out unto his brethren and looked on their burdens; and he spied an Egyptian smiting a Hebrew, one of his brethren.

— he went out unto his brethren; it is probable that Pharaoh’s daughter had never concealed from Moses that he was not her own child, but she had no heir of her own, even where Moses was one of the oppressed race.

12 And he looked this way and that way, and when he saw that there was no man, he slew the Egyptian and hid him in the sand.

— he slew the Egyptian, and hid him in the sand; this act of Moses may seem and indeed by some has been condemned as rash and unjustifiable—in plain terms, a deed of assassination.

13 And when he went out the second day, behold, two men of the Hebrews strove together; and he said to him that did the wrong, “Why smitest thou thy fellow?” — the second day; that is, the next day;

— wherefore smitest thou thy fellow? Compare with Acts 7:26, where the words of Moses are reported somewhat differently, “Sirs, ye are brethren; why do ye wrong one to another?”

14 And he said, “Who made thee a prince and a judge over us? Intendest thou to kill me as thou killed the Egyptian?” And Moses feared and said, “Surely this thing is known.”

— and Moses feared; lest the thing should be discovered and be told to Pharaoh, and he should suffer for it: this fear that possessed Moses was before he fled from Egypt and went to Midian;

15 Now when Pharaoh heard this thing, he sought to slay Moses. But Moses fled from the face of Pharaoh, and dwelt in the land of Midian; and he sat down by a well.

— and dwelt in the land of Midian: a country so called from Midian, one of Abraham’s sons by Keturah, Genesis 25:2.

16 Now the priest of Midian had seven daughters; and they came and drew water, and filled the troughs to water their father’s flock.

— the Priest of Midian; Reuel Exodus 2:18. His name, and the detailed notices in Exodus 18, prove that he was a priest (sometimes used of a prince, ruler, and governor) of the one true God who was known to the patriarchs especially under the name El.

17 And the shepherds came and drove them away; but Moses stood up and helped them, and watered their flock. — the shepherds came; those of the neighbourhood;

— the rule of the desert is that those who come to a well take their turns in the use of the water in the order of their arrival. But these rude shepherds declined to wait for their turn.

18 And when they came to Reuel their father, he said, “How is it that ye have come so soon today?” — strictly, and then he is the same who elsewhere is called Jethro, Exodus 3:1;

19 And they said, “An Egyptian delivered us out of the hand of the shepherds, and also drew water enough for us and watered the flock.” — an Egyptian; so they concluded from his dress and appearance, perhaps even from his speech.

20 And he said unto his daughters, “And where is he? Why is it that ye have left the man? Call him, that he may eat bread.” — that he may eat bread; Arabian hospitality was offended that the stranger had not been invited into the tent to partake of the evening meal.

21 And Moses was content to dwell with the man; and he gave Moses Zipporah his daughter.

— the Targum Jonathan says it was at the end of ten years;

“And when Reuel [Jethro] realized that Moses had fled from before Pharaoh, he cast him into a pit. But Zipporah, his daughter, sustained him in secret for a period of ten years. At the end of ten years, he brought him out of the pit, and Moses entered the garden of Reuel. He gave thanks and prayed before the Lord, who had performed miracles and mighty deeds for him.

“There he beheld the Staff which had been created at the twilight [of creation], upon which was engraved and explicitly carved the Great and Glorious Name, by which he was destined to perform wonders in Egypt, and by which he was destined to split the Sea of Reeds and bring forth water from the rock. It was stuck in the middle of the garden; immediately he stretched out his hand and took it. Behold, then Moses was willing to dwell with the man [Jethro], and he gave Zipporah, his granddaughter (or daughter’s daughter), to Moses.”

22 And she bore him a son, and he called his name Gershom [that is, A stranger there]; for he said, “I have been a stranger in a strange land.”

— Gershom; that is, a stranger there; and indeed forty years after this a son of his seems to have been young, having not till then been circumcised. Now this settlement of Moses in Midian was designed by Providence to shelter him for the present.

23 And it came to pass in process of time that the king of Egypt died. And the children of Israel sighed by reason of the bondage, and they cried; and their cry came up unto God by reason of the bondage. — in those many days; another 40 years after Moses fled Egypt;

— as Moses was now eighty years old (Exodus 7:7), and only forty when he quitted Egypt, the Pharaoh from whom he fled must have reigned above forty years;

— the Targum Jonathan says

“And it happened in those many days, the king of Egypt was struck [with a plague/leprosy], and he commanded to kill the firstborn of the children of Israel in order to bathe in their blood.

“And the children of Israel groaned from the labor which was hard upon them, and they cried out, and their complaint ascended to the high heavens of the Lord; and He said by His Word (Memra) to redeem them from the labor.”

24 And God heard their groaning, and God remembered His covenant with Abraham, with Isaac, and with Jacob. — and God remembered his covenant; that he would bring their seed out of a land not theirs, in which they were strangers, and were afflicted, into the land of Canaan, for an everlasting possession.

25 And God looked upon the children of Israel, and God took heed of them. — and God looked upon them with an eye of pity and compassion, and saw all the hardships they laboured under, and all the injuries that were done unto them.

Anti-Trump Coalition Forming

•April 22, 2026 • Leave a Comment
Spain’s Sánchez leading the anti-Trump coalition around the world

EuroNews • April 21, 2026

Spain’s Sánchez builds anti-Trump coalition looking for political lifeline at home.

Spanish PM led a progressive conference in Barcelona bringing together world leaders opposing MAGA politics, as Brazil’s Lula lashed out at warlords and tech billionaires. “They’re destroying democracy, workers and nature.”

Pedro Sánchez rallied global leaders in Barcelona this weekend at a two-day convention billed as the “progressive CPAC,” crowning himself leader of the international left while grappling with mounting challenges at home.

In a speech Saturday, the Spanish leader warned of an international “reactionary wave” fuelling hate speech, sexism, war and division, without explicitly naming US President Donald Trump.

“It doesn’t matter how much they scream, or how many lies they spread,” Sánchez said. “The time for the reactionary, ultra-right has come to an end.”

Brazilian President Luiz Inácio Lula da Silva echoed the remarks, criticising those “who call themselves patriots but put their sovereignty up for sale and call for sanctions.”

Chants of “No to war” could be heard at the Fira auditorium in Barcelona.

The guest list included South African President Cyril Ramaphosa, Colombian President Gustavo Petro and Mexican President Claudia Sheinbaum.

All three have clashed with US President Donald Trump over tariffs and migration, while South Africa has also faced allegations of “anti-white” racism — claims echoed by tech billionaire Elon Musk.

A European delegation included German Vice-Chancellor Lars Klingbeil, UK Foreign Secretary David Lammy, Italy’s opposition leader Elly Schlein, and Belgian politician Paul Magnette. Tax-the-rich economist Gabriel Zucman was also in attendance.

European Council President António Costa cancelled at the last minute, citing personal reasons, and skipped a gathering perhaps considered too political for his role.

Mexico’s Sheinbaum participated in an event about protecting democracies but did not join the more political rally on Saturday. A US-Mexico-Canada trade agreement is under review by the Trump administration and delicate talks about its terms are ongoing.

Progressive CPAC to counter global MAGA

Sánchez said the Barcelona conference — unofficially billed as a left-wing answer to the conservative gathering CPAC — would serve to unite “progressive forces” under a single banner. A source involved in the preparations told Euronews that Brazil had asked Spain to move the event earlier to spring, with April ultimately chosen as the date.

While none of the leaders mentioned US President Donald Trump by name, references to the American leader surfaced repeatedly, alongside criticism of his policies. From tariffs to the war in Iran, officials called for a progressive response to “a reactionary wave.”

Brazil’s president Lula joined in the criticism of the war in Iran, and greeted Spain’s decision to deny access to US forces to use Spanish military bases to strike Iran.

“I want to salute friend, Pedro Sánchez, for having the courage (to say no),” Lula added.

A difficult week for Sánchez at home

By often taking an independent stance – from Gaza to the war in Iran – the Spanish prime minister has captured a global audience, leading a bloc of left-wing leaders.

Euronews first reported about plans to organise a convention for socialist parties and the international left in March.

Euronews also reported that Sánchez sought to capitalise on public discontent over the war in Iran and the unpopularity of Trump to boost his international profile.

His stance has earned him applause, but also criticism from the White House.

Trump has repeatedly said he “wants nothing to do with Spain” and has criticised Sánchez as a bad leader who is “not paying” his fair share for NATO protection. He also threatened to impose a full trade blockade, although no measures have been announced.

The convention wraps a difficult week for the Spanish prime minister after his wife, Begoña Gómez, was charged with corruption and is set to face trial following a two-year investigation. The couple have denied any wrongdoing.

Sources close to Sánchez speaking to Euronews describe the case as politically motivated and expect Gómez to be acquitted.

This is the beginning of how a Prophecy, a rivarlry between Esau and Jacob, is now brewing to being fulfilled

And upon thy sword shalt thou depend, entering at every place: yet thou shalt be supple and credulous, and be in subjection to thy brother; but it will be that when his sons become evil, and fall from keeping the commandments of the law, thou shalt break his yoke of servitude from off thy neck. Genesis 27:40 Jonathan

“Rather, I will wait until the days of mourning for my father have passed, and then I will kill Jacob my brother, and I will be the sole heir.’” Genesis 27:41 Jonathan

For a detailed Study of who Esau is, see Obadiah

And who then is Ephraim, see (1) Ephraim and Manasseh (2) Ephraim as the Thirteenth Tribe

And how they would play out, see Ezekiel 4 – 390/40 Years Timeline

Genesis (49-50)

•April 21, 2026 • Leave a Comment

~~~~~

~~~~~

Genesis 49

1 And Jacob called unto his sons and said, “Gather yourselves together, that I may tell you that which shall befall you in the last days. — in the last days, or the latter days, after you have entered and be settled in the Land of Promise; just before the Messiah’s coming;

— the Targum Onkelos says

Come together and listen, sons of Yaakov; listen to [accept chastisement from] Yisrael, your father.

— the Targum of Jonathan reveals

“And Jacob called his sons and said to them: ‘Purify yourselves from uncleanness, and I will show you the hidden secrets, the concealed ends, the hidden rewards of the righteous, the punishment of the wicked, and what the shadow of Eden is like.’

“As one, the twelve tribes of Israel gathered, surrounding the golden throne upon which he reclined. From the moment the Glory of the Shekhinah of the Lord was revealed, the ‘End’—when the King Messiah is destined to come—was hidden from him.

“Therefore he said: ‘Come, and I will relate to you that which shall befall you in the end of days.'”

“Gather yourselves together and hear, ye sons of Jacob, and hearken unto Israel your father: — here it contains a number of predictions or prophecies which were to be fulfilled at distant periods;

— the Targum Onkelos says

Come together and listen, sons of Yaakov; listen to [accept chastisement from] Yisrael, your father.

“Reuben, thou art my firstborn, my might, and the beginning of my strength, the excellency of dignity, and the excellency of power. — Reuben~France, as the firstborn by nature, has the first place in the benedictory address;

— the Targum Onkelos says

Reuvein, you are my firstborn, you are my strength, and the beginning of my manhood [power]; superior in rank and superior in power [it would have been right for you to take three portions—the birthright, the priesthood, and the kingship].

— the Targum of Jonathan reveals

“Reuben, you are my firstborn, the head of my strength, the beginning of my service, and the start of the city of my thoughts.

“It was fitting for you to have the Birthright, the High Priesthood, and the Kingdom.

“But because you sinned, my son, the Birthright was given to Joseph, the Kingdom to Judah, and the Priesthood to Levi.”

The Battle of Waterloo, June 1815; the French Imperial Army under the Command of Napoleon was defeated by Arthur Duke of Wellington

— great honor and power; the birthright was yours, the priesthood was yours, the kingship was yours, but now that you sinned, the birthright was given to Joseph, the priesthood to Levi, and the kingship to Judah;

Q. The priesthood bestored upon the Levites, to operate in God’s Temple; the scepter and kingship belong to Judah, to rule and uphold God’s laws, statutes and ordinances; the birthright bestored upon Joseph, but what is the posterity of Joseph supposed to do?

Unstable as water, thou shalt not excel, because thou wentest up to thy father’s bed; then defiledst thou it; he went up to my couch.

— unstable as water, Reuben shalt not excel; as water is prone to flow downward to an inferior situation, so France should fall from the pre-eminence he had by birth;

— May Reuben live and not die (Deu 33:6, because such sin is to be stoned to death Deu 27:20); but thou shalt not excel, or be not the most eminent amongst thy brethren; thou hast lost thy pre-eminency due to thee by birthright, both for thyself and for thy posterity (no prominent character are from Reuben/French);

— Reuben most famous posterity, Napoleon, was best known not for his conquest, but for his defeat at Waterloo; and it shall be given to others; the priesthood to Levi, the dominion or septer to Judah (the Jews); and the double portion of birthright to Joseph (the Anglo-Saxons);

— the Targum Onkelos says

Unstable as water, you shall no longer be superior, [However, because you went towards your anger like flowing water, you will not benefit, you will not receive an additional portion,] for you have gone up [to the place of] your father’s bed. You profaned He Who went up on my couch[, my son, you went up].

— the Targum of Jonathan reveals

“I compare you to a small garden into which light streams have entered, but then powerful, surging rivers overflowed it, and it could not withstand them and was overturned.

“So was your will broken, Reuben my son, for you sinned; but do not continue [to sin], and for the sin you committed, you shall be forgiven.

“For it was accounted to you as if you had entered the bed where your father had slept, in the time that you disordered my couch upon which you ascended.”

“Simeon and Levi are brethren; instruments of cruelty are in their habitations. — Simeon and Levi are brethren; brother for Dinah, but not for Joseph, that is, they are alike in character and disposition;

— weapons of villainy are their heritage; these two brothers were in their same modes of thought and action; and were associated in the massacre of the Shechemites; but not for Joseph;

— the Targum Onkelos says

Shimon and Levi are brothers [mighty men]. Instruments of violence are their wares. [In the land of their residence they did mighty deeds.]

— the Targum of Jonathan reveals

“Simeon and Levi are twin brothers; sharp weapons of war are their hallmark, [used] for hewing down [their enemies].”

O my soul, come not thou into their secret; unto their assembly, mine honor, be not thou united; for in their anger they slew a man, and in their selfwill they dug down a wall.

— my soul, come not thou into their secret; Jacob seems ashame to be with either of them; their cursed plot hatched in secret: far be it from me to approve of their secret designs;

— the Targum Onkelos says

My soul will not enter [was not in] their secret council, let my honor not be identified with their assembly [when they gathered to go to war against Shechem I did not descend from my honor and join them]. For in their anger they killed a [”dead”] man, and through their willfulness they maimed an ox [demolished the enemy’s wall].

— the Targum of Jonathan reveals

“In their counsel, my soul took no pleasure; and in their assembling to Shechem to destroy it, my honor was not united; for in their anger they slew a king and his ruler, and by their will they tore down the wall of their enemies.”

Cursed be their anger, for it was fierce; and their wrath, for it was cruel! I will divide them in Jacob, and scatter them in Israel. — the violence against the Shechemites is a proof of this: thus both posteries of Simeon and Levi were to be scattered throughout Israel;

— for the tribe of Levi: “I am your portion and your inheritance” Numbers 18:20;

— for the tribe Simeon, the mysteries remain why they were lost among Israel;

— the Targum Onkelos says

Cursed be their anger for it is powerful, and their fury for it is cruel. I will divid them throughout Yaakov and scatter them throughout [the land of] Israel.

— the Targum of Jonathan reveals

“Jacob said: Cursed was the city of Shechem when they entered into it to destroy it in their mighty anger, and their fury against Joseph, for it was harsh.

“Jacob said: If these two dwell together as one, there is no king or ruler who could stand before them. [Therefore], I will divide the inheritance of the sons of Simeon into two portions: one portion shall go out from within the inheritance of the sons of Judah, and one portion among the rest of the tribes of Jacob.

“And I will scatter the tribe of Levi within all the tribes of Israel.”

“Judah, thou art he whom thy brethren shall praise; thy hand shall be on the neck of thine enemies; thy father’s children shall bow down before thee. — Judah, the fourth son of Jacob, comes in for the supremacy;

— thy hand shall be on the neck of thine enemies; that is, always ready to strangle its enemies to death;

— thy father’s children shall bow down before thee; before the kings that should spring from this tribe, and should rule over all the rest, as David and Solomon, to whom civil adoration and respect were given by them;

— the Book of Jasher, chapter 56, adds regarding Judah’s propensity and prominence in war, and the use of bow (and arrows); missiles, and all other form of weapons; that is, Judah is prone to go to war with its neighbours:

And Jacob said unto Judah, I know my son that thou art a mighty man for thy brethren; reign over them, and thy sons shall reign over their sons forever.

Only teach thy sons the bow and all the weapons of war, in order that they may fight the battles of their brother who will rule over his enemies. Book of Jasher 56:8-9

— the Targum Onkelos says

Yehudah, your brothers will praise you [you confessed, and you were not ashamed. Your brothers will acknowledge you.] Your hand will be on the neck of [overpower] your enemies. [Your haters will be dispersed. They will turn the back of their necks to you.] Your father’s sons will prostrate themselves to you [greet you first].

— the Targum of Jonathan reveals

“Judah, you confessed regarding the incident of Tamar; therefore your brothers shall praise you and shall be called ‘Jews’ after your name.

“Your hands shall exact punishment for you from your enemies, to launch arrows at them when they turn their backs before you.

“And your father’s sons shall be early to greet you in peace.”

Judah is a lion’s whelp; from the prey, my son, thou art gone up. He stooped down, he couched as a lion, and as an old lion; who shall rouse him up? — the origin of the three lions;

— Judah is a lion’s whelp; the lion is the king of beasts, the terror of the forest when he roars; when he seizeth his prey, none can resist him;

— this it was prophecised that the tribe of Judah should become very formidable, and should not only obtain great victories, but should peaceably enjoy what was gotten by those victories;

— here Judah is compared, not to a lion rampant, always raging, but to a lion couching, enjoying the satisfaction of his success, and that shouldn’t create vexation to others;

— who shall rouse him up? a lion grown up and in its full strength, or a lioness, which is the fiercest, and therefore the most dangerous to rouse up when laid down, either in its den, or with its prey in its paws: so dangerous it was to provoke the tribe of Judah;

— the Targum Onkelos says

Yehudah is like a young lion. [He will be a ruler at the beginning, and at the end, a king will be anointed from the house of Yehudah.] You have risen above plunder my son. [For from the judgment of death, my son, you removed yourself.] He crouches, rests like a lion, [He will rest and dwell in strength like a lion.] like an awesome lion, who will rouse him? [there is no kingdom that can make him tremble.]

— the Targum of Jonathan reveals

“I compare you, Judah my son, to a young lion. From the killing of Joseph my son, you withdrew your soul; and from the judgment of Tamar, you shall be delivered.

“You shall rest and dwell in strength like a lion, and like a lioness—when he rests, who shall rouse him?”

10 The scepter shall not depart from Judah, nor a lawgiver from between his feet until Shiloh come; and unto Him shall the gathering of the people be.

— the sceptre, the staff, the emblem of authority: kingship; shall not depart from Judah, also, the great council of Israelites, termed the Sanhedrin; first constituted chiefly of the Levites, then the tribe of Judah, together they constitute the Jews;

— until Shilo arrives, this is the Messianic King; until he comes;

— the Targum Onkelos says

The rod [of the ruler] will not depart from [the house of] Yehudah, nor a law-enforcer from between his feet [nor a scribe from his children’s children forever], until Shiloh Comes [the Moshiach will come, for his is the kingship], and to him shall be an assembly of nations [nations will listen].

— the Targum of Jonathan reveals

“Kings and rulers shall not cease from the House of Judah, nor scribes who teach the Torah from his seed, until the time that the King Messiah shall come—the youngest of his sons—and because of him, the nations shall melt away.”

11 Binding his foal unto the vine, and his ass’s colt unto the choice vine, he washed his garments in wine, and his clothes in the blood of grapes.

— binding his foal unto the vine; of the tribe of Judah, signify that vines should grow in such plenty, and so large and strong, that a man might fasten his ass to one of them;

— and he washed his garments in wine, and his clothes in the blood of grapes, setting forth the great abundance of wine in this tribe, that if they would, they might have used it instead of water to wash their clothes in;

— the Targum Onkelos says

He loads his young donkey with grapes of a vine, and his she-donkey’s foal with a vine-branch. [He will bring Israel from all around to his city, the nation who will build his Temple. The righteous will congregate around the Moshiach, and those who engage in Torah will study with him.] He washes his clothes in wine, [May his garments be of fine purple cloth,] and his cloak in the blood of grapes [and his clothes of fine wool colored in scarlet and other colors].

— the Targum of Jonathan reveals

“How beautiful is the King Messiah who is destined to arise from the House of Judah! He girds his loins and goes down; he sets in order the battle-arrays against his enemies and slays kings along with their rulers.

12 His eyes shall be red with wine, and his teeth white with milk. — his eyes shall be red with wine; signifying their adult or elder use of wine, and the effect of it; also the goodness and generosity of their wine, that if drank plentiful, and especially to excess, would have such an effect;

— and his teeth white with milk; signifing the fruitfulness of his land, producing fine pastures, on which flocks and herds fed, and gave abundance of milk for their young; the Targums say “his mountains shall be red with his vineyards, and his hills shall drop wine, and his valleys shall be white with corn and flocks of sheep;”

— the Targum Onkelos says

His eyes are red from wine, [His mountains will become red with his vineyards, / His winepresses will be flowing with wine,] and his teeth are white [from an abundance of] milk [His valleys will appear white from the abundance of grain and sheep].

— the Targum of Jonathan reveals

“How beautiful are the eyes of the King Messiah! Like pure wine, [too pure] to behold the uncovering of nakedness or the shedding of innocent blood.

“His teeth are cleaner than milk, [too clean] to consume that which is stolen or taken by force.

“And then his mountains and his winepresses shall grow red with wine; and his hills shall grow white with grain and with the folds of the flocks.”

13 “Zebulun shall dwell at the haven of the sea; and he shall be for a haven of ships, and his border shall be unto Sidon. — Zebulun~Holland; shall dwell at the haven of the “sea;”

— the territory of Holland, or the Netherlands, the tribe then lay upon the inland sea of Gennesaret and toward the shore of the Mediterranean; but now in low-lying northern Europe;

— that Jonah was from Zebulun; that is what is written: “The third lot arose [for the children of Zebulun.… from there it passed eastward [to Gat Ḥefer]” (Joshua 19:10, 13). And it is written: “In accordance with the word of the Lord, God of Israel, that He spoke by means of His servant Jonah son of Amitai [the prophet, who was from Gat Ḥefer]” (II Kings 14:25);

— the Targum Onkelos says

Zevulun will settle on seashores, he will be a harbor for ships [conquer the borders with ships]; [he will consume the best of the sea] his border will reach to Sidon.

— the Targum of Jonathan reveals

“Zebulun shall dwell by the shores of the sea, and he shall be a ruler over the harbors; he shall conquer the provinces of the sea with ships, and his boundary shall reach unto Sidon.”

14 “Issachar is a strong ass, couching down between two burdens. — Issachar shall be strong and industrious, fit for and inclined to labour, particularly the toil of husbandry; like the ass that patiently carries his burden; to be active, given to agricultural labors;

— couching down between two burdens; for much of history, Finland was ruled by Sweden; and during the Cold War, had to struggle to navigate between Western and Soviet forces; even where it is now a part of NATO, it still has to couch between two burdens;

— the Targum Onkelos says

Yissachar is a bony donkey [rich in property], crouching [and his inheritance is] between the borders.

— the Targum of Jonathan reveals

“Issachar is a donkey [laden] with the Torah, a mighty tribe that knows the [astronomical] calculations of the times; and he reclines between the boundaries of his brothers.”

15 And he saw that rest was good, and the land that it was pleasant, and bowed his shoulder to bear, and became a servant to tribute.

— the Targum Onkelos says

He saw that rest [his portion] is good, and that the land is pleasant [produces fruit]; he bent his shoulder to bear the burden [and he will conquer territories of peoples and destroy their inhabitants]; and became a servant to pay the tribute [and those that remain will become workers to him and bring taxes].

— a servant unto tribute; or task-work; it means service paid in actual labour, such as was exacted by Solomon of the descendants of the Canaanites (1 Kings 9:21, where the phrase used here is translated “a tribute of bondservice;” and II Chronicles 8:8);

— the Targum of Jonathan reveals

“And he saw the rest of the World to Come, that it is good, and the portion of the Land of Israel, that it is pleasant.

“Therefore, he inclined his shoulder to labor in the Torah; and his brothers became those who bring him gifts.”

— asking ChatGPT: had Finland paid tributes to her neighbours in history?

Yes, Finland has historically been involved in paying tributes to neighboring powers under various circumstances. These payments were usually the result of political pressure, conquest, or as part of peace treaties. Here are some notable instances:

1. Tribute to Novgorod and Russia:

In the medieval period, parts of what is now Finland were under the influence of both Sweden and Novgorod (a powerful Russian principality). Some Finnish tribes, especially in Karelia and eastern Finland, were sometimes forced to pay tribute to Novgorod. This was part of the broader competition for control over Finland between Novgorod and Sweden.

  • Karelia: Eastern Finland and the Karelian region were especially contested. Finnic tribes in this region would at times pay tribute to Novgorod, particularly during periods when Novgorod held power over parts of the area.

2. Swedish Rule:

Finland was part of the Kingdom of Sweden from the 12th century until 1809. During this time, Finland did not pay tribute as a foreign subject but contributed to Swedish military campaigns and supported the Swedish economy through taxes, which sometimes resembled tribute-like obligations, especially in wartime.

  • Wars with Russia: Finland often bore the brunt of Swedish conflicts with Russia, and as part of the Kingdom of Sweden, its resources were used to support these wars. While this was not tribute in the classical sense, it involved significant economic sacrifice.

3. Under Russian Rule (1809–1917):

After Sweden ceded Finland to Russia following the Finnish War (1808–1809), Finland became an autonomous Grand Duchy under the Russian Empire. Although Finland had its own governmental structures and relative autonomy, it was required to support the Russian Empire, particularly in terms of military service and taxes.

  • Tribute-like obligations: Finland had to contribute economically and militarily to the Russian Empire. While Finland was not subjected to formal “tribute,” the economic obligations placed on it during its time as a Russian Grand Duchy were similar to the tributes or taxes paid by other subjugated territories.

4. Viking Age (pre-Swedish control):

Before becoming part of the Swedish kingdom, some Finnish tribes may have been subjected to tribute payments to Viking raiders from Scandinavia. This would have been common in the Viking Age, when Norsemen would raid or exert influence over coastal communities in the Baltic region, including those in Finland.

5. Post-Swedish and Russian Rule:

After gaining independence in 1917 following the Russian Revolution, Finland no longer paid tributes to any neighboring country. However, during the Winter War (1939–1940) and Continuation War (1941–1944) with the Soviet Union, Finland was forced to cede territory and make reparations to the Soviet Union after World War II.

  • War Reparations to the Soviet Union: While not a historical tribute in the traditional sense, Finland was forced to pay significant reparations to the Soviet Union after World War II. Finland’s war reparations were in the form of industrial goods, such as machinery, ships, and other materials, rather than direct monetary payments.

In summary, Finland has, at various points in its history, paid tribute or similar obligations to more powerful neighboring states, including Novgorod, Russia, and Sweden, depending on the political situation of the time. These tributes were generally part of power struggles over control of the region and were often driven by geopolitical pressures rather than voluntary alliances.

16 “Dan shall judge his people, as one of the tribes of Israel. — Dan; in passing on to the sons of the maids it was necessary to assure them of an independent rank among their brethren: the four tribes descended from them did always hold an inferior position;

— Dan is the first of the children of concubine wives as yet taken notice of; that a judge should arise out of him as out of the other tribes; that should judge all Israel, an honour given to Samson, who was of the tribe of Dan; today they Dan settled in Ireland and Denmark;

— the Targum Onkelos says

Dan will avenge his people [From the house of Dan a man will be chosen and will arise, in his day his people will be delivered], as one of the tribes of Israel [and in his years the tribes of Israel will rest together].

— the Targum of Jonathan reveals

“From the House of Dan, a man is destined to arise who shall judge his people with judgments of truth; as one, the tribes of Israel shall listen to him.”

17 Dan shall be a serpent by the way, an adder in the path, that biteth the horse’s heels, so that his rider shall fall backward. — the adder is the cerastes or horned serpent, of the color of the sand,

— and therefore, not easily recognized, that inflicts a fatal wound on him that unwarily treads on it; features that are conspicuous in Samson, the most illustrious of its judges;

— that biteth the horse heels, so that his rider shall fall backward; the golden calf set up in Dan by Jeroboam; for this sort of serpents lying in horse ways and cart ruts, snaps at and bites horses as the Ten Tribes of Northern Israel passed along Bethel and Dan; causing their riders to fall backward into idolatry;

— the Targum Onkelos says

Dan will be a serpent on the road, [The man that will be chosen and will arise from the house of Dan û his terror will fall upon the peoples, and his smiting will be strong against the Pelishtim. Like a viper he will lie on the way,] a viper on the path [and like an old snake he will ambush on the path], that bites the horse’s heel [He will kill the mighty of the camp of the Plishtim / the horsemen with the infantry / He will uproot the horses and chariots] so that the rider falls backward [and he will cause their riders to fall backward].

Jeroboam, “It is too much for you to go up to Jerusalem. Behold thy gods, O Israel, which brought thee up out of the land of Egypt!”

— the Targum of Jonathan reveals

“There shall be a man who is chosen and shall arise from the House of Dan; he is compared to a basilisk (churmana) that lies at the crossroads, and like the heads of serpents that lurk by the path, which bite the horse in its heel, and from its terror, its rider is thrown backward.

“Thus shall Samson bar Manoah slay all the mighty men of the Philistines—the horsemen and the footmen—and he shall uproot their horses and cast their enemies backward.”

18 I have waited for Thy salvation, O Lord! — missing out of the 144,000 of Revelation 7, Dan exclaimed “I have waited for thy salvation, O Lord.” Jacob finding his spirits faint and flag, stops and breathes awhile before he proceeded any further in blessing other tribes;

— the Targum Onkelos says

For your deliverance, I wait, Adonoy.

— the Targum of Jonathan reveals

“Jacob said, when he saw Gideon the son of Joash and Samson the son of Manoah arising as saviors:

“‘Not for the salvation of Gideon do I hope, and not to the salvation of Samson do I look; for their salvation is but a salvation of the hour.

“Rather, for Your salvation do I hope and look, O Lord—for Your salvation is an eternal salvation.'”

19 “Gad, a troop shall overcome him; but he shall overcome at the last. — Gad~Switzerland; Gad, which signifies a troop, foresees the character a warlike tribe;

— being seated on the other side Jordan was exposed to the incursions and spoils of the Moabites and Amonites; who came upon them like troops of robbers, and seized upon their possessions and retained them for some years; 

— the Targum Onkelos says

[From the house of] Gad will be an assailing [armed] troop[s will pass over the Jordan before their brothers to war]; he will be a troop at their heels [and they will return to their land with much property].

— the Targum of Jonathan reveals

“The tribe of Gad shall cross over armed with the rest of the tribes across the torrents of Arnon; and they shall conquer before them the pillars of the land.

“And they shall return armed at the end with great possessions, and they shall dwell in tranquility beyond the crossing of the Jordan, for there they desired and were granted their inheritance.”

20 “Out of Asher, his bread shall be fat, and he shall yield royal dainties. — Asher~Belgium; the territory of this tribe, extending along the coast from Mount Carmel to Lebanon, was very productive;

— replenished not only with bread for necessity, but with fatness, with dainties, royal daintie; not only oil for ointments, but also delicious and excellent fruits, fit to be presented to a king;

— the Targum Onkelos says

From Asher will come oily food [The land of Asher is good], he will provide [it produces] delicacies for the king.

— the Targum of Jonathan reveals

“Blessed is Asher! Fat are the fruits of his land; it produces spices and the roots of medicinal drugs.”

21 “Naphtali is a hind let loose; he giveth goodly words. — Naphtali~Sweden;  is a deer roaming at liberty; is light and active, moving rapidly like “a hind let loose;” or literally, sent forth, like the scouts or van of an army;

— a hind let loose; another view is an image of ease and grace in movement, associated with promiscuous sex or experimenting with drugs;

— the Targum Onkelos says

Naftali is a gazelle-like messenger, [The lot of Naftali will fall on a good land. His inheritance will yield fruit,] he delivers pleasant Sayings [they will give thanks and blessings over them].

— the Targum of Jonathan reveals

“Naphtali is a swift messenger, resembling a deer that runs upon the peaks of the mountains, bringing good tidings.

“It was he who brought the news that Joseph is still alive; and it was he who hastened and went to Egypt and brought the deed of the Cave of Machpelah, [proving] that Esau had no portion in it.

“And when he opened his mouth in the assembly of Israel to give praise, it was the choicest of all languages.”

22 “Joseph is a fruitful bough, even a fruitful bough by a well, whose branches run over the wall. — Joseph~US&UK is a fruitful bough; or as one, like the bough or branch of a tree laden with fruit, as he was with children;

Jacob blessing upon Joseph; the Ox or Bull, the strength and fortitude of the United States; and its horns like that of a Unicorn, is the strength and fortitude of the Anglo-Saxons; together they push and dominate the world

— with Manasseh over running its walls into Canada, Australia and New Zealand; and from Ephraim: the original thirteen tribes, into Louisiana Purchase; Texas, New Mexico, Arizonia, California and westward march onto Hawaii, Guam and even the Philippines, engulfed the entire archipelago before dislodging it;

— one of which he called Ephraim from his fruitfulness, and both his sons became numerous, and the heads of two tribes in Israel; and with other temporal fruits and blessings, as riches and honour;

— the Targum Onkelos says

A fruitful son is Yoseif, [Yoseif is a son who will increase,] a fruitful son at the well [a son who will be blessed like a vine planted by a spring of water]. Daughters tread on the wall. [Two tribes will emerge from his sons, they will receive a portion and an inheritance.]

— the Targum of Jonathan reveals

“My son, you have grown, Joseph my son; you have grown and become strong, and in the end, it was [fitting] for you to be strong, for you subdued your [evil] inclination in the matter of your mistress and in the matter of your brothers.

“I compare you to a vine planted by springs of water, which sends forth its roots and breaks the teeth of rocks; and with its branches, it subdues all the barren trees. So did you, Joseph my son, subdue by your wisdom and your good deeds all the Egyptian sorcerers.

“And when they praised you, the daughters of the rulers would walk upon the walls and throw before you golden bracelets and necklaces, so that you might lift your eyes toward them; but you did not lift your eyes toward even one of them, so as not to be found guilty by them on the Great Day of Judgment.”

23 The archers have sorely grieved him, and shot at him, and hated him. — Joseph’s enemies described as archers, the arrows and the bow, in modern days term would be projectiles, artilleries, missiles, and drones;

— the words are probably to be taken as prophecy; to future conflicts of the tribe of Joseph; at the endtime, the archers from his enemies have sorely grieved Joseph (or Ephraim and Manasseh); though he lived with ease and in honour,

— Jacob prophecised Joseph of the difficulties he had formerly waded through; as he had many enemies, now described as archers, being skilful to do mischief; they hated him, they shot their poisonous darts back at Joseph; remember this context: “Gather, and I will tell you what will befall you at the end of days” Genesis 49:1

— the Targum Onkelos says

They made him bitter and quarreled with him [they avenged themselves on him]. Expert bowmen with hatred made him their target. [Mighty men, those who have half, afflicted him.]

“And they embittered him and contended with him—all the Egyptian sorcerers—and they even ‘ate his pieces’ (accused him) before Pharaoh.

— the Targum of Jonathan reveals

“And they embittered him and contended with him—all the Egyptian sorcerers—and they even ‘ate his pieces’ (accused him) before Pharaoh.

“They hoped to strike him down from his honor; they spoke against him with a triple tongue which is as hard and sharp as arrows.”

24 But his bow abode in strength, and the arms of his hands were made strong by the hands of the mighty God of Jacob, from thence is the Shepherd, the Stone of Israel, — but Joseph’s bow abode in strength; God, the mighty God of Jacob; the Shepherd and Stone of Israel, came to Joseph’s rescue;

— Joshua, a descendant of Joseph, by Ephraim, may be a foretaste intended. He, as a solid shepherd, brought into the promised land of Canaan that flock of the Lord which Moses had indeed led forth from Egypt, but which he had left in a barren wilderness;

— say it differently, in the last days, the children of Joseph, Ephraim and Manasseh, the US and the UK, will have an enemy, or enemies, who would strike them with projectiles, artilleries, missiles, drones and even high-powered laser; but that Ephraim and Manasseh will strike back, and be triumphant not by their own hands but “by the hands of the mighty God of Jacob;”

— the Targum Onkelos says

His bow remained in strength, [His prophecy was fulfilled in them, because he secretly kept the Torah. He placed his trust in the Almighty,] his arms were bedecked with gold, [therefore, gold was placed on his arms / and he inherited kingship and power.] by the hand of Mighty One of Yaakov [This was for him from before the Mighty God of Yaakov]; from there he became the shepherd [the provider], [who by His Word sustained] the stone of Israel [the fathers and sons of the seed of Israel].

— the Targum of Jonathan reveals

“And his strength returned to its former state, and the strength of his limbs [prevailed] so as not to have relations with his mistress.

“And his hands were scattered (withheld) from the seed of desire, and he subdued his inclination through the powerful teaching he received from Jacob.

“Because of this, he was found worthy to become a sustainer and to be joined in the engraving of the names upon the Stones of Israel (the Breastplate).”

25 even by the God of thy father, who shall help thee, and by the Almighty, who shall bless thee with blessings of heaven above, blessings of the deep that lieth under, blessings of the breasts and of the womb.

— blessings of heaven above are the rains and dew; those of “the deep” beneath are lakes, rivers, and springs; and those of “the breasts and womb” mean an abundant offspring both of men and cattle;

— the Targum Onkelos says

From the Almighty [The Word of the God] of your father and He will help you [will be your support], and Shaddai Who will bless you with the blessings of [that descend from the dew of the] heaven from above, blessings [that flow] of [from] the depths [of the earth] that lie below, blessings of seed and womb [your father and your mother].

— the Targum of Jonathan reveals

“From the Word of the God of your father, let there be your help; and from He who is called Shaddai, may He bless you with blessings that descend from the dew of the heavens above, and with the good blessings of the springs of the deep that rise up and cover the sprouts from below.

“Blessed shall be the breasts from which you sucked, and the womb in which you lay.”

26 The blessings of thy father have prevailed above the blessings of my progenitors unto the utmost bound of the everlasting hills; they shall be on the head of Joseph, and on the crown of the head of him that was separate from his brethren.

— it means that the blessings which Jacob bestows upon Joseph are greater than those which he had himself received from his ancestors, Abraham and Isaac; but only earthly prosperity, as the chief spiritual blessing was bestowed upon Judah;

— the Targum Onkelos says

The blessings that [of] your father [received] are stronger than [will be in addition to] the blessings [with which] my forebears [received] [blessed me] even to the boundaries of the eternal hills [for which the righteous of the earth longed]; they [all these] shall be on Yoseif’s head, on the crown of him who is a Nazirite among his brothers [and on the man who was separated from his brothers].

— the Targum of Jonathan reveals

“The blessings of your father shall be added upon the blessings with which my fathers, Abraham and Isaac, blessed me—blessings which the great ones of the world, Ishmael and Esau and all the sons of Keturah, longed for.

“May all these blessings be gathered and made into a crown of greatness for the head of Joseph, and for the crown of the head of the man who was Ruler and Governor in Egypt, yet was [still] careful of the honor of his brothers.”

— the Jonathan added: “That the great ones (nobles, princes) of the world — Ishmael, Esau, and all the sons of Keturah, have coveted,” symbolizing his greatness and elevated position. Ephraim’s primary emblem was an ox, with his horns, its secondary emblem, being that of a unicorn.

27 “Benjamin shall raven as a wolf; in the morning he shall devour the prey, and at night he shall divide the spoil.” — the tribe, Benjamin~Norway&Iceland; compared to a wolf, but Judah was like a lion; a wolf famed for its fortitude, courage, and valour, as well as for its rapaciousness, it being a warlike tribe;

— both of these modern countries were heavily influenced by Viking exploration, which always involved plundering, pillaging and “dividing the spoil,”

— the Targum Onkelos says

Binyamin is like a wolf that preys. [: the Shechina will dwell in his land, and in his inheritance the Temple will be built.] In the morning [and towards evening] he will eat a portion [the Cohanim will offer sacrifices], and in the evening he will divide the spoil [and in the evening-time they will divide their left over share from other sacred things].

— the Targum of Jonathan reveals

“Benjamin is a mighty tribe, like a wolf [in strength]; in his land shall the Shekhinah of the Lord of the World dwell, and in his inheritance shall the House of the Sanctuary be built.

“In the morning, the priests shall offer the continual lamb until the fourth hour; and between the suns (twilight), they shall offer the second lamb.

“And in the evening, they shall divide the remainder of the rest of the sacrifices, and each man shall eat his portion.”

28 All these are the twelve tribes of Israel, and this is it that their father spoke unto them and blessed them; every one according to his blessing he blessed them.

— there were indeed thirteen tribes, two springing from Joseph; but then the tribe of Levi had no part in the land of Canaan, which was divided into twelve parts; this shows that the above predictions respect not the persons of the patriarchs, but their tribes;

— why, then, does the verse state: each man in accordance with his blessing he blessed them? It is because he blessed them [by comparing] Judah to a lion, Dan to a serpent, Naphtali to a doe, Benjamin to a wolf, and he then included them all and rendered them lions and rendered them serpents;

— the Targum Onkelos says

All these are tribes of Israel, twelve [of them]; and this is what their father spoke to them and he blessed them. He blessed them each with his own unique blessing.

— the Targum of Jonathan reveals

“All these are the tribes of Israel, twelve in number; all of them are righteous as one. And this is what their father spoke to them when he blessed them; each man according to his own [specific] blessing, he blessed them.”

29 And he charged them and said unto them, “I am to be gathered unto my people. Bury me with my fathers in the cave that is in the field of Ephron the Hittite, — bury me with my fathers; his body, he orders to be interred with his fathers Abraham and Isaac;

— the Targum Onkelos says

He commanded them, and said to them, I shall be gathered to my people; bring me for burial to my fathers, to the cave that is in the field of Ephron the Chittite.

— the Targum of Jonathan reveals

“And he commanded them and said to them: ‘I am being gathered to my people. Bury me with my fathers in the cave that is in the field of Ephron the Hittite.'”

30 in the cave that is in the field of Machpelah, which is before Mamre, in the land of Canaan, which Abraham bought with the field of Ephron the Hittite for a possession as a burying place.

— the Targum Onkelos says

In the cave that is in the field of Machpeilah, which faces Mamrei in the land of Canaan; which Avraham bought, along with the field, from Ephron, the Chittite, for a possession as a burial place.

— the Targum of Jonathan reveals

“In the cave that is in the field of Machpelah (the Double), which is before Mamre in the land of Canaan, which Abraham bought with the field from Ephron the Hittite for a possession of a burial place.”

31 There they buried Abraham and Sarah his wife; there they buried Isaac and Rebekah his wife, and there I buried Leah. — there they buried Abraham and Sarah his wife; Abraham buried Sarah there himself, and his two sons, Isaac and Ishmael, buried him there;

— there they buried Isaac and Rebekah his wife; we have no other account of the death of Rebekah, and her burial, but here; it is probable she died before Isaac, and that Isaac buried her in this cave; and here Esau and Jacob buried him;

— and there I buried Leah; of whose death and burial we also read nowhere else but here; it is probable she died before Isaac, and that Isaac buried her in this cave; and here Esau and Jacob buried him;

— but for Rachel, she died when she and Jacob journey from Shechem to Hebron, a short distance from Ephrath, which is glossed as Bethlehem (35:16–21, 48:7). She dies on the way giving birth to Benjamin;

“And Rachel died, and was buried on the way to Ephrath, which is Bethlehem. And Jacob set a pillar upon her grave: that is the pillar of Rachel’s grave unto this day.” — Genesis 35:19–20

— the Targum Onkelos says

There they buried Avraham and Sarah, his wife, there they buried Yitzchok and Rivkah, his wife, and there I buried Leah.

— the Targum of Jonathan reveals

“There they buried Abraham and Sarah his wife; there they buried Isaac and Rebekah his wife; and there I buried Leah.”

32 The purchase of the field and of the cave that is therein was from the children of Heth.” — the estate was initially bought by Abraham of Ephron the Hittite, the children of Heth were witnesses of the bargain; and the payment, and by whom the estate was made sure to Abraham;

— the Targum Onkelos says

The purchase of the field and the cave that is in it was made from the sons of Cheis.

— the Targum of Jonathan reveals

“The purchase of the field and the cave that is in it [was] from the sons of the Hittite.”

33 And when Jacob had made an end of commanding his sons, he gathered up his feet into the bed and yielded up the ghost, and was gathered unto his people. — Jacob died an easy death, without any pain or sickness; of his age one hundred and forty seven;

— the Targum Onkelos says

Yaakov concluded his commands to his sons, and he gathered up his feet, to the bed. He expired and was gathered to his people.

— the Targum of Jonathan reveals

“And Jacob finished commanding his sons; and he gathered his feet into the bed, and he expired, and was gathered unto his people.”

~~~~~

And more details on the identities of the twelve tribes from Ezekiel 48

Of the four directions:

—— (North) Reuben~France; Judah&Levi~Israel;
—— (East) Joseph~US&UK; Benjamin~Norway&Iceland; Dan~Ireland&Denmark;
—— (South) Simeon~scattered throughout; Issachar~Finland; Zebulun~Holland;
—— (West) Gad~Switzerland; Asher~Belgium; Naphtali~Sweden

The identities of the various tribes above are largely drawn from the researches done by Steven Collins and from Yair Davidiy below; although there is a slight variant between them. Both, however, are erroneous in their identities of Ephraim and Manasseh.

The Tribes of Joseph dominate the USA, Britain and other Anglo-Saxon nations. Manasseh, representing the Unicorn, is especially evident in the UK, and also in Scotland. The Tribe of Reuben prevails in France;

Issachar in Switzerland and Finland; Benjamin in Belgium; Zebulon in the Netherlands; Dan in Denmark, as well as in Ireland, and parts of Britain; Naphtali in Norway, Gad in Sweden. The Tribe of Asher may be seen in Ireland; Ephraim, Manasseh and Judah in Ulster.

The Jewish People on the other hand derives mainly from the Tribes of Judah, Benjamin and Levi with minority element from the others.

For understanding who the modern tribes of Judah and Joseph are, the best book to have expounded this subject is “Judah’s Sceptre and Joseph’s Birthright” by J.H. Allen (1847-1930).

For more details on  the identities of Ephraim and Manasseh, see (1) The Birthrights (2) Ephraim and Manasseh (3) Ephraim as the Thirteenth Tribe (4) Who is this lying Ephraim? (5) The Ox with horns of a Unicorn

Genesis 50

1 And Joseph fell upon his father’s face, and wept upon him, and kissed him. — probably the rest of Jacob’s sons and grandsons did the same, much moved, no doubt, with his dying words;

— the Targum Onkelos says

Yoseif fell on the face of his father, and wept over him and kissed him.

— the Targum of Jonathan reveals

“And Joseph arranged his father upon a bed of ivory, overlaid with good gold, set with precious stones, and fastened with cords of fine linen. There they poured out spiced wines, and there they burned prime spices.

“There stood the mighty men of the House of Esau and the mighty men of the House of Israel. There stood the Lion, Judah, the strongest of his brothers; he answered and said to his brothers:

“‘Come, let us build over our father a lofty Cedar, whose top reaches the end of the heavens, while its branches overshadow all the inhabitants of the earth, and its roots reach down to the lands of the Deep. From him arose twelve tribes; from him are destined to arise kings and rulers, and priests in their divisions to offer sacrifices, and Levites in their sections to sing.’

“Thereupon, Joseph bent over his father’s face, and wept over him, and kissed him.”

And Joseph commanded his servants the physicians to embalm his father; and the physicians embalmed Israel. — and the physicians embalmed him; with spices, ointments and other things necessary for the preservation of the body from putrefaction as long as might be;

— the Targum Onkelos says

Yoseif commanded his servants, the physicians, to embalm his father and the physicians embalmed Yisrael.

— the Targum of Jonathan reveals

“And Joseph commanded his servants, the physicians, to spice (embalm) his father; and the physicians spiced Israel.”

And forty days were fulfilled for him (for so are fulfilled the days of those who are embalmed), and the Egyptians mourned for him threescore and ten days. — the process of embalming as occupying forty days and mouning continued until seventy days;

— the Targum Onkelos says

They completed forty days [of embalmment] for him, for that is the number of days required for embalming. The Egyptians wept for him seventy days.

— the Targum of Jonathan reveals

“And forty days were completed for him—for so are the days of spicing (embalming) completed; and the Egyptians wept for him seventy days.

“They said to one another: ‘Come, let us weep for Jacob the Pious, through whose merit the famine passed away from the land of Egypt. For there had been a decree for the famine to last forty-two years, but through the merit of Jacob, forty years were withheld from Egypt, and there was famine for only two years alone.'”

And when the days of his mourning were past, Joseph spoke unto the house of Pharaoh, saying, “If now I have found grace in your eyes, speak, I pray you, in the ears of Pharaoh, saying, — that Joseph did not address himself directly to Pharaoh, but through the members of the royal household;

— the Targum Onkelos says

[When] the days of weeping were over, Yoseif spoke to the house of Pharaoh saying, If I have found favor in your eyes, please [now] speak in [before] Pharaoh’s ears, saying.

— the Targum of Jonathan reveals

“And the days of his weeping passed; and Joseph spoke with the lords of the house of Pharaoh, saying: ‘If now I have found mercy in your eyes, speak now in the hearing of Pharaoh, saying:'”

‘My father made me swear, saying, “Lo, I die; in my grave which I have dug for myself in the land of Canaan, there shalt thou bury me.” Now therefore let me go up, I pray thee, and bury my father, and I will come again.’”

— the Targum Onkelos says

My father made me swear [an oath] saying, Behold I am dying. In my grave that I have prepared for myself in the land of Canaan, there you shall bury me. Now therefore, please [now], I would go up and bury my father, and then I will return.

— the Targum of Jonathan reveals

“‘My father made me swear, saying: “Behold, I am dying; in my grave which I have prepared (digged) for myself in the land of Canaan, there you shall bury me.” And now, let me go up now and bury my father, and I will return.'”

And Pharaoh said, “Go up, and bury thy father, according as he made thee swear.”

— the Targum Onkelos says

Pharaoh said, Go up and bury your father, just as he made you swear.

— the Targum of Jonathan reveals

“And Pharaoh said: ‘Go up and bury your father, just as he made you swear.'”

And Joseph went up to bury his father; and with him went up all the servants of Pharaoh, the elders of his house and all the elders of the land of Egypt,

— the Targum Onkelos says

Yoseif went up to bury his father; and with him went up all Pharaohs servant’s, the elders of this house, and all the elders of the land of Egypt,

— the Targum of Jonathan reveals

“And Joseph went up to bury his father; and with him went up all the servants of Pharaoh, the elders of his house, and all the elders of the land of Egypt.”

and all the house of Joseph, and his brethren, and his father’s house. Only their little ones, and their flocks and their herds, they left in the land of Goshen.

— the Targum Onkelos says

And all Yoseif’s household, his brothers and his father’s household. Only their little ones, their sheep and their cattle did they leave behind in the land of Goshen.

— the Targum of Jonathan reveals

“And all the men of the house of Joseph, and his brothers, and the house of his father; only their little ones, and their flocks, and their oxen, they left behind in the land of Goshen.”

And there went up with him both chariots and horsemen; and it was a very great company.

— the Targum Onkelos says

With him also went up chariots and horsemen. It was a very imposing camp.

— the Targum of Jonathan reveals

“And there went up with him also chariots and also horsemen; and it was a very great camp.”

10 And they came to the threshing floor of Atad, which is beyond the Jordan, and there they mourned with a great and very sore lamentation; and he made a mourning for his father seven days.

— the Targum Onkelos says

They came to the threshing place of Atad, which is on the other side of the Jordan, and there they eulogized [him and held] a very great and imposing funeral. He [Yoseif] made seven days of mourning for his father.

— the Targum of Jonathan reveals

“And they came to the threshing floor of Atad, which is beyond the Jordan; and they lamented there with a very great and powerful lamentation; and he made for his father a mourning of seven days.”

11 And when the inhabitants of the land, the Canaanites, saw the mourning at the floor of Atad, they said, “This is a grievous mourning of the Egyptians.” Therefore the name of it was called Abelmizraim [that is, The mourning of the Egyptians], which is beyond the Jordan.

— the Targum Onkelos says

The Canaanites who lived in the land saw the mourning in the threshing place of Atad, and they said, This is heavy mourning for Egypt. It was therefore named Egypt’s Mourning, which is on the other side of the Jordan.

— the Targum of Jonathan reveals

“And the inhabitants of the land, the Canaanites, saw the mourning at the threshing floor of Atad, and they untied the belts of their loins because of the honor of Jacob; and they pointed with their hands and said: ‘This is a powerful mourning for the Egyptians.’ Therefore, the name of the place was called Abel Mizraim, which is beyond the Jordan.”

12 And his sons did unto him according as he commanded them.

— the Targum Onkelos says

His sons did for him as he commanded them.

— the Targum of Jonathan reveals

“And his sons did for him exactly as he had commanded them.”

13 For his sons carried him into the land of Canaan, and buried him in the cave of the field of Machpelah, which Abraham bought with the field for a possession as a burying place from Ephron the Hittite, before Mamre.

— the Targum Onkelos says

His sons carried him to the land of Canaan, and buried him in the cave of the field of Machpeilah, which Avraham purchased along with the field, for a possession as a burial place, from Ephron, the Chittite, facing Mamrei.

— the Targum of Jonathan reveals Joseph’s continuing conflict with Esau, who was still alive

“And his sons carried him to the land of Canaan. And the report was heard by Esau the Wicked, and he set out from the mountain of Gabla (Seir) with many legions, and came to Hebron, and would not allow Joseph to bury his father in the Double Cave.

“Immediately, Naphtali went and ran, and went down to Egypt and returned on that same day, and brought the Deed of Sale which Esau had written to Jacob his brother for his half of the Double Cave.

“And immediately, Chushim the son of Dan signaled; he took a sword and cut off the head of Esau the Wicked. And the head of Esau rolled until it entered the cave and rested in the bosom of Isaac his father. And the sons of Esau buried his body in the field of the Double [Cave]. And afterward, his sons buried Jacob in the cave of the field of the Double [Cave], which Abraham had bought as a possession for a burial place from Ephron the Hittite, before Mamre.”

14 And Joseph returned into Egypt, he and his brethren and all who went up with him to bury his father, after he had buried his father.

— the Targum Onkelos says

Yoseif returned to Egypt, he and his brothers, and all those who went with him, to bury his father, after he had buried his father.

— the Targum of Jonathan reveals

“And Joseph returned to Egypt, he and his brothers, and all who had gone up with him to bury his father, after he had buried his father.”

15 And when Joseph’s brethren saw that their father was dead, they said, “Joseph will perhaps hate us, and will certainly requite us all the evil which we did unto him.”

— the Targum Onkelos says

Yoseif’s brothers saw that their father was dead, and they said, Perhaps Yoseif still bears a grudge against us. He will then certainly repay us for all the evil that we did him.

— the Targum of Jonathan reveals

“And the brothers of Joseph saw that their father was dead; and [they saw] that he was no longer turning to them to eat together as one; and they said: ‘What if Joseph bears a grudge against us, and surely returns to us all the evil that we dealt him?'”

16 And they sent a messenger unto Joseph, saying, “Thy father did command before he died, saying,

— the Targum Onkelos says

They sent a command to Yoseif saying, Your father issued a command before his death, saying,

— the Targum of Jonathan reveals

“And they commanded Bilhah to say to Joseph: ‘Your father commanded before his death, saying to you:'”

17 ‘So shall ye say unto Joseph, “Forgive, I pray thee now, the trespass of thy brethren and their sin, for they did unto thee evil.”’ And now, we pray thee, forgive the trespass of the servants of the God of thy father.” And Joseph wept when they spoke unto him.

— the Targum Onkelos says

This is what you should say to Yoseif, Please forgive the transgression of your brothers and their sin, for they did evil to you. And now please forgive [now] the transgr ession of the servants of the God of your father. Yoseif wept as his brothers spoke to him.

— the Targum of Jonathan reveals

“Thus shall you say to Joseph: ‘I beseech you, forgive now the rebellion of your brothers and their sins, for they dealt evil to you; and now, forgive, I pray, the rebellion of the servants of the God of your father.’ And Joseph wept when they spoke with him.”

18 And his brethren also went and fell down before his face, and they said, “Behold, we are thy servants.”

— the Targum Onkelos says

His brothers also went and threw themselves down before him, and they said, Behold, we are your slaves.

— the Targum of Jonathan reveals

“And his brothers also went and bowed down before him, and they said: ‘Behold, we are your servants.'”

19 And Joseph said unto them, “Fear not; for am I in the place of God?

— the Targum Onkelos says

Yoseif said to them, Fear not. For am I in place of Elohim? [For I am one who fears Elohim]

— the Targum of Jonathan reveals

“And Joseph said to them: ‘Fear not; for I will not repay you with evil, but only with good; for I am one who fears and is broken from before the Presence of the Lord.'”

20 But as for you, ye thought evil against me, but God meant it unto good to bring to pass as it is this day, to save many people alive.

— the Targum Onkelos says

You meant to do evil to me, but [from before] Elohim [it was meant] meant it for good, in order to do as it is today, to preserve the lives of a great people.

— the Targum of Jonathan reveals

“And you thought against me evil thoughts—that because I was no longer turning to eat with you, it was because I was guarding an enmity against you. But the Word of the Lord thought it toward me for good; for [while] my father used to seat me at the head, and from before his honor I would receive [it], now I do not receive [that honor], so that I may merit to have salvation wrought for us as on this day, to sustain a great people from the House of Jacob.”

21 Now therefore fear ye not; I will nourish you and your little ones.” And he comforted them, and spoke kindly unto them.

— the Targum Onkelos says

And now, fear not. I will provide for you and your little ones. He comforted them and spoke [words of consolation] to their hearts.

— the Targum of Jonathan reveals

“And now, fear not; I will sustain you and your little ones; and he comforted them and spoke comforts upon their hearts.”

22 And Joseph dwelt in Egypt, he and his father’s house; and Joseph lived a hundred and ten years.

— the Targum Onkelos says

Yoseif lived in Egypt, he and his father’s household. Yoseif lived one hundred and ten years.

— the Targum of Jonathan reveals

“And Joseph dwelt in Egypt, he and his father’s house; and Joseph lived one hundred and ten years.”

23 And Joseph saw Ephraim’s children of the third generation. The children also of Machir the son of Manasseh were brought up upon Joseph’s knees.

— the Targum Onkelos says

Yoseif saw Ephraim’s children of the third generations. The children of Machir, Menasheh’s son, were born [and Yoseif rasied them] on Yoseif’s knees.

— the Targum of Jonathan reveals

“And Joseph saw of Ephraim sons of the third generation; also the sons of Machir, the son of Manasseh; when they were born, Joseph circumcised them.”

24 And Joseph said unto his brethren, “I die; and God will surely visit you, and bring you out of this land unto the land which He swore to Abraham, to Isaac, and to Jacob.”

— the Targum Onkelos says

Yoseif said to his brothers, I will die, and Elohim will surely consider you and bring you up out of this land, to the land which He swore to Avraham, Yitzchok and to Yaakov.

— the Targum of Jonathan reveals

“And Joseph said to his brothers: ‘Behold, I am dying; but the Lord will surely remember you, and will bring you up from this land to the land which He swore to Abraham, to Isaac, and to Jacob.'”

25 And Joseph took an oath from the children of Israel, saying, “God will surely visit you, and ye shall carry up my bones from hence.”

— the Targum Onkelos says

Yoseif made the sons of Yisrael swear, saying, Elohim will surely consider you, and you shall bring my bones up from here.

— the Targum of Jonathan reveals

“And Joseph made the sons of Israel swear, saying to their sons: ‘Behold, you are going to be enslaved in Egypt; and you shall not presume to go up from Egypt until the time that the two redeemers come and say to you: “The Lord has surely remembered you.” And at the time that you go up, you shall bring up my bones from here.'”

26 So Joseph died, being a hundred and ten years old. And they embalmed him, and he was put in a coffin in Egypt.

— the Targum Onkelos says

Yoseif died being a hundred and ten years old. They embalmed him and he was placed in a coffin in Egypt. Chazak

— the Targum of Jonathan reveals

“And Joseph died, a son of one hundred and ten years; and they embalmed him, and they crowned him, and they placed him in a sarcophagus, and they submerged him in the midst of the Nile of Egypt.”

~ THE END ~

Judah’s Sceptre and Joseph’s Birthright

•April 20, 2026 • Leave a Comment

Below is a gist of “Judah’s Sceptre and Joseph’s Birthright” by J. H. Allen (published 1902)

Judah’s sceptre represents the royal line and kingship, while Joseph’s birthright signifies the preeminent inheritance and leadership among the tribes of Israel.

“For Judah prevailed above his brethren, and from him came the chief ruler, but the birthright was Joseph’s” 1 Chronicles 5:2

Judah’s Sceptre

The sceptre is a symbol of royal authority and governance, promised to the tribe of Judah. This covenant originates from Genesis 49:10, where Jacob prophesies that the scepter will not depart from Judah until the coming of the one to whom it belongs.

And kings shall come out of thee, Genesis 17:6; and this aligns with the British Royalty in Great Britain; but not in the modern state of Israel

Historically, this line produced the Davidic kings, culminating in the expectation of a future king, ultimately fulfilled in Christian theology by Jesus Christ, who is seen as the Messiah from Judah’s lineage. The sceptre emphasizes divine choice in leadership, ensuring that Judah’s descendants would hold the throne of Israel and maintain the royal covenant.

Joseph’s Birthright

The birthright, in contrast, refers to the special inheritance and preeminence among the tribes, originally belonging to the firstborn. In the case of Joseph, although he was not the firstborn of Isaac’s sons, he received the birthright through Jacob, who purchased it from Esau. This birthright included material blessings, multiplication of descendants, and leadership over the other tribes. Jacob.

A Lion and Three Lions in the Royal Coat of Arms of the United Kingdom

Joseph’s sons, Ephraim and Manasseh, were granted prominence, with Ephraim often taking precedence, symbolizing the spiritual and national leadership of the northern tribes of Israel.

To Abraham, God promised:

“And I will make thee exceeding fruitful, and I will make nations of thee, and kings shall come out of thee” Genesis 17:6

To Jacob, his posterity spreading to all directions of the earth

“And thy seed shall be as the dust of the earth, and thou shalt spread abroad to the west and to the east, and to the north and to the south; and in thee and in thy seed shall all the families of the earth be blessed” Genesis 28:14

Judah’s sceptre: Focused on royal authority and kingship, tied to the Davidic line and the promise of a future ruler.

Joseph’s birthright: Focused on inheritance, multiplication, and leadership among the tribes, particularly the northern kingdom of Israel.

Great Seal of the United States – thirteen Stars, thirteen Arrows, thirteen Leaves and thirteen Olives – hence the Seal of being the thirteenth tribe

The two covenants illustrate a division of roles among Israel’s tribes: Judah for kingship and governance, Joseph for national leadership and expansion. Historically, this distinction is reflected in the ten-tribed kingdom of Israel (Joseph/Ephraim) and the three-tribed kingdom of Judah (Judah, Benjamin, and Levi), with their respective prophetic destinies and historical paths

Historical and Prophetic Context

The sceptre and birthright are not merely symbolic; they have historical fulfillment in the lineage of kings and the development of Israelite tribes. Judah maintained the royal line through David, while Joseph’s descendants became prominent in the northern kingdom.

Prophetic interpretations suggest that these covenants also point to future spiritual and national roles, with Judah’s sceptre culminating in the Messiah and Joseph’s birthright representing the leadership and blessings of Israel among nations.

Judah’s Sceptre and Joseph’s Birthright by J. H. Allen (published 1902)

In summary, understanding Judah’s sceptre and Joseph’s birthright provides insight into the divine plan for leadership, inheritance, and prophecy within Israel, highlighting the distinct yet complementary roles of these two tribes in biblical history and prophecy.

Judah’s Sceptre and Joseph’s Birthright by J. H. Allen (published 1902)

For a free online copy, click archive.org

For a hard copy on hand to read, Amazon

Genesis (47-48)

•April 19, 2026 • Leave a Comment

~~~~~

~~~~~

Genesis 47

1 Then Joseph came and told Pharaoh, and said, “My father and my brethren, and their flocks and their herds and all that they have, have come out of the land of Canaan; and behold, they are in the land of Goshen.”

— behold, they have already arrived in the land of Goshen; though Joseph had all along wished this to be the dwelling-place of his brethren, yet it was necessary to obtain Pharaoh’s permission; and at present Joseph only mentions that they had halted there;

— the Targum Onkelos says

Yoseif came and told Pharaoh, and he said, My father, and my brothers, their sheep, their cattle, and all their possessions, have come from the land of Canaan, and they are now in the land of Goshen.

And he took some of his brethren, even five men, and presented them unto Pharaoh.

— the Targum Onkelos says

From among his brothers, he took five men, and he presented them to Pharaoh.

— the Targum of Jonathan identifies the five men as “Zebulon, Dan, Naphtali, Gad, and Asher”

And Pharaoh said unto his brethren, “What is your occupation?” And they said unto Pharaoh, “Thy servants are shepherds, both we and also our fathers.”

— the Targum Onkelos says

Pharaoh said to his brothers, What is your occupation? They said to Pharaoh, Your servants are shepherds, we and our fathers.

They said moreover unto Pharaoh, “To sojourn in the land have we come, for thy servants have no pasture for their flocks; for the famine is sore in the land of Canaan. Now therefore, we pray thee, let thy servants dwell in the land of Goshen.”

— the Targum Onkelos says

They said to Pharaoh, We have come to live in the land temporarily, since there is no pasture for your servant’s flocks, because the famine is severe in the land of Canaan. Now then, please let your servants [now] settle in the land of Goshen.

And Pharaoh spoke unto Joseph, saying, “Thy father and thy brethren have come unto thee.

— the Targum Onkelos says

Pharaoh said to Yoseif, Your father and your brothers have come to you.

The land of Egypt is before thee. In the best of the land make thy father and brethren to dwell; in the land of Goshen let them dwell; and if thou knowest any industrious men among them, then make them rulers over my cattle.”

— and if thou knowest any men of activity among them, then make them rulers over my cattle; Pharaoh offered to employ them as shepherds, provided they were active men; also, of body or mind, fit for royal employment of flocks and herds;

— the Targum Onkelos says

The land of Egypt is before you. In the best of the land, settle your father and your brothers. Let them settle in the land of Goshen. If you know of capable men among them, appoint them livestock officers over my [herds.]

And Joseph brought in Jacob his father, and set him before Pharaoh; and Jacob blessed Pharaoh. — Jacob blessed Pharaoh;

— the patriarch’s grateful return for Pharaoh’s great kindness and generosity toward him and his house, which is repeated below, Genesis 47:10, as being a circumstance very remarkable;

— the Targum Onkelos says

Yoseif [then] brought in Yaakov, his father, and presented him to Pharaoh; and Yaakov blessed Pharaoh.

And Pharaoh said unto Jacob, “How old art thou?” — how many are the days of the years of thy life? 

— and Jacob replied Pharaoh, the days of the years of my pilgrimage (literally, of my sojournings, wanderings to and fro without any settled condition) are an hundred and thirty years;

— the Targum Onkelos says

Pharaoh said to Yaakov, How many are the years of your life?

And Jacob said unto Pharaoh, “The days of the years of my pilgrimage are a hundred and thirty years. Few and evil have the days of the years of my life been, and have not attained unto the days of the years of the life of my fathers in the days of their pilgrimage.”

— Jacob’s life till now is fell short of that of his ancestors in respect of duration (witness the 175 years of Abraham, and the 180 of Isaac)

— the Targum Onkelos says

Yaakov said to Pharaoh, The years of my temporary residence are one hundred and thirty years. Few and troublesome have been the days of my life. I have not attained the years of my father’s lives, in the days of their temporary residence.

10 And Jacob blessed Pharaoh, and went out from before Pharaoh.

— the Targum Onkelos says

Yaakov blessed Pharaoh, and left Pharaoh’s presence.

11 And Joseph placed his father and his brethren, and gave them a possession in the land of Egypt, in the best of the land, in the land of Rameses, as Pharaoh had commanded. — the land of Rameses; “best of the land” this description of the land of Goshen appears only here;

— the Targum Onkelos says

Yoseif settled his father and his brothers, and gave them a possession in the land of Egypt, in the best part of the land, in the land of Ramseis, as Pharaoh had ordered.

12 And Joseph nourished his father and his brethren and all his father’s household with bread, according to their families. — the famine still continuing,

— during which time Joseph, as a dutiful and affectionate son, and as a kind brother, supplied them with all necessary provision, signified by bread;

— the Targum Onkelos says

Yoseif provided his father, his brothers, and all his father’s household with bread according to [the needs of] the children.

13 And there was no bread in all the land; for the famine was very sore, so that the land of Egypt and all the land of Canaan fainted by reason of the famine.

— there was no bread in all the land; this probably refers to the second year of the famine when any little stores of individuals or families were exhausted and when the people had become universally dependent on the government;

— the Targum Onkelos says

There was no bread in all the land, for the famine was very severe. The [the people of the] land of Egypt, and Canaan were worn out because of the famine.

14 And Joseph gathered up all the money that was found in the land of Egypt and in the land of Canaan for the corn which they bought; and Joseph brought the money into Pharaoh’s house.

— and Joseph brought the money into Pharaoh’s house: into his repository, as the Targum of Jonathan, into his treasury, not into his own house or coffers, in which he acted the faithful servant of Pharaoh;

— the Targum Onkelos says

Yoseif gathered up all the money that was to be found in the land of Egypt, and in the land of Canaan, through the purchases [grain] they made. Yoseif brought the money to the house of Pharaoh.

15 And when money failed in the land of Egypt and in the land of Canaan, all the Egyptians came unto Joseph and said, “Give us bread; for why should we die in thy presence? For the money faileth.”

— all the Egyptians came unto Joseph, and said, give us bread; freely, for nothing, since they had no money to buy any with;

— the Targum Onkelos says

When the money was used up in the land of Egypt, and in the land of Canaan, all [the people of] Egypt came to Yoseif, saying, Give us bread; why should we die in your presence, [just] because there is no money?

16 And Joseph said, “Give your cattle; and I will give to you for your cattle, if money fail.” — and I will give you for your cattle, if money fail; that is, corn or wheat for cattle, if they had no money to give;

— the Targum Onkelos says

Yoseif said, Bring your livestock, and I will give you [food] [in exchange] for your livestock if there is no more money.

17 And they brought their cattle unto Joseph; and Joseph gave them bread in exchange for horses and for the flocks, and for the cattle of the herds and for the asses; and he fed them with bread for all their cattle for that year.

— the Targum Onkelos says

They brought their livestock to Yoseif, and Yoseif gave them bread [in exchange] for their horses, their flocks of sheep, their herds of cattle and their donkeys. He tended [sustained] them with bread in exchange for all their livestock, in that year.

18 When that year was ended, they came unto him the second year, and said unto him, “We will not hide it from my lord that our money is spent; my lord also hath our herds of cattle. There is not anything left in the sight of my lord but our bodies and our lands.

— the seventh year is now come; their silver and cattle are now gone. Nothing remains but their lands, and with these themselves as serfs orr slaves of the Pharaoh;

— the Targum Onkelos says

That year came to an end. They came to him in the second year, and they said to him, We are holding nothing back from my master, for the money is used up, and the herds of cattle belong to my master. There is nothing left before my master except our bodies and our land.

19 Why shall we die before thine eyes, both we and our land? Buy us and our land for bread, and we and our land will be servants unto Pharaoh; and give us seed, that we may live and not die, that the land be not desolate.”

— all the desperate Egyptians cried before their Pharaoh, willing to serve as his slaves;

— the Targum Onkelos says

Why should we die before your eyes, both we and our land? Buy us and our land [in exchange] for bread. We and our land will become slaves to Pharaoh. Give us seed grain, let us live and not die, and let the land not become desolate [uncultivated].

20 And Joseph bought all the land of Egypt for Pharaoh; for the Egyptians sold every man his field, because the famine prevailed over them; so the land became Pharaoh’s.

— and we and our land will be servants unto Pharaoh; both should be his; they would hold their land of him, and be tenants to him;

— the Targum Onkelos says

Yoseif bought all the land of Egypt for Pharaoh, for every Egyptian sold his field, because the famine was severe upon them. Thus the land became Pharaoh’s [property.]

21 And as for the people, he removed them to cities, from one end of the borders of Egypt even to the other end thereof. — in the cities, the people would be sure of nourishment only if they were in the immediate neighbourhood of the food;

— the Targum Onkelos says

He [Yoseif] then transferred the people to cities [from city to city], from one end of the border of Egypt to the other.

22 Only the land of the priests bought he not; for the priests had a portion assigned them by Pharaoh, and ate their portion which Pharaoh gave them. Therefore they sold not their lands. — it was then the custom in Egypt for the priests to have a daily allowance of cooked food;

— the Targum Onkelos says

But the land of the priests he did not buy, because the priests had an allotment from Pharaoh. They ate the allotment that Pharaoh gave them, and therefore they did not sell their land.

23 Then Joseph said unto the people, “Behold, I have bought you this day and your land for Pharaoh. Lo, here is seed for you, and ye shall sow the land.

— the Targum Onkelos says

Yoseif said to the people, Behold, I have today purchased you and your lands for Pharaoh. Here is seed, plant [it in] the soil.

24 And it shall come to pass in the harvest, that ye shall give a fifth part unto Pharaoh, and four parts shall be your own for seed of the field and for your food, and for those of your households and for food for your little ones.”

— the fifth part unto Pharaoh; a fifth part or 20% of their production;

— the Targum Onkelos says

When it produces [the produce is gathered] you must give a fifth to Pharaoh. Four parts shall be yours for seed for your fields and for your food, and for those [the people] of your households, and for food for your little ones.

25 And they said, “Thou hast saved our lives. Let us find grace in the sight of my lord, and we will be Pharaoh’s servants.” — we will be Pharaoh’s servants; signifying, that they esteemed it a great favour to be so on the foot of the bargain made with them;

— the Targum Onkelos says

They said, You have saved our lives. May we find favor in the eyes of my master, and we will be slaves to Pharaoh.

26 And Joseph made it a law over the land of Egypt unto this day, that Pharaoh should have a fifth part, except the land of the priests only, which became not Pharaoh’s.

— the Targum Onkelos says

Yoseif enacted a statute over the land of Egypt to this day, that a fifth belongs [they should give a fifth] to Pharaoh. Except the land of the priests alone, did not belong to Pharaoh.

27 And Israel dwelt in the land of Egypt, in the country of Goshen; and they had possessions therein, and grew and multiplied exceedingly. — in the country of Goshen or in the land of Rameses, hence this land is the same;

— the Targum Onkelos says

Yisrael lived in the land of Egypt, in the land of Goshen. They acquired property there. They were fruitful and [their population] increased greatly.

28 And Jacob lived in the land of Egypt seventeen years; so the whole age of Jacob was a hundred forty and seven years. — Jacob’s life now is 147, still short of that of his ancestors: 175 years of Abraham, and the 180 of Isaac;

— the Targum Onkelos says

Yaakov lived in the land of Egypt seventeen years. The days of Yaakov, the years of his life were one hundred and forty seven years.

29 And the time drew nigh that Israel must die, and he called his son Joseph and said unto him, “If now I have found grace in thy sight, put, I pray thee, thy hand under my thigh, and deal kindly and truly with me: bury me not, I pray thee, in Egypt.

— Joseph retained his power and place near Pharaoh after the fourteen years of special service were completed; hence, Jacob looks to him for the accomplishment of his wishes concerning the place of his burial;

— “Put thy hand under my thigh” Genesis 24:2; that is,  swear to me; this binds Joseph by a solemn asseveration to carry his mortal remains to the land of promise;

— the Targum Onkelos says

The days of Yisrael’s death drew near, and he called for his son Yoseif, and said to him, If I have found favor in your eyes, please [now], place your hand under my thigh; that you will deal kindly [with goodness] and truthfully with me. Please [Now], do not bury me in Egypt.

30 But I will lie with my fathers, and thou shalt carry me out of Egypt and bury me in their burying place.” And he said, “I will do as thou hast said.”

— bury me not, I pray thee, in Egypt; not choosing to lie among idolaters at death, with whom he cared not to have any fellowship in life;

— the Targum Onkelos says

For I will lie with my fathers. Carry me out of Egypt, and bury me in their grave. He [Yoseif said], I will do as you say.

31 And he said, “Swear unto me.” And he swore unto him. And Israel bowed himself upon the bed’s head. — and Jacob asked from Joseph; “Swear unto me”

— the right of primogeniture, the right, by law or custom, of the firstborn legitimate child, has been forfeited by Reuben; the double portion in the inheritance is now transferred to Joseph;

— the Targum Onkelos says

He [Yaakov] said, Swear to me, and he swore to him. Yisrael prostrated himself at the head of the bed.

Genesis 48

1 And it came to pass after these things that one told Joseph, “Behold, thy father is sick”; and he took with him his two sons, Manasseh and Ephraim. — Joseph’s two sons Manasseh and Ephraim destined to be fathers of two tribes in Israel, Genesis 48:5,6

Rashi Gen 48:1 that Ephraim was accustomed to study with Jacob, and when Jacob became ill in the land of Goshen, Ephraim went to his father to tell him;

— the Targum Onkelos says

After these events, someone said to Yoseif, Behold your father is [lying] ill. He took his two sons with him, Menasheh and Ephraim.

And one told Jacob and said, “Behold, thy son Joseph cometh unto thee”; and Israel strengthened himself and sat upon the bed. — and Israel strengthened himself, and sat upon his bed; his spirits revived, his strength renewed, he got fresh vigour on hearing his son Joseph was coming;

— the Targum Onkelos says

It was told to Yaakov, saying, Behold, your son, Yoseif, has come to you. Yisrael gathered his strength and sat up in bed.

And Jacob said unto Joseph, “God Almighty appeared unto me at Luz in the land of Canaan, and blessed me

— the Targum Onkelos says

Yaakov said to Yoseif, Almighty Shaddai appeared [became revealed] to me in Luz, in the land of Canaan, and He blessed me.

and said unto me, ‘Behold, I will make thee fruitful and multiply thee; and I will make of thee a multitude of people, and will give this land to thy seed after thee for an everlasting possession.’

— and I will make of thee a multitude of people; a large nation, consisting of many tribes, even a company of nations, as the twelve tribes of Israel were;

— the Targum Onkelos says

He said to me, Behold, I will make you fruitful and numerous, and I will make you into an assembly of nations [tribes]. I will give this land to your descendants after you for an everlasting possession.

And now thy two sons, Ephraim and Manasseh, who were born unto thee in the land of Egypt before I came unto thee into Egypt, are mine; as Reuben and Simeon, they shall be mine.

— thy two sons, Ephraim and Manasseh; it was the intention of the aged patriarch to adopt Joseph’s sons as his own;

— the Targum Onkelos says

And now your two sons, who were born to you in the land of Egypt before I came to you to Egypt, are mine. Ephraim and Menasheh, like Reuvein and Shimon, shall be mine [before me].

And thy issue whom thou begettest after them shall be thine, and shall be called after the name of their brethren in their inheritance. — but should be called either the children of Ephraim, or the children of Manasseh;

— the Targum Onkelos says

But your progeny that will be born after them shall be yours. They shall be called by their brother’s name with regard to their inheritance.

And as for me, when I came from Padan, Rachel died beside me in the land of Canaan on the way, when yet there was but a little way to come unto Ephrath; and I buried her there on the way to Ephrath” (the same is Bethlehem).

— Rachel died by me; this circumstance he mentions here, partly because the sight of Joseph and his children brought his beloved Rachel, Joseph’s mother, to his remembrance; and partly that he might assign a reason for transferring the right of the firstborn to Joseph;

— the Targum Onkelos says

And I, when I came from Padan, Rochel died unto me in the land of Canaan, on the road, when there was yet a stretch of land, before coming to Ephros. I buried her there on the road to Ephros, which is Beis Lechem.

And Israel beheld Joseph’s sons, and said, “Who are these?”

— the Targum Onkelos says

Yisrael saw Yoseif’s sons, and he said, Who are these?

— and said, who are these? whose sons are they? the Targum of Jonathan says, “from whom were these born to thee?”

And Joseph said unto his father, “They are my sons, whom God hath given me in this place.” And he said, “Bring them, I pray thee, unto me, and I will bless them.” — that I may bless them, not with a common, but with a paternal, and patriarchal, and prophetical blessing;

— the Targum Onkelos says

Yoseif said to his father, These are my sons, whom Elohim has given me in this [place] [here]. He [Yaakov] said, Please Take [Now bring] them [near] to me, and I will bless them.

10 (Now the eyes of Israel were dim with age, so that he could not see.) And he brought them near unto him; and he kissed them and embraced them.

— and he brought them near unto Jacob; that he might have a better sight of them and bless them: and he kissed them, and embraced them: as a token of his affection for them;

— the Targum Onkelos says

Yisrael’s eyes were heavy with age, and he could not see. He [Yoseif] brought them near to him, and he kissed them and hugged them.

11 And Israel said unto Joseph, “I had not thought to see thy face; and lo, God hath shown me also thy seed.” — God hath showed me also thy seed; it was an additional favour to see his offspring;

— the Targum Onkelos says

Yisrael said to Yoseif, I have never thought to see your face, and behold Elohim has even allowed me to see your offspring.

12 And Joseph brought them out from between his knees, and he bowed himself with his face to the earth. — he bowed himself, testifying thereby his reverence to his father, he had now showed his humble and earnest request for his blessing upon them;

— the Targum Onkelos says

Yoseif brought them out from between his knees [before him], and he prostrated himself with his face to the ground.

13 And Joseph took them both, Ephraim in his right hand toward Israel’s left hand, and Manasseh in his left hand toward Israel’s right hand, and brought them near unto him.

— the Targum Onkelos says

Yoseif took the two [of them]—Ephraim in his right [hand], toward Yisrael’s left, and Menasheh in his left, toward Yisrael’s right—and he brought them near to him.

14 And Israel stretched out his right hand and laid it upon Ephraim’s head, who was the younger, and his left hand upon Manasseh’s head, guiding his hands wittingly; for Manasseh was the firstborn.

— the Targum Onkelos says

Yisrael stretched out his right [hand] and placed it on the head of Ephraim, [although] he was the younger, and his left [hand] on the head of Menasheh. He deliberately placed his hands so, even though Menasheh was the firstborn.

15 And he blessed Joseph and said, “God, before whom my fathers Abraham and Isaac walked, the God who fed me all my life long unto this day,

— the Targum Onkelos says

He blessed Yoseif and said, Elohim before whom my fathers walked [served], Avraham, and Yitzchok, Elohim who was my shepherd [sustainer] from my inception until this day—

16 the Angel who redeemed me from all evil, bless the lads; and let my name be named on them, and the name of my fathers Abraham and Isaac; and let them grow into a multitude in the midst of the earth.”

— the Targum Onkelos says

The Angel who redeemed me from all evil, should bless the lads, and let my name be called on them, together with the name of my fathers, Avraham and Yitzchok. May they be like fish [of the sea], multiplying within [amongst people upon] the land.

17 And when Joseph saw that his father laid his right hand upon the head of Ephraim, it displeased him; and he held up his father’s hand to remove it from Ephraim’s head unto Manasseh’s head.

— the Targum Onkelos says

Yoseif saw that his father placed his right hand on Ephraim’s head, and it was bad in his eyes. He held up his fathers hand, to remove it from Ephraim’s head [and to place it] on Menasheh’s head.

18 And Joseph said unto his father, “Not so, my father, for this is the firstborn. Put thy right hand upon his head.”

— Jacob’s preference for Ephraim wasn’t out of the blue. Ephraim had Jacob’s right-hand blessing because Ephraim was accustomed to studying the Torah under Jacob (Rashi Genesis 48:1), while Manasseh, the firstborn was picked by Joseph to succeed him by being an assistant in governing Egypt;

— from a critical verse in Deuteronomy 33:17

His glory is like the firstling of his bullock, and his horns are like the horns of unicorns. With them he shall push the people together to the ends of the earth; and they are the ten thousands of Ephraim, and they are the thousands of Manasseh.” Deuteronomy 33:17

— the Targum Onkelos says

Yoseif said to his father, Not so, my father, for this one is the firstborn, place your right hand on his head.

19 And his father refused and said, “I know it, my son, I know it. He also shall become a people, and he also shall be great; but truly his younger brother shall be greater than he, and his seed shall become a multitude of nations.”

— the Targum Onkelos says

His father refused, and he said, I know my son, I know. He too will become a people, he too will become great; however his younger brother will be greater than he, and [the fame] of his descendants will fill [rule] the nations.

“I know, my son, I know that he is the firstborn,” Jacob said

20 And he blessed them that day, saying, “In thee shall Israel bless, saying, ‘God make thee as Ephraim and as Manasseh.’” And he set Ephraim before Manasseh.

— the Targum Onkelos says

He blessed them on that day saying: Through you shall [the People of] Israel bless saying; May Elohim make you as Ephraim and Menasheh. He placed Ephraim ahead of Menasheh.

21 And Israel said unto Joseph, “Behold, I die; but God shall be with you, and bring you again unto the land of your fathers.

— the Targum Onkelos says

Yisrael said to Yoseif, Behold I am dying. [The Word of] Elohim will be with you [your support], and He will bring you back to the land of your fathers.

22 Moreover I have given to thee one portion above thy brethren, which I took out of the hand of the Amorite with my sword and with my bow.”

— the Targum Onkelos says

I have given you one share more than your brothers, which I took from the hand of the Amorite with my sword [prayer] and with my bow [plea].

— the Targum of Jonathan reveals the house of Joseph to inherit the city of Shechem

“And I, behold, I have given to you the city of Shechem, one portion as a gift, more than your brothers; which I took from the hands of the Amorites at the time that you entered into it, and I arose and assisted you with my sword and with my bow.”

— “extra gift” in Jewish law, the firstborn receives a double portion. By giving Joseph “one portion more than his brothers,” Jacob is effectively confirming that the Birthright has been transferred from the eldest (Reuben) to Joseph;

— the Targum Jerusalem says

“And I, behold, I have given to you one portion more than your brothers: the garment of Adam the first [man].

“Abraham, the father of my father, took it from the hands of Nimrod the Wicked; and he gave it to Isaac my father; and Isaac my father gave it to Esau.

“But I took it from the hands of Esau my brother—not with my sword and not with my bow, but through my merit and my good deeds.”

— Ephraim before Manasseh! Who symbolises the Bullock and who is the Unicorn?

If Great Britain were truly Ephraim, then why does their Royal Standard bear the clear representation of the Unicorn – the symbol or sign of the tribe of Manasseh? The Unicorn of Great Britain identifies the British as primarily of the tribe of Manasseh. And if the unicorn is the symbol of Manasseh and the United States is “Manasseh” – why doesn’t the United States have this symbol in their national emblems and symbols?

The beginning of the story of America is the saga of the search for freedom to worship God without having to conform to the authority of a religious tyranny emanating from Europe. Today, as a whole, America remains a religious nation.

Among advanced industrialized countries, the United States is easily the most religious. Some 60 percent of its citizens say religion is very important to their lives, about six times the percentage of the French. But the divine looms even larger in most Americans’ hearts than those figures suggest. Some 90 percent say they believe in God – 94 percent if you add those who revere a ‘universal spirit’ – while less than 1 percent call themselves atheists or agnostics.

The United States was originally founded largely by Puritans, called Pilgrims, a break-away group of devout Christians who were known as Separatists, because they separated from the Church of England to follow the precepts of the Bible. Because of intense persecution, they sailed for the New World to establish a country where they could worship God in peace.

More on the identities of Ephraim and Manasseh (1) The Birthrights (2) Ephraim and Manasseh (3) Ephraim as the Thirteenth Tribe (4) Who is this lying Ephraim? (5) The Ox with horns of a Unicorn

Genesis (45-46)

•April 18, 2026 • Leave a Comment

~~~~~

And Joseph could not restrain himself before all those who stood by him

Genesis 45

1 Then Joseph could not restrain himself before all those who stood by him; and he cried, “Cause every man to go out from me!” And there stood no man with him while Joseph made himself known unto his brethren.

— the Targum Onkelos says

Yoseif could not contain his emotions in the presence of all who stood before him, and he cried out Let everyone leave my presence. No man remained with him, when Yoseif made himself known to his brothers.

And he wept aloud, and the Egyptians and the house of Pharaoh heard.

— the Targum Onkelos says

He wept aloud, and the Egyptians heard about it, and the [people of the] house of Pharaoh [also] heard.

And Joseph said unto his brethren, “I am Joseph. Doth my father yet live?” And his brethren could not answer him, for they were troubled at his presence.

— the Targum Onkelos says

Yoseif said to his brothers, I am Yoseif, is my father still alive? His brothers could not answer [a word to] him for they were shocked at his presence.

And Joseph said unto his brethren, “Come near to me, I pray you.” And they came near; and he said, “I am Joseph your brother, whom ye sold into Egypt.

— the Targum Onkelos says

[Then] Yoseif said to his brothers, Please [Now] come close to me. They came close [to him] and he said, I am Yoseif your brother, whom you sold into Egypt.

Now therefore be not grieved nor angry with yourselves that ye sold me hither, for God sent me before you to preserve life.

— the Targum Onkelos says

Now do not worry, and do not be angry with yourselves that you sold me here; for it was to preserve life that Elohim sent me [here] before you.

For these two years hath the famine been in the land, and yet there are five years in which there shall neither be planting nor harvest.

— the Targum Onkelos says

For it is [now] two years that there has been famine in the land; and for another five years there will be no plowing [sowing] or harvest.

And God sent me before you to preserve you a posterity in the earth, and to save your lives by a great deliverance.

— the Targum Onkelos says

Elohim sent me [here] before you to insure your survival in the land, and to keep you alive for a great deliverance.

So now it was not you that sent me hither, but God; and He hath made me a father to Pharaoh, and lord of all his house and a ruler throughout all the land of Egypt.

— God hath made me a father to Pharaoh; that is, the Pharaoh’s principal counsellor of state, to guide his affairs with a fatherly care, and to have the authority, respect, and power of a father with him;

— the Targum Onkelos says

Now [then] it was not you that sent me here, but [it was from before] Elohim; and He has made me as a father to Pharaoh, and master of all [the people of] his house, and ruler over all the land of Egypt.

— the Targum of Jonathan says 

“And now, it was not you who sent me here, but from before the Lord the matter was ordained); and He has made me a father (counselor) to Pharaoh, and lord over all his house, and ruler in all the land of Egypt.”

Hasten ye, and go up to my father and say unto him, ‘Thus saith thy son Joseph: God hath made me lord of all Egypt. Come down unto me, tarry not;

— the Targum Onkelos says

Hurry, go up to my father and tell him: this is what your son, Yoseif, says, Elohim has made me master of all Egypt. Come down to me, do not delay.

10 and thou shalt dwell in the land of Goshen, and thou shalt be near unto me — thou, and thy children, and thy children’s children, and thy flocks and thy herds and all that thou hast.

— the land of Goshen; this land, also called “the land of Rameses” (Genesis 47:11), probably from the city “Raamses,” which the Israelites were compelled to build there (Exodus 1:11)

— was situated on the eastern bank of the Nile, hence when the Israelites were fleeing Egypt during the Exodus they were not known to have crossed the Nile;

— the Targum Onkelos says

You will dwell in the land of Goshen, and you will be close to me—you, your children, your grandchildren, your sheep, your cattle and all that you own.

11 And there will I nourish thee (for yet there are five years of famine), lest thou and thy household and all that thou hast come to poverty.’

— thy household; as the famine had lasted only two years, and as Jacob had preserved his flocks and herds, so probably he had lost few or none of the large number of men-servants and women-servants who belonged to him;

— the Targum Onkelos says

I will provide for you there, since there will be another five years of famine; lest you become impoverished together with [the people of] your household and all that is yours.

12 And behold, your eyes see, and the eyes of my brother Benjamin, that it is my mouth that speaketh unto you.

— the Targum Onkelos says

Behold, your eyes see it along with my brother Binyomin’s eyes, that I speak to you with my own mouth [in your language].

Arts have always portray Benjamin as a young lad, but he was already a great-grandpa! Genesis 46:21 Septuagint
“And the sons of Benjamin; Bala, and Bochor, and Asbel. And the sons of Bala were Gera, and Noeman, and Anchis, and Ros, and Mamphim. And Gera begot Arad.”

13 And ye shall tell my father of all my glory in Egypt, and of all that ye have seen; and ye shall make haste and bring down my father hither.”

— the Targum Onkelos says

Tell my father of all my honor in Egypt, and all that you saw. Hurry and bring my father down here.

14 And he fell upon his brother Benjamin’s neck, and wept; and Benjamin wept upon his neck.

— the Targum Onkelos says

He [then] fell upon his brother Binyomin’s neck and wept, and Binyomin wept upon his neck.

— the Targum of Jonathan says 

“And he fell upon the neck of his brother Benjamin and wept—because the Holy Temple was destined to be built in the portion of Benjamin, and was destined to be destroyed twice. And Benjamin wept upon the neck of Joseph, for he saw the Tabernacle of Shiloh (Mashkena de-Shiloh) which was destined to be in the portion of Joseph, and was destined to be destroyed.”

15 Moreover he kissed all his brethren, and wept upon them; and after that his brethren talked with him.

— the Targum Onkelos says

He kissed all his brothers and wept upon [their necks]. After that his brothers spoke with him.

16 And the fame thereof was heard in Pharaoh’s house, saying, “Joseph’s brethren have come”; and it pleased Pharaoh well, and his servants.

— the Targum Onkelos says

The news was heard in Pharaoh’s house that Yoseif’s brothers had come. This was good [news] in the eyes of Pharaoh and in the eyes of his servants.

17 And Pharaoh said unto Joseph, “Say unto thy brethren, ‘This do ye: Load your beasts and go, get you unto the land of Canaan.

— the Targum Onkelos says

Pharaoh said to Yoseif, Tell your brothers to do this: load up your beasts, and go and enter [bring to] the land of Canaan.

18 And take your father and your households, and come unto me; and I will give you the good of the land of Egypt, and ye shall eat the fat of the land.’

— the Targum Onkelos says

Bring your father and [the people of] your households and come to me; and I will give you the best of the land of Egypt. You will eat of the fat of the land.

19 Now thou art commanded, this do ye: ‘Take with you wagons out of the land of Egypt for your little ones and for your wives, and bring your father, and come.

— the Targum Onkelos says

Now you are commanded [to order (your) brothers to] do the following: Take wagons from the land of Egypt for your little ones and for your wives. Bring your father and come.

20 Also, regard not your possessions, for the good of all the land of Egypt is yours.’”

— the Targum Onkelos says

Do not be concerned with your belongings, for the best of Egypt is yours,

21 And the children of Israel did so; and Joseph gave them wagons, according to the commandment of Pharaoh, and gave them provision for the way.

— the Targum Onkelos says

The sons of Yisrael did so. Yoseif gave them wagons by order of Pharaoh, and he gave them provisions for the journey.

22 To all of them he gave each man changes of raiment; but to Benjamin he gave three hundred pieces of silver, and five changes of raiment.

— the Targum Onkelos says

To each of them, he gave a change of clothing. To Binyomin he gave three hundred [selaim of] silver pieces and five changes of clothing.

23 And to his father he sent in this manner: ten asses laden with the good things of Egypt, and ten sheasses laden with corn and bread and meat for his father on the way.

— the Targum Onkelos says

To his father he sent the following: Ten male donkeys loaded with the best of Egypt, and ten female donkeys loaded with grain, bread, and food [provisions] for his father for the journey.

24 So he sent his brethren away, and they departed; and he said unto them, “See that ye fall not out on the way.”

— the Targum Onkelos says

He sent his brothers off and they went. He said to them, Do not be troubled [argue] along the way.

25 And they went up out of Egypt, and came into the land of Canaan unto Jacob their father,

— the Targum Onkelos says

They went up from Egypt, and they came to the land of Canaan, to their father Yaakov.

26 and told him, saying, “Joseph is yet alive, and he is governor over all the land of Egypt.” And Jacob’s heart fainted, for he believed them not.

— the Targum Onkelos says

They told him saying, Yoseif is still alive, and he is ruler of all the land of Egypt. His [Yaakov’s] heart stood still [The words created uncertainty in his heart], for he could not believe them.

27 And they told him all the words of Joseph which he had said unto them; and when he saw the wagons which Joseph had sent to carry him, the spirit of Jacob their father revived.

— the Targum Onkelos says

They told him all the words of Yoseif which he had spoken to them, and he saw the wagons that Yoseif had sent to carry him. [Then] the spirit of [prophecy rested upon] their father Yaakov was revived.

— the Targum of Jonathan says

“And they spoke with him all the words of Joseph which he had spoken with them; and he saw the wagons which Joseph had sent to carry him; and the Spirit of Prophecy—which had departed from him at the time they sold Joseph—rested upon and returned to Jacob their father.”

28 And Israel said, “It is enough; Joseph my son is yet alive! I will go and see him before I die.”

— the Targum Onkelos says

Yisrael said, It is too much [There is great joy for me]! My son Yoseif still lives. I will go and see him before I die.

— the Targum of Jonathan says

“And Israel said: ‘Many are the favors the Lord has done with me! He delivered me from the hands of Esau, and from the hands of Laban, and from the hands of the Canaanites who pursued after me.

“And many are the comforts I have seen and hoped to see; but for this I did not hope—that my son Joseph is still alive until now! I will go now and see him before I die.'”

Genesis 46

1 And Israel took his journey with all that he had and came to Beersheba, and offered sacrifices unto the God of his father Isaac.

— the Targum Onkelos says

Yisrael journeyed with all that he possessed, and he came to Beer Sheva. He offered sacrifices [there] to the God of his father Yitzchok.

And God spoke unto Israel in the visions of the night and said, “Jacob, Jacob.” And he said, “Here am I.”

— the Targum Onkelos says

Elohim said to Yisrael in a night vision, and He said, Yaakov, Yaakov. And he said, Here I am.

And He said, “I am God, the God of thy father. Fear not to go down into Egypt, for I will there make of thee a great nation.

— the Targum Onkelos says

He said I am the Almighty, God of your father. Do not be afraid to do down to Egypt, for there I will make you into a great nation.

I will go down with thee into Egypt, and I will also surely bring thee up again; and Joseph shall put his hand upon thine eyes.”

— the Targum Onkelos says

I will go down with you to Egypt, and I will also surely bring you up again. Yoseif shall place his hand upon your eyes.

And Jacob rose up from Beersheba; and the sons of Israel carried Jacob their father, and their little ones and their wives, in the wagons which Pharaoh had sent to carry him.

— the Targum Onkelos says

Yaakov rose up from Beer Sheva. The sons of Yisrael transported their father Yaakov, their children, their wives in the wagons that Pharaoh had sent to carry him.

And they took their cattle and their goods which they had gotten in the land of Canaan, and came into Egypt, Jacob, and all his seed with him:

— the Targum Onkelos says

They took their livestock and their possessions that they had acquired in the land of Canaan, and they came to Egypt; Yaakov and all his descendants with him.

his sons and his sons’ sons with him, his daughters and his sons’ daughters; and all his seed brought he with him into Egypt. — Jacob had daughters (plural), that is, beside Dinah, but they were not named;

— the Targum Onkelos says

His sons and grandsons were with him. His daughters and his granddaughters, and all his descendants he brought with him to Egypt.

An artistic depiction of Pharaoh’s royal wagons being given to transport Jacob, his sons, and their little ones to Egypt

And these are the names of the children of Israel who came into Egypt, Jacob and his sons: Reuben, Jacob’s firstborn.

— the Targum Onkelos says

These are the names of the sons of Yisrael who were coming to Egypt, Yaakov and his sons. The firstborn of Yaakov was Reuvein.

And the sons of Reuben: Hanoch and Pallu, and Hezron and Carmi.

— the Targum Onkelos says

The sons of Reuvein [were]: Chanoch, Phallu, Chetzron and Carmi.

10 And the sons of Simeon: Jemuel and Jamin and Ohad and Jachin and Zohar and Shaul the son of a Canaanite woman.

— the Targum Onkelos says

The sons, of Shimon [were]: Yemueil, Yamin, Ohad, Yachin, Tzochar and Shaul, the son of the Canaanite woman.

11 And the sons of Levi: Gershon, Kohath, and Merari.

— the Targum Onkelos says

The sons of Leivi [were] Gershon, Kehas and Merari.

12 And the sons of Judah: Er and Onan, and Shelah and Perez and Zerah (but Er and Onan died in the land of Canaan). And the sons of Perez were Hezron and Hamul.

— the Targum Onkelos says

The sons of Yehudah [were]: Eir, Onan, Sheiloh, Peretz and Zorach. Eir and Onan died in the land of Canaan. The sons of Peretz were Chetzron and Chamul.

13 And the sons of Issachar: Tola, and Puvah and Job, and Shimron.

— the Targum Onkelos says

The sons of Yissachar [were]: Tolah, Phuvah, Yov and Shimron.

14 And the sons of Zebulun: Sered and Elon and Jahleel.

— the Targum Onkelos says

The sons of Zevulun [were]: Sered, Eilon and Yachle’eil.

15 These are the sons of Leah, whom she bore unto Jacob in Padanaram, with his daughter Dinah. All the souls of his sons and his daughters were thirty and three. — Leah’s daughter Dinah also came to Egypt; no sign she was married after her misfortune in Shechem;

— all the souls; were thirty and three; that is, six sons, twenty-three grandsons, two great grandsons, Dinah, and Jacob himself; the other daughters and granddaughters are omitted;

— the Targum Onkelos says

These are the sons of Leah that she bore to Yaakov in Padan Aram, along with his daughter Deenah. All the souls of his sons and daughters were thirty-three.

16 And the sons of Gad: Ziphion and Haggi, Shuni, and Ezbon, Eri, and Arodi, and Areli.

— the Targum Onkelos says

The sons of Gad [were]: Tzifyon, Chagi, Shuni, Etzbon, Eiri, Arodi, and Areili.

17 And the sons of Asher: Jimnah and Ishuah, and Isui and Beriah, and Serah their sister. And the sons of Beriah: Heber and Malchiel.

— the Targum Onkelos says

The sons of Asher [were]: Yimnah, Yishvah, Yishvi, and Beriah, and their sister, Serach. The sons of Beriah [were]: Chever and Malki’eil.

18 These are the sons of Zilpah, whom Laban gave to Leah his daughter, and these she bore unto Jacob, even sixteen souls.

— the Targum Onkelos says

These are the sons of Zilpah, whom Lavan gave to his daughter, Leah. She bore these to Yaakov, sixteen souls.

19 The sons of Rachel, Jacob’s wife: Joseph and Benjamin.

— the Targum Onkelos says

The sons of Rochel, Yaakov’s wife [were]: Yoseif and Binyomin.

20 And unto Joseph in the land of Egypt were born Manasseh and Ephraim, whom Asenath the daughter of Potipherah, priest of On, bore unto him.

— the Targum Onkelos says

In the land of Egypt, [sons] were born to Yoseif, which were born to him by Osnas, daughter of Poti Phera, priest [chief] of On; [they were] Menasheh and Ephraim.

— the Targum of Jonathan says

“And there were born to Joseph children in the land of Egypt, whom Asenath—the daughter of Dinah, who was raised in the house of Potiphera, the prince of Tanis—bore to him: Manasseh and Ephraim.”

21 And the sons of Benjamin were Belah and Becher and Ashbel, Gera and Naaman, Ehi and Rosh, Muppim and Huppim and Ard.

— the LXX gives Benjamin three sons, Bela, Chobor, and Ashbel; six grandsons, sons of Bela, viz. Gera, Naaman, Ehi, Rosh, Muppim, and Huppim; and one great-grandson, Ard, the son of Gera.

And the sons of Benjamin; Bala, and Bochor, and Asbel. And the sons of Bala were Gera, and Noeman, and Anchis, and Ros, and Mamphim. And Gera begot Arad. Genesis 46:21 Septuagint

— the Targum Onkelos says

The sons of Binyomin [were]: Bela, Becher, Ashbeil, Geiroh, Naamon, Eichi, Rosh, Muppim, Chuppim and Ard.

22 These are the sons of Rachel, who were born to Jacob; all the souls were fourteen.

— the Targum Onkelos says

These are the sons of Rochel that she bore to Yaakov. All the souls were fourteen.

23 And the son of Dan: Hushim.

— the Targum Onkelos says

The sons of Don [were] Chushim.

24 And the sons of Naphtali: Jahzeel and Guni, and Jezer and Shillem.

— the Targum Onkelos says

The sons of Naftali were: Yachtze’eil, Guni, Yeitzer and Shileim.

25 These are the sons of Bilhah, whom Laban gave unto Rachel his daughter, and she bore these unto Jacob; all the souls were seven.

— the Targum Onkelos says

These are the sons of Bilhah whom Lavan gave to his daughter Rochel. She bore these to Yaakov, seven souls in all.

26 All the souls who came with Jacob into Egypt, who came out of his loins, besides Jacob’s sons’ wives, all the souls were threescore and six.

— the Targum Onkelos says

All the souls coming with Yaakov to Egypt, who came out of his loins, not counting the wives of Yaakov’s sons, all the souls totaled sixty-six.

27 And the sons of Joseph who were born to him in Egypt were two souls; all the souls of the house of Jacob who came into Egypt, were threescore and ten.

— the Targum Onkelos says

The sons of Yoseif who were born to him in Egypt were [another] two souls. All the souls of the house of Yaakov that came to Egypt were seventy.

28 And he sent Judah before him unto Joseph to direct his face unto Goshen, and they came into the land of Goshen.

— the Targum Onkelos says

He [Yaakov] sent Yehudah ahead of him to Yoseif, so that he might direct him to [clear a place before him in] Goshen. They then came to the land of Goshen.

29 And Joseph made ready his chariot, and went up to meet Israel his father in Goshen, and presented himself unto him; and he fell on his neck, and wept on his neck a good while.

— the Targum Onkelos says

Yoseif harnessed his chariot, and went up to greet his father, Yisrael in Goshen. [When] he appeared before him, he fell on his neck, and wept on his neck for a long time.

30 And Israel said unto Joseph, “Now let me die, since I have seen thy face, because thou art yet alive.”

— the Targum Onkelos says

Yisrael said to Yoseif, Now I can [If I were to] die [now I will have been consoled]; after I have seen your face that you are alive.

31 And Joseph said unto his brethren and unto his father’s house, “I will go up and show Pharaoh, and say unto him, ‘My brethren and my father’s house, who were in the land of Canaan, have come unto me.

— the Targum Onkelos says

Yoseif said to his brothers and to his father’s household, I will go up and tell Pharaoh. I will say to him, My brothers and my father’s household, who were in the land of Canaan, have come to me.

32 And the men are shepherds, for their trade hath been to feed cattle; and they have brought their flocks and their herds, and all that they have.’

— the Targum Onkelos says

The men are shepherds, for they are owners of livestock. Their sheep, their cattle, and all their possessions, they have brought [with them.]

33 And it shall come to pass, when Pharaoh shall call you and shall say, ‘What is your occupation?’

— the Targum Onkelos says

And when Pharaoh calls you, and says, What is your occupation,

34 that ye shall say, ‘Thy servants’ trade hath been about cattle from our youth even until now, both we and also our fathers,’ that ye may dwell in the land of Goshen; for every shepherd is an abomination unto the Egyptians.”

— the Targum Onkelos says

You should say, Your servants have been livestock owners from our youth until now, we and our fathers; so that you will be able to settle in the land of Goshen, since every shepherd is abhorrent to Egypt [the Egyptians make distant all shepherds].

Wars between President Trump and Pope Leo

•April 17, 2026 • Leave a Comment

Pope Leo Calls Out ‘Those Who Manipulate Religion and the Very Name of God’ for ‘Military, Economic and Political Gain’ in Scorching Statement.

The target of the Pope’s speech is President Donald Trump, a Presbyterian and a Protestant, who responded in kind. This splits Spain and Italy, both with Catholic majority, from Trump.

MEDIAite • April 16, 2026 ~ BBC

Pope Leo XIV issued a statement condemning “those who manipulate religion and the very name of God” for “military, economic, and political gain” on Thursday amid his ongoing feud with President Donald Trump.

“Woe to those who manipulate religion and the very name of God for their own military, economic, and political gain, dragging that which is sacred into darkness and filth,” said the pope in a statement. “It is a world turned upside down, an exploitation of God’s creation that must be denounced and rejected by every honest conscience.”

While Leo made his remarks in the city of Bamenda in Cameroon, they came just days after he publicly clashed with Trump over immigration and the war in Iran.

“Pope Leo is WEAK on Crime, and terrible for Foreign Policy,” wrote Trump in a Truth Social rant last week. “I like his brother Louis much better than I like him, because Louis is all MAGA. He gets it, and Leo doesn’t! I don’t want a Pope who thinks it’s OK for Iran to have a Nuclear Weapon. I don’t want a Pope who thinks it’s terrible that America attacked Venezuela, a Country that was sending massive amounts of Drugs into the United States and, even worse, emptying their prisons, including murderers, drug dealers, and killers, into our Country. And I don’t want a Pope who criticizes the President of the United States because I’m doing exactly what I was elected, IN A LANDSLIDE, to do.”

He continued, “Leo should get his act together as Pope, use Common Sense, stop catering to the Radical Left, and focus on being a Great Pope, not a Politician. It’s hurting him very badly and, more importantly, it’s hurting the Catholic Church!”

Trump doubled down on his post, calling the pope “weak” on crime again during an interview with reporters.

White House border czar Tom Homan, a lifelong Catholic, also urged the pope to “stay out” of America’s affairs.

“There are enough problems with the Catholic Church – and I know because I’m a member of the Catholic Church – that they need to fix and concentrate on and leave politics alone,” said Homan. “I wish they would sit down and let me educate them on open borders.”

For a more detailed setting how a Prophecy between Jacob and Esau would be fulfilled

And upon thy sword shalt thou depend, entering at every place: yet thou shalt be supple and credulous, and be in subjection to thy brother; but it will be that when his sons become evil, and fall from keeping the commandments of the law, thou shalt break his yoke of servitude from off thy neck. Genesis 27:40 Jonathan

“Rather, I will wait until the days of mourning for my father have passed, and then I will kill Jacob my brother, and I will be the sole heir.’” Genesis 27:41 Jonathan

For a detailed Study of who Esau is, see Obadiah

And who then is Ephraim, who took the banner of Jacob, see (1) Ephraim and Manasseh (2) Ephraim as the Thirteenth Tribe

And how they would play out, see Ezekiel 4 – 390/40 Years Timeline

Genesis (43-44)

•April 16, 2026 • Leave a Comment

~~~~~

The Book of Jasper Chapter 53 (inserted between the chapters) because it provides more details for deeper understanding

Genesis 43

1 And the famine was sore in the land.

— the Targum Onkelos says

The famine was severe in the land.

And it came to pass, when they had eaten up the corn which they had brought out of Egypt, their father said unto them, “Go again, buy us a little food.”

— the Targum Onkelos says

When they had finished eating [entirely comsumed] the food [grain] that they had brought from Egypt, their father said to them, Go back and buy a little food [grain] for us.

And Judah spoke unto him, saying, “The man did solemnly declare unto us, saying, ‘Ye shall not see my face, unless your brother be with you.’

— the Targum Onkelos says

Yehudah spoke to him saying, The man warned us repeatedly, saying, You had better not see my face unless your brother is with you.

If thou wilt send our brother with us, we will go down and buy thee food.

— the Targum Onkelos says

If you will send our brother with us, we will go down and buy food [grain] for you.

But if thou wilt not send him, we will not go down, for the man said unto us, ‘Ye shall not see my face, unless your brother be with you.’”

— the Targum Onkelos says

But if you will not send [him] we will not go down; for the man said to us, You had better not see my face unless your brother is with you.

And Israel said, “Why dealt ye so ill with me, as to tell the man whether ye had yet a brother?”

— the Targum Onkelos says

Yisrael said, Why did you do such harm to me, by telling the man that you had another brother.

And they said, “The man asked us strictly about our state, and about our kindred, saying, ‘Is your father yet alive? Have ye another brother?’ And we told him according to the tenor of these words. Could we certainly know that he would say, ‘Bring your brother down’?”

— the Targum Onkelos says

They said, The man asked us repeatedly, about ourselves and about our family, saying. Is your father still alive? Do you have a brother? We told him according to his words. Could we have known that he would say, Bring your brother down?

And Judah said unto Israel his father, “Send the lad with me, and we will arise and go, that we may live and not die, both we and thou, and also our little ones.

— the Targum Onkelos says

Yehudah said to his father, Yisrael, Send the lad with me, and we will get up and go; let us live and not die, we, you and our children.

I will be surety for him; from my hand shalt thou require him. If I bring him not unto thee and set him before thee, then let me bear the blame for ever;

— the Targum Onkelos says

I will be security for him. You will demand him from my hand. If I do not bring him to you, and set him before you, I will have sinned [be a sinner] to you for all time.

10 for had we not lingered, surely now we would have returned this second time.”

— the Targum Onkelos says

If we had not hesitated until now, we could have been there and back twice.

11 And their father Israel said unto them, “If it must be so now, do this: Take of the best fruits in the land in your vessels, and carry down the man a present, a little balm and a little honey, spices and myrrh, nuts and almonds.

— the Targum Onkelos says

Their father Yisrael said to them, If so, here, this is what you must do: Take of the best fruits of the land in your vessels, and take an offering to the man, a little balsam, a little honey, gum, labdanum, pistachios and almonds.

12 And take double money in your hand; and the money that was brought again in the mouth of your sacks, carry it again in your hand. Perhaps it was an oversight.

— the Targum Onkelos says

Take double the money in your hands; and the money that was returned in the opening of your bags return by your own hands. Perhaps it was an oversight.

13 Take also your brother, and arise, go again unto the man;

— the Targum Onkelos says

Take your brother, get up and return to the man.

14 and God Almighty give you mercy before the man, that he may send away your other brother and Benjamin. If I am bereaved of my children, I am bereaved!”

— the Targum Onkelos says

May the Almighty, Shaddai, grant you compassion in the presence of the man, that he may release to you your other brother along with Binyamin. If I have been bereft of my children, I will be bereft.

— the Targum of Jonathan reveals Jacob wasn’t guessing, but the working of the holy spirit, saying

“And God Almighty (El Shaddai) give you mercy before the man, that he may release to you your other brother and Benjamin. And as for me—behold, I have already been informed by the Holy Spirit that even if I am bereaved of Joseph, I shall [also] be bereaved of Simeon and of Benjamin.”

15 And the men took that present, and they took double money in their hand, and Benjamin; and they rose up, and went down to Egypt, and stood before Joseph.

— the Targum Onkelos says

The men took that offering, and they took double money in their hands, and [they took] Binyamin. They rose and went down to Egypt, and they stood before Yoseif.

16 And when Joseph saw Benjamin with them, he said to the ruler of his house, “Bring these men home, and slay a beast and make ready; for these men shall dine with me at noon.”

— the Targum Onkelos says

When Yoseif saw Binyamin with them he said to the one in charge of his house, Bring these men to the house. Slaughter an animal and prepare it, for these men shall dine with me at noon [the morning meal].

— the Targum of Jonathan reveals this official as Manasseh, Joseph’s firstborn son, saying

“And Joseph saw Benjamin with them, and he said to Manasseh, who was appointed as the steward over his house: ‘Bring the men into the house, and perform the slaughtering of the meat, and remove the displaced nerve, and prepare the cooked meal before them; for the men shall eat with me at the beginning of the noon meal.'”

17 And the man did as Joseph bade, and the man brought the men into Joseph’s house.

— the Targum Onkelos says

The man did as Yoseif said, and the man brought the men to the house of Yoseif.

18 And the men were afraid because they were brought into Joseph’s house; and they said, “Because of the money that was returned in our sacks the first time are we brought in, that he may seek occasion against us and fall upon us, and take us for bondmen, and also our asses.”

— the Targum Onkelos says

The men were afraid because they had been brought to Yoseif’s house, and they said, Because of the money that was returned in our bags previously are we being brought [here]; that he may turn on [act as a lord over] us and come down on [libel] us, and take [acquire] us for slaves along with [and take] our donkeys.

19 And they came near to the steward of Joseph’s house, and they communed with him at the door of the house

— the Targum Onkelos says

They approached the man, who was in charge of Yoseif’s house, and they spoke to him at the entrance to the house.

20 and said, “O sir, we came indeed down the first time to buy food.

— the Targum Onkelos says

They said, Please, my master, we came down the first time to buy food [grain].

21 And it came to pass, when we came to the inn, that we opened our sacks, and behold, every man’s money was in the mouth of his sack, our money in full weight; and we have brought it again in our hand.

— the Targum Onkelos says

When we came to the inn and opened our bags, behold each man’s money was in the opening of his bag. It was our own money in its full weight. We have brought it back in our hand.

22 And other money have we brought down in our hands to buy food. We cannot tell who put our money in our sacks.”

— the Targum Onkelos says

We have [also] brought other money in our hand to buy food [grain]. We do not know who put the money in our bags.

23 And he said, “Peace be to you, fear not; your God and the God of your father hath given you treasure in your sacks. I had your money.” And he brought Simeon out unto them.

— the Targum Onkelos says

He [the man] said, Peace be with you, do not fear. Your God, and the God of your fathers, has given you a hidden gift in your bags. Your money has come to me. He then brought Shimon out to them.

24 And the man brought the men into Joseph’s house, and gave them water and they washed their feet; and he gave their asses provender.

— the Targum Onkelos says

The man brought the men into the house of Yoseif. He gave them water and they washed their feet. He had feed given to their donkeys.

25 And they made ready the present for Joseph’s coming at noon, for they heard that they should eat bread there.

— the Targum Onkelos says

They prepared their offering [to be ready] when Yoseif came at noon [to the morning meal], for they had heard that they would eat there.

26 And when Joseph came home, they brought him the present which was in their hand into the house, and bowed themselves before him to the earth.

— the Targum Onkelos says

Yoseif came to the house, and they brought the offering that was in their hand, to him in the house. They prostrated themselves on the ground to him.

27 And he asked them of their welfare and said, “Is your father well, the old man of whom ye spoke? Is he yet alive?”

— the Targum Onkelos says

He inquired about their welfare, and said, Is your old father at peace, the one about whom you spoke? Is he still alive?

28 And they answered, “Thy servant our father is in good health; he is yet alive.” And they bowed down their heads and made obeisance.

— the Targum Onkelos says

They said, Your servant, our father is at peace. He is still alive. They bowed their heads and prostrated themselves.

29 And he lifted up his eyes and saw his brother Benjamin, his mother’s son, and said, “Is this your younger brother of whom ye spoke unto me?” And he said, “God be gracious unto thee, my son.”

— the Targum Onkelos says

He raised his eyes and saw his brother Binyamin, his mother’s son, and said, Is this your youngest brother of whom you spoke to me? He [then] said, Elohim be gracious to you [Graciousness from before Elohim be upon you] my son.

30 And Joseph made haste, for his heart yearned for his brother, and he sought somewhere to weep; and he entered into his chamber and wept there. — Joseph making himself known to Benjamin wasn’t in any of the Masoretic Text, but revealed in the Book of Jasper;

— the Targum Onkelos says

Yoseif hurried [to go out] because his compassion was aroused toward his brother, and he wanted to weep. He went into [his] [bed]room and wept there.

31 And he washed his face and went out, and restrained himself, and said, “Set on the bread.”

— the Targum Onkelos says

He washed his face and came out. He composed himself, and said, Serve bread.

32 And they served him by himself, and them by themselves, and the Egyptians who ate with him by themselves, because the Egyptians might not eat bread with the Hebrews, for that is an abomination unto the Egyptians.

— the Targum of Jonathan reveals the Egyptians practiced zoolatry: the worship of animals, specifically cattle/sheep, saying

“And they set [the meal] for him by himself, and for them by themselves, and for the Egyptians who ate with him by themselves; for it is not proper for Egyptians to eat bread with Jews, because the animals that the Egyptians worship, the Jews eat.”

— the Targum Onkelos says

They set [a place] for him by himself, and for them by themselves, and for the Egyptians who ate with him by themselves, since the Egyptians could not eat food with the Hebrews, because it was loathsome to the [the animal that the] Egyptians [worship, the Hebrews eat].

33 And they sat before him, the firstborn according to his birthright and the youngest according to his youth; and the men marveled one at another. — Reuben, the firstborn, first, and so on to Benjamin the youngest;

— the Targum Onkelos says

They were seated [reclined] before him, the first born [the oldest] according to his birthright, and the youngest according to his youth. The men looked at each other in astonishment.

— the Targum of Jonathan reveals how Joseph striking the cup to create a ringing sound; pretending to use it as a magical tool to “hear” the secrets of their birth

“And they were seated before him, the eldest according to his seniority and the youngest according to his youth. And he was holding the silver cup in his hand, and he struck it as if practicing divination.

“The sons of Leah he arranged on one side; the sons of Zilpah he arranged on one side; the sons of Bilhah he arranged on one side; and Benjamin, the son of Rachel, he arranged by his own side. And the men marveled, each at his companion.”

34 And he took and sent portions unto them from before him, but Benjamin’s portion was five times as much as any of theirs. And they drank and were merry with him.

— “Benjamin’s portion was five times” wan’t explained in this text; but is in both the Targum Jonathan and Jasper, as more details revealed below;

— the Targum of Jonathan says

“And he took portions from before his table and sent them from before him to them; and Benjamin’s portion was greater than the portions of all of them—five portions: one portion was his own, one portion from [Joseph’s] own, one portion from his wife’s, and two portions from his two sons. And they drank and became merry with him; for from the day they were separated from him, neither he nor they had drunk wine until that day.”

The Book of Jasper Chapter 53

1 And the sons of Jacob rose up and took Benjamin and the whole of the presents, and they went and came to Egypt and they stood before Joseph.

2 And Joseph beheld his brother Benjamin with them and he saluted them, and these men came to Joseph’s house.

3 And Joseph commanded the superintendent of his house to give to his brethren to eat, and he did so unto them.

4 And at noon time Joseph sent for the men to come before him with Benjamin, and the men told the superintendent of Joseph’s house concerning the silver that was returned in their sacks, and he said unto them, It will be well with you, fear not, and he brought their brother Simeon unto them.

5 And Simeon said unto his brethren, The lord of the Egyptians has acted very kindly unto me, he did not keep me bound, as you saw with your eyes, for when you went out from the city he let me free and dealt kindly with me in his house.

6 And Judah took Benjamin by the hand, and they came before Joseph, and they bowed down to him to the ground.

7 And the men gave the present unto Joseph and they all sat before him, and Joseph said unto them, Is it well with you, is it well with your children, is it well with your aged father? and they said, It is well, and Judah took the record which Jacob had sent and gave it into the hand of Joseph.

8 And Joseph read the letter and knew his father’s writing, and he wished to weep and he went into an inner room and he wept a great weeping; and he went out.

9 And he lifted up his eyes and beheld his brother Benjamin, and he said, Is this your brother of whom you spoke unto me? And Benjamin approached Joseph, and Joseph placed his hand upon his head and he said unto him, May God be gracious unto thee my son.

10 And when Joseph saw his brother, the son of his mother, he again wished to weep, and he entered the chamber, and he wept there, and he washed his face, and went out and refrained from weeping, and he said, Prepare food.

11 And Joseph had a cup from which he drank, and it was of silver beautifully inlaid with onyx stones and bdellium, and Joseph struck the cup in the sight of his brethren whilst they were sitting to eat with him.

12 And Joseph said unto the men, I know by this cup that Reuben the first born, Simeon and Levi and Judah, Issachar and Zebulun are children from one mother, seat yourselves to eat according to your births.

13 And he also placed the others according to their births, and he said, I know that this your youngest brother has no brother, and I, like him, have no brother, he shall therefore sit down to eat with me.

14 And Benjamin went up before Joseph and sat upon the throne, and the men beheld the acts of Joseph, and they were astonished at them; and the men ate and drank at that time with Joseph, and he then gave presents unto them, and Joseph gave one gift unto Benjamin, and Manasseh and Ephraim saw the acts of their father, and they also gave presents unto him, and Osnath [wife of Joseph and the mother of his sons] gave him one present, and they were five presents in the hand of Benjamin.

15 And Joseph brought them out wine to drink, and they would not drink, and they said, From the day on which Joseph was lost we have not drunk wine, nor eaten any delicacies.

16 And Joseph swore unto them, and he pressed them hard, and they drank plentifully with him on that day, and Joseph afterward turned to his brother Benjamin to speak with him, and Benjamin was still sitting upon the throne before Joseph.

17 And Joseph said unto him, Hast thou begotten any children? and he said, Thy servant has ten sons, and these are their names, Bela, Becher, Ashbal, Gera, Naaman, Achi, Rosh, Mupim, Chupim, and Ord, and I called their names after my brother whom I have not seen.

18 And he ordered them to bring before him his map of the stars, whereby Joseph knew all the times, and Joseph said unto Benjamin, I have heard that the Hebrews are acquainted with all wisdom, dost thou know anything of this?

19 And Benjamin said, Thy servant is knowing also in all the wisdom which my father taught me, and Joseph said unto Benjamin, Look now at this instrument and understand where thy brother Joseph is in Egypt, who you said went down to Egypt.

20 And Benjamin beheld that instrument with the map of the stars of heaven, and he was wise and looked therein to know where his brother was, and Benjamin divided the whole land of Egypt into four divisions, and he found that he who was sitting upon the throne before him was his brother Joseph, and Benjamin wondered greatly, and when Joseph saw that his brother Benjamin was so much astonished, he said unto Benjamin, What hast thou seen, and why art thou astonished?

21 And Benjamin said unto Joseph, I can see by this that Joseph my brother sitteth here with me upon the throne, and Joseph said unto him, I am Joseph thy brother, reveal not this thing unto thy brethren; behold I will send thee with them when they go away, and I will command them to be brought back again into the city, and I will take thee away from them.

22 And if they dare their lives and fight for thee, then shall I know that they have repented of what they did unto me, and I will make myself known to them, and if they forsake thee when I take thee, then shalt thou remain with me, and I will wrangle with them, and they shall go away, and I will not become known to them.

23 At that time Joseph commanded his officer to fill their sacks with food, and to put each man’s money into his sack, and to put the cup in the sack of Benjamin, and to give them provision for the road, and they did so unto them.

24 And on the next day the men rose up early in the morning, and they loaded their asses with their corn, and they went forth with Benjamin, and they went to the land of Canaan with their brother Benjamin.

25 They had not gone far from Egypt when Joseph commanded him that was set over his house, saying, Rise, pursue these men before they get too far from Egypt, and say unto them, Why have you stolen my master’s cup?

26 And Joseph’s officer rose up and he reached them, and he spoke unto them all the words of Joseph; and when they heard this thing they became exceedingly wroth, and they said, He with whom thy master’s cup shall be found shall die, and we will also become slaves.

27 And they hastened and each man brought down his sack from his ass, and they looked in their bags and the cup was found in Benjamin’s bag, and they all tore their garments and they returned to the city, and they smote Benjamin in the road, continually smiting him until he came into the city, and they stood before Joseph.

28 And Judah’s anger was kindled, and he said, This man has only brought me back to destroy Egypt this day.

29 And the men came to Joseph’s house, and they found Joseph sitting upon his throne, and all the mighty men standing at his right and left.

30 And Joseph said unto them, What is this act that you have done, that you took away my silver cup and went away? but I know that you took my cup in order to know thereby in what part of the land your brother was.

31 And Judah said, What shall we say to our lord, what shall we speak and how shall we justify ourselves, God has this day found the iniquity of all thy servants, therefore has he done this thing to us this day.

32 And Joseph rose up and caught hold of Benjamin and took him from his brethren with violence, and he came to the house and locked the door at them, and Joseph commanded him that was set over his house that he should say unto them, Thus saith the king, Go in peace to your father, behold I have taken the man in whose hand my cup was found.

Genesis 44

1 And he commanded the steward of his house, saying, “Fill the men’s sacks with food, as much as they can carry, and put every man’s money in the mouth of his sack.

— the Targum Onkelos says

He commanded the one in charge of his house, saying, Fill the men’s bags with as much food [grain] as they can carry, and place each man’s money in the opening of his bag.

— the Targum of Jonathan says

“And he commanded Manasseh, who was appointed as the steward over his house, saying: ‘Fill the men’s travel-bags with grain, as much as they are able to carry, and put each man’s money in the mouth of his sack.'”

And put my cup, the silver cup, in the sack’s mouth of the youngest, and his corn money.” And he did according to the word that Joseph had spoken.

— the Targum Onkelos says

And my goblet, the silver goblet, put in the opening of the youngest one’s bag, together with the money for his purchase of food. He acted according to the word Yoseif had spoken.

As soon as the morning was light, the men were sent away, they and their asses.

— the Targum Onkelos says

With the morning light, the men were sent [on their way] together with their donkeys.

And when they had gone out of the city, and not yet far off, Joseph said unto his steward, “Up, follow after the men; and when thou dost overtake them, say unto them, ‘Why have ye rewarded evil for good?

— the Targum Onkelos says

They had just left the city, they had not gone far, when Yoseif said to the one in charge of his house, Get up, pursue the men, and when you catch up with them, say to them, Why did you repay good with evil.

— the Targum of Jonathan says

“They had gone out from the city and had not gone far, when Joseph said to Manasseh, who was appointed as the steward over his house: ‘Arise, pursue after the men! And you shall overtake them and say to them: Why have you repaid evil for good?'”

Is not this that from which my lord drinketh, and whereby indeed he divineth? Ye have done evil in so doing.’”

— the Targum Onkelos says

Why, this is [the goblet] from which my master drinks. He uses it for divination [investigating]. You have acted badly in what you have done.

And he overtook them, and he spoke unto them these same words.

— the Targum Onkelos says

He caught up with them, and spoke these exact words to them.

And they said unto him, “Why saith my lord these words? God forbid that thy servants should do according to this thing!

— the Targum Onkelos says

They said to him, Why does my master speak such words? It would be degrading for your servants to do [May your servants be spared from doing] such a thing.

Behold, the money which we found in the mouths of our sacks we brought again unto thee out of the land of Canaan. How then would we steal out of thy lord’s house silver or gold?

— the Targum Onkelos says

Behold the money that we found in the opening of our bags, we brought back to you from the land of Canaan. How then could we have stolen silver [vessels] or gold [vessels] from your master’s house?

With whomsoever of thy servants it be found, both let him die, and we also will be my lord’s bondmen.”

— the Targum Onkelos says

He among your servants with whom it is found, he shall die. We will also be servants to my master.

10 And he said, “Now also let it be according unto your words: he with whom it is found shall be my servant, and ye shall be blameless.”

— the Targum Onkelos says

And he said, Your words are now also correct. The one with whom it is found, he shall be my slave, and you shall be guiltless.

11 Then every man speedily took down his sack to the ground, and opened every man his sack.

— the Targum Onkelos says

They hurried, and each man lowered his bag to the ground, and each man opened his bag.

12 And he searched, and began with the eldest and ended with the youngest; and the cup was found in Benjamin’s sack.

— the Targum Onkelos says

He searched, beginning with the oldest, and ending with the youngest. The goblet was found in Binyomin’s bag.

13 Then they rent their clothes; and every man loaded his ass, and returned to the city.

— the Targum Onkelos says

They tore their garments [in grief]. Each man loaded his donkey, and they returned to the city.

14 And Judah and his brethren came to Joseph’s house (for he was yet there), and they fell before him on the ground.

— the Targum Onkelos says

Yehudah and his brothers came to Yoseif’s house. He was still there, and they fell to the ground before him.

15 And Joseph said unto them, “What deed is this that ye have done? Know ye not that such a man as I can certainly divine?”

— the Targum Onkelos says

Yoseif said to them, What is this deed that you have done? Do you not know that a man like me is an expert diviner [investigator]?

16 And Judah said, “What shall we say unto my lord? What shall we speak? Or how shall we clear ourselves? God hath found out the iniquity of thy servants; behold, we are my lord’s servants, both we and he also with whom the cup was found.”

— the Targum Onkelos says

Yehudah said, What shall we say to my master? What can we speak? How can we justify ourselves? [From before] God [the iniquity of your servants] has [been] found the iniquity of your servants. Let us be slaves to my master, both we, and the one in whose hand the goblet was found.

17 And he said, “God forbid that I should do so; but the man in whose hand the cup is found, he shall be my servant; and as for you, go up in peace unto your father.”

— the Targum Onkelos says

He [Yoseif] said [to them], It would be degrading for me to do [May I be spared from doing] such a thing. The man in whose hand the goblet was found, he shall be my slave, and [the rest of] you go up in peace to your father.

18 Then Judah came near unto him and said, “Oh my lord, let thy servant, I pray thee, speak a word in my lord’s ears, and let not thine anger burn against thy servant; for thou art even as Pharaoh.

— the Targum Onkelos says

Yehudah approached him [Yoseif] and said, Please my master, let your servant speak [now] a word in my master’s ears [before my master], and do not be angry with your servant; for you are equal to Pharaoh.

19 My lord asked his servants, saying, ‘Have ye a father or a brother?’

— the Targum Onkelos says

My master asked his servants, saying, Do you have a father or brother?

20 And we said unto my lord, ‘We have a father, an old man, and a child of his old age, a little one; and his brother is dead, and he alone is left of his mother, and his father loveth him.’

— the Targum Onkelos says

We said to my master, We have a father who is old, and a young child of his old age. His brother is dead, and he alone survives of his mother, and his father loves him.

21 And thou saidst unto thy servants, ‘Bring him down unto me, that I may set mine eyes upon him.’

— the Targum Onkelos says

You said to your servants, Bring him down to me, that I may set my eyes on him.

22 And we said unto my lord, ‘The lad cannot leave his father; for if he should leave his father, his father would die.’

— the Targum Onkelos says

We said to my master, the lad cannot leave his father, for if he left his father, he would die.

23 And thou saidst unto thy servants, ‘Unless your youngest brother come down with you, ye shall see my face no more.’

— the Targum Onkelos says

You [then] said to your servants, If your youngest brother does not come down with you, you shall not see my face again.

24 And it came to pass, when we came up unto thy servant, my father, we told him the words of my lord.

— the Targum Onkelos says

When we went to your servant, my father, we told him of my master’s words.

25 And our father said, ‘Go again, and buy us a little food.’

— the Targum Onkelos says

Our father said, Go back and buy us a little food [grain].

26 And we said, ‘We cannot go down. If our youngest brother be with us, then will we go down, for we may not see the man’s face unless our youngest brother is with us.’

— the Targum Onkelos says

We said, We cannot go down. If our youngest brother is with us, we will go down, for we cannot see the man’s face, unless our youngest brother is with us.

27 And thy servant, my father, said unto us, ‘Ye know that my wife bore me two sons;

— the Targum Onkelos says

Your servant, my father said to us, You know that my wife [Rochel] bore me two sons.

28 and the one went out from me, and I said, “Surely he is torn in pieces”; and I saw him not since.

— the Targum Onkelos says

One has [already] left me, and I said, surely he is torn to pieces [dead]. I have not see him until now.

29 And if ye take this also from me, and harm befall him, ye shall bring down my gray hairs with sorrow to the grave.’

— the Targum Onkelos says

If you take this one also away from me, and misfortune [death] befall him, you will bring my white head down to the grave in evil.

30 Now therefore when I come to thy servant my father and the lad be not with us, seeing that his life is bound up in the lad’s life,

— the Targum Onkelos says

And now, when I come to your servant, my father, and the lad is not with us; his soul is bound up with the lad’s [as beloved to him as his own] soul.

31 it shall come to pass, when he seeth that the lad is not with us, that he will die; and thy servants shall bring down the gray hairs of thy servant our father with sorrow to the grave.

— the Targum Onkelos says

When he sees that the lad is not [with us], he will die. Your servants will have brought down the white head of your servant, our father, to the grave in sorrow.

32 For thy servant became surety for the lad unto my father, saying, ‘If I bring him not unto thee, then I shall bear the blame to my father for ever.’

— the Targum Onkelos says

For your servant became surety for the lad, to my father, saying, If I do not bring him to you, I will have sinned [be a sinner] to my father for all time.

33 Now therefore, I pray thee, let thy servant remain instead of the lad as a bondman to my lord, and let the lad go up with his brethren.

— the Targum Onkelos says

And now, let your servant [now] remain as a slave to my master instead of the lad. Let the lad go up with his brothers.

34 For how shall I go up to my father and the lad be not with me, lest perhaps I see the evil that shall come upon my father?”

— the Targum Onkelos says

For how shall I go up to my father when the lad is not with me; lest I see the evil that would befall my father.

Genesis (41-42)

•April 15, 2026 • Leave a Comment

~~~~~~

~~~~

Genesis 41

1 And it came to pass at the end of two full years, that Pharaoh dreamed; and behold, he stood by the river. — Pharaoh dreamed; after two years spent in the prison, the time has now come for Joseph’s elevation to influence and power;

— the Targum Onkelos says

It was at the end of two full years, that Pharaoh had a dream, and behold, he was standing on the bank of the river.

And behold, there came up out of the river seven wellfavored cows, and fatfleshed; and they fed in a meadow.

— the Targum Onkelos says

Behold, from the river emerged seven cows, fine-looking and well-fleshed, and they were grazing in the reed grass.

And behold, seven other cows came up after them out of the river, illfavored and leanfleshed, and stood by the other cows upon the brink of the river.

— the Targum Onkelos says

And behold, seven other cows emerged after them, from the river, bad-looking and thin-fleshed, and they stood next to [opposite] the cows that were [already] on the bank of the river.

And the illfavored and leanfleshed cows ate up the seven wellfavored and fat cows. So Pharaoh awoke.

— the Targum Onkelos says

They ate—the bad looking, thin-fleshed cows [then ate] the seven fine looking, healthy cows, and Pharaoh woke up.

And he slept and dreamed the second time; and behold, seven ears of corn came up upon one stalk, rank and good.

— the Targum Onkelos says

He fell asleep and had a second dream. Behold, seven ears of grain [corn] came up on a single stalk, wholesome and good.

And behold, seven thin ears, blasted with the east wind sprang up after them.

— the Targum Onkelos says

And behold, seven ears, thin [smitten] and scorched [beaten] by the east wind, grew up after them.

And the seven thin ears devoured the seven rank and full ears. And Pharaoh awoke, and behold, it was a dream.

— the Targum Onkelos says

The seven thin [smitten] ears swallowed the seven wholesome, full ears. Pharaoh woke up, and behold it was a dream.

And it came to pass in the morning that his spirit was troubled; and he sent and called for all the magicians of Egypt, and all the wise men thereof. And Pharaoh told them his dream, but there was none that could interpret them unto Pharaoh.

— the Targum Onkelos says

In the morning, he was agitated [his spirit was beaten]. He sent and summoned all the wizards of Egypt and all its wise men. Pharaoh related his dream to them, but none could interpret them for Pharaoh.

— the Targum of Jonathan reveals there was a Divine Obstruction against the magicians

“And it was in the morning that his spirit was troubled; and he sent and called all the magicians of Egypt and all its wise men. And Pharaoh recounted the dreams to them, but there was no man who could interpret them—because from before the Lord it was obstructed, for the reason that the time of Joseph had arrived to go out from the house of prisoners.”

Then spoke the chief butler unto Pharaoh, saying, “I do remember my faults this day.

— the Targum Onkelos says

The chief butler spoke to Pharaoh saying, I recall my sins today:

10 Pharaoh was wroth with his servants, and put me under guard in the captain of the guard’s house, both me and the chief baker.

— the Targum Onkelos says

Pharaoh was enraged at his servants, and he placed me under guard in the house of the chief executioner; me and the chief baker.

11 And we dreamed a dream one night, I and he; we dreamed each man according to the interpretation of his dream.

— the Targum Onkelos says

We had a dream on the same night, I and he, each according to the interpretation of his dream, did we dream.

12 And there was there with us a young man, a Hebrew, servant to the captain of the guard; and we told him, and he interpreted to us our dreams. To each man according to his dream he did interpret.

— the Targum Onkelos says

With us there was a lad, a Hebrew, a slave of the chief of the slaughterers. We told him [about our dreams], and he interpreted our dreams, he interpreted each man’s dream accordingly.

13 And it came to pass, as he interpreted to us, so it was: me he restored unto mine office, and him he hanged.”

— the Targum Onkelos says

It came to pass, that as he interpreted for us, so did it occur; he restored me to my position, and him he hanged.

14 Then Pharaoh sent and called Joseph, and they brought him hastily out of the dungeon; and he shaved himself and changed his raiment, and came in unto Pharaoh.

— the Targum Onkelos says

Pharaoh sent and summoned Yoseif. They hurried him out of the dungeon [prison], but [Yoseif first] shaved [trimmed his hair] and changed his clothes. And then came to Pharaoh.

15 And Pharaoh said unto Joseph, “I have dreamed a dream, and there is none that can interpret it; and I have heard say of thee, that thou canst understand a dream to interpret it.”

— the Targum Onkelos says

Pharaoh said to Yoseif, I had a dream and there is no one to interpret it. I have heard it said about you that you hear a dream so as to interpret it.

16 And Joseph answered Pharaoh, saying, “It is not in me: God shall give Pharaoh an answer of peace.”

— the Targum Onkelos says

Yoseif answered Pharaoh, saying, Not I. [from my wisdom but from before] God will respond [there be a response] to the peace of Pharaoh.

17 And Pharaoh said unto Joseph, “In my dream, behold, I stood upon the bank of the river.

— the Targum Onkelos says

Pharaoh spoke to Yoseif, In my dream, I was standing on the bank of the river.

18 And behold, there came up out of the river seven cows, fatfleshed and wellfavored, and they fed in a meadow.

— the Targum Onkelos says

Behold from the river there emerged seven cows, well-fleshed and fine looking, and they were grazing in the reed grass.

19 And behold, seven other cows came up after them, poor and very illfavored and leanfleshed, such as I never saw in all the land of Egypt for badness.

— the Targum Onkelos says

And behold seven other cows emerged after them, poor, very bad-looking and thin-fleshed. I never saw in the entire land of Egypt, such bad looking [cows.]

20 And the lean and the illfavored cows ate up the first seven fat cows;

— the Targum Onkelos says

The thin, bad-looking cows, ate the first seven cows, which were the healthy ones.

21 and when they had eaten them up, it could not be known that they had eaten them, but they were still illfavored, as at the beginning. So I awoke.

— the Targum Onkelos says

They came inside them, but it could not be recognized that they had come inside them, [because] their appearance was as bad as it was previously. Then I woke up.

22 And I saw in my dream, and behold, seven ears came up in one stalk, full and good;

— the Targum Onkelos says

Then I saw in my dream that behold seven ears of grain [corn], wholesome and good, came up on one stalk.

23 and behold, seven ears, withered, thin, and blasted with the east wind sprang up after them.

— the Targum Onkelos says

And behold seven ears, shriveled, thin [smitten] and scorched [beaten] by the east wind, grew up after them.

24 And the thin ears devoured the seven good ears. And I told this unto the magicians, but there was none that could declare it to me.”

— the Targum Onkelos says

The thin [smitten] ears swallowed the seven good ears. I said this to the wizards, but none of them could tell me [its meaning].

25 And Joseph said unto Pharaoh, “The dreams of Pharaoh are one. God hath shown Pharaoh what He is about to do.

— the Targum Onkelos says

Yoseif said to Pharaoh, Pharaoh’s dream is one. What God is about to do, He has told to Pharaoh.

26 The seven good cows are seven years, and the seven good ears are seven years: the dreams are one.

— the Targum Onkelos says

The seven good cows represent seven years, and the seven good ears represent seven years; it is one dream.

27 And the seven thin and illfavored cows that came up after them are seven years, and the seven empty ears blasted with the east wind shall be seven years of famine.

— the Targum Onkelos says

The seven thin, bad [looking] cows who came up after them, represent seven years, and the seven empty [smitten], east wind—scorched [beaten] ears, represent the coming of seven years of famine.

28 This is the thing which I have spoken unto Pharaoh: what God is about to do He showeth unto Pharaoh. — what God is about to do, he sheweth unto Pharaoh: the events of fourteen years with respect to plenty and famine;

— the Targum Onkelos says

This is the word that I have spoken to Pharaoh; what God is about to do, He has revealed to Pharaoh.

29 Behold, there come seven years of great plenty throughout all the land of Egypt. — behold, there come seven years of great plenty throughout all the land of Egypt; not only a sufficiency but an abundance, even to luxury;

— the Targum Onkelos says

Behold, seven years are coming during which there will be great abundance in the entire land of Egypt.

30 And there shall arise after them seven years of famine; and all the plenty shall be forgotten in the land of Egypt, and the famine shall consume the land.

— the seven years of plenty being all spent, it would be forgotten as if it never happened; men would be so intent upon their distressed case and circumstances, that they should wholly forget how it had been with them in time past;

— the Targum Onkelos says

Seven years of famine will rise after them, and all the abundance will be forgotten in the land of Egypt. The famine will devastate the land.

31 And the plenty shall not be known in the land by reason of that famine following, for it shall be very grievous. — the former plenty was in some measure known by the stores of provisions laid up in the seven years, and which were brought forth when the famine became very pressing;

— but by that time, and before the seven years of it were ended, there were no traces of the foregoing plenty to be observed; for it shall be very grievous; as it was both in Egypt and in all the countries round about;

— the Targum Onkelos says

Nor will be known the [former] abundance of the land because of that famine that will follow, for it will be very severe.

32 And for that the dream was repeated unto Pharaoh twice; it is because the thing is established by God, and God will shortly bring it to pass. — the dream was doubled unto Pharaoh twice; or was repeated to him under different figures and images:

— it is because the thing is established by God; by a firm decree of his, and is sure, and will most certainly be accomplished; and to assure him of it was the repetition of the dream made;

— the Targum Onkelos says

As for the dream being repeated twice to Pharaoh, it is because the thing stands ready [from] before God, and God is hurrying to do it.

33 Now therefore let Pharaoh seek out a man discreet and wise, and set him over the land of Egypt. — now therefore let Pharaoh look out a man discreet and wise, one of good judgment and of abilities equal to the execution of a scheme hereafter proposed;

— the Targum Onkelos says

Now Pharaoh should seek a man of understanding and wisdom, and place him in charge of the land of Egypt.

34 Let Pharaoh do this, and let him appoint overseers over the land, and take up a fifth part of the land of Egypt in the seven plenteous years.

— take up the fifth part of the land, that is, exact a fifth part of the produce that it had been usual in Egypt to pay to the king a tithe of the crop, and the doubling of the tributes would not press very heavily on the people in these years of extraordinary abundance;

— the Targum Onkelos says

This is what Pharaoh should do: appoint officials [faithful men] over the land, and prepare the land of Egypt during the seven years of abundance.

35 And let them gather all the food of those good years that come, and lay up corn under the hand of Pharaoh, and let them keep food in the cities. — Joseph now proceeds to interpret the dream, and offer counsel suitable to the emergency. “What the God is about to do.”

— the Targum Onkelos says

Let them gather in all the food [grain] during these good years that are coming, and let them store up grain under the hand [jurisdiction] of Pharaoh. Let the food [grain] be [kept] in the cities, and let them safeguard it.

36 And that food shall be for store for the land against the seven years of famine which shall be in the land of Egypt, that the land perish not through the famine.”

— against the seven years of famine: and so be a supply to the inhabitants of the land, when they should be sore pressed with a famine, and know not what to do, nor where to go for food;

— the Targum Onkelos says

The food [grain] will be held in safe-keeping [stored away] for the land, for the seven years of famine; which will be in the land of Egypt. Let the [people of the] land not be cut off by the famine.

37 And the counsel was good in the eyes of Pharaoh and in the eyes of all his servants. — Pharaoh readily approved of the advice Joseph gave, and of the scheme and plan which he proposed;

— the Targum Onkelos says

This thing [plan] was good in the eyes of Pharaoh, and in the eyes of all his servants.

38 And Pharaoh said unto his servants, “Can we find such a one as this is, a man in whom the Spirit of God is?” — Joseph’s sudden promotion by Pharaoh who made him his second in command;

— the Targum Onkelos says

Pharaoh said to his servants, Can [another] one like this be found, a man who has God’s spirit [the spirit of prophecy from before God] in him?

39 And Pharaoh said unto Joseph, “Inasmuch as God hath shown thee all this, there is none so discreet and wise as thou art. — Pharaoh acknowledges the gift that is in Joseph to be from God;

— the Targum Onkelos says

Pharaoh said to Yoseif, After Elohim has informed you of all this, there is no one so understanding and wise as you.

40 Thou shalt be over my house, and according unto thy word shall all my people be ruled. Only in the throne will I be greater than thou.”

— the Targum Onkelos says

You shall be [appointed] over my house, and by your word shall all my people be fed. Only by [virtue of] the throne [of this kingdom] will I be greater [more honored] than you.

41 And Pharaoh said unto Joseph, “See, I have set thee over all the land of Egypt.”

— the Targum Onkelos says

Pharaoh said to Yoseif, Behold, I have placed you in charge of the entire land of Egypt.

42 And Pharaoh took off his ring from his hand and put it upon Joseph’s hand, and arrayed him in vestures of fine linen, and put a gold chain about his neck. — his ring, his signet ring;

— as decrees became law when stamped with the royal signet, it was naturally the symbol of authority; and put it on Joseph’s hand, who is thus invested with power;

— the Targum Onkelos says

Pharaoh then took off his ring from his hand, and he placed it on Yoseif’s hand. He dressed him in linen garments, and put a gold chain around his neck.

43 And he made him to ride in the second chariot which he had; and they cried before him, “Bow the knee!” And he made him ruler over all the land of Egypt. — in the second chariot; the object of this procession was to display Joseph to the people as their new governor;

— the Pharaoh, probably, took the chief part in this parade, riding in the first chariot of state; bow the knee: they commanded all that passed by him, or came to him, to show their reverent respect to him in this manner;

— the Targum Onkelos says

He had him [Yoseif] ride in his second-ranking carriage, and they proclaimed before him, Avreich [”This is the associate of the king”]. He thus placed him over the entire land of Egypt.

44 And Pharaoh said unto Joseph, “I am Pharaoh, and without thee shall no man lift up his hand or foot in all the land of Egypt.” — I am Pharaoh, that is, only I am the king, I reserve to myself the sovereign power over thee, and over all;

— the Targum Onkelos says

Pharaoh [then] said to Yoseif, I am Pharaoh, but without you [your permission], no man will lift [pick up] his hand [to carry a sword] or his foot [to ride upon a horse] in the entire land of Egypt.

45 And Pharaoh called Joseph’s name Zaphnathpaaneah; and he gave him for a wife Asenath the daughter of Potipherah, priest of On. And Joseph went out over all the land of Egypt. — gave him to wife Asenath, the daughter of Poti-pherah, from a family of high distinction;

— the Targum Onkelos says

Pharaoh gave Yoseif the name Tzafnas Paneiach [the man to whom hidden things are revealed], and he gave him Osnas, the daughter of Poti Phera, priest [chief] of On as a wife. Yoseif [then] went out over the land of Egypt.

— the Targum of Jonathan reveals who Asenath was, the wife of Joseph

“And Pharaoh called the name of Joseph: ‘The man who reveals hidden things.’ And he gave to him Asenath—whom Dinah had borne to Shechem, and whom the wife of Potiphera, the prince of Tanis, had raised—to be his wife. And Joseph went out as ruler over the land of Egypt.”

46 And Joseph was thirty years old when he stood before Pharaoh king of Egypt. And Joseph went out from the presence of Pharaoh, and went throughout all the land of Egypt. — Joseph was thirty years old; so that his life had been a life of suffering and imprisonment for about thirteen years;

— the Targum Onkelos says

Yoseif was thirty years old when he stood before Pharaoh, king of Egypt. Yoseif left Pharaoh’s presence, and traversed throughout the entire land of Egypt.

47 And in the seven plenteous years the earth brought forth by handfuls. — such as the gatherers take up in their hands when reaped, in order to bind up in sheaves:

— now such was the fruitfulness of the land during the seven years of plenty, that either one stalk produced as many ears as a man could hold in his hand;

— the Targum Onkelos says

The earth produced [The inhabitants of the land stored up] during the seven years of abundance by handfuls [grain for store-houses].

48 And he gathered up all the food of the seven years which were in the land of Egypt, and laid up the food in the cities; the food of the field, which was round about every city, laid he up in the same.

— and laid up the food in the cities; in places built for that purpose, and whither the people round about could easily bring it, and fetch it, when it was wanted;

— the Targum Onkelos says

He gathered in all the food [grain] of the seven years [that was produced] in the land of Egypt, and placed the food [grain] in the cities. The food [grain] of the fields surrounding each city was placed within [the city].

49 And Joseph gathered corn as the sand of the sea — very much, until he left off numbering; for it was without number.

— the Targum Onkelos says

Yoseif piled up grain like the sand of the sea—in great abundance, until that they gave up counting it, because there were no [more] numbers.

50 And unto Joseph were born two sons before the years of famine came, whom Asenath the daughter of Potipherah, priest of On, bore unto him. — Ephraim signifies mighty and fruitfulness, and Manasseh, forgetfulness;

— the Targum Onkelos says

Two sons were born to Yoseif before the years of famine came. They were born to him by Osnas, the daughter of Poti Phera, Priest [chief] of On.

51 And Joseph called the name of the firstborn Manasseh [that is, Forgetting], “For God,” said he, “hath made me forget all my toil and all my father’s house.”

— the Targum Onkelos says

Yoseif named the first-born, Menasheh, For God has made me forget all my trouble, and all that was in my father’s house.

52 And the name of the second called he Ephraim [that is, Fruitful], “For God hath caused me to be fruitful in the land of my affliction.”

— the Targum Onkelos says

He named the second one Ephraim, Because Elohim has made me fruitful in the land of my suffering [servitude].

53 And the seven years of plenteousness, which were in the land of Egypt, were ended.

— the Targum Onkelos says

The seven years of abundance came to an end [were completed], [the good years] that were in the land of Egypt.

54 And the seven years of dearth began to come, according as Joseph had said; and the dearth was in all lands, but in all the land of Egypt there was bread.

— but in all the land of Egypt there was bread; which was in the hands of everyone, and remained of their old stores in the years of plenty not yet exhausted, and which continued for some time after the dearth began.

— the Targum Onkelos says

The seven years of famine started to come, just as Yoseif had said. There was famine in all the lands, but in all the land of Egypt there was bread.

55 And when all the land of Egypt was famished, the people cried to Pharaoh for bread; and Pharaoh said unto all the Egyptians, “Go unto Joseph. What he saith to you, do.”

— and Pharaoh said to the Egyptians, go unto Joseph; whom he had appointed over this business of providing and laying up corn against this time, and of distributing it;

— the Targum Onkelos says

When all the land of Egypt was famished, the people cried out to Pharaoh for bread. Pharaoh said to all of Egypt [the Egyptians], Go to Yoseif. Whatever he says to you, do.

56 And the famine was over all the face of the earth; and Joseph opened all the storehouses and sold unto the Egyptians. And the famine waxed sore in the land of Egypt.

— and the famine waxed sore in the land of Egypt; there being no overflow of the Nile year after year, and nothing left of the old stock but what was in the storehouses;

— the Targum Onkelos says

The famine spread over the entire face of the land. Yoseif opened everything that held grain, and sold [grain] to the Egyptians [Egypt]. The famine became severe in the land of Egypt.

57 And all countries came into Egypt to Joseph to buy corn, because the famine was so sore in all lands. — and all countries came into Egypt to Joseph for to buy corn;

— all the neighbouring nations (Syria, Arabia, Palestine, Canaan, Lebanon), when they heard there was corn there for money, came from all parts for Egypt and were glad to get it at such expense and trouble.

— the Targum Onkelos says

All [countries] [inhabitants] of the land came to Egypt to buy [grain] from Yoseif, for the famine was severe in all the land.

Genesis 42

1 Now when Jacob saw that there was corn in Egypt, Jacob said unto his sons, “Why do ye look one upon another?”

— why look ye one upon another? as careless and helpless, each one expecting relief from the other; but none offering either counsel or help for the subsistence of all;

— the Targum Onkelos says

Yaakov saw that food [grain] was being sold in Egypt. Yaakov said to his sons, Why would you have everyone gazing at you?

— the Targum of Jonathan says

And Jakob saw that provisions might be bought and that they brought corn from Mizraim; and Jakob said to his sons, Why are you afraid to go down to Mizraim?

And he said, “Behold, I have heard that there is corn in Egypt. Go down thither and buy for us from thence, that we may live and not die.” — “Behold, I have heard there is grain in Egypt; or Mizraim, which is its old name; a posterity of Ham;

— the Targum Onkelos says

He said, Behold, I have heard that there is food [grain] for sale in Egypt. Go down there and buy for us from there, so that we will live and not die.

And Joseph’s ten brethren went down to buy corn in Egypt. — Joseph’s ten brethren obeyed their father’s orders, and immediately set out for Egypt;

— the Targum Onkelos says

Yoseif’s ten brothers went down to buy grain from Egypt.

But Benjamin, Joseph’s brother, Jacob sent not with his brethren, for he said, “Lest perhaps mischief befall him.” — for Jacob said, lest peradventure mischief befall him; as had to Joseph his brother, as he imagined;

— the Targum Onkelos says

But Binyamin, Yoseif’s brother, Yaakov did not send along with his brothers, for he [Yaakov] said, Misfortune [Death] might befall him.

And the sons of Israel came to buy corn among those who came, for the famine was in the land of Canaan.

— the Targum Onkelos says

The sons of Yisrael came to buy [grain] among the others who came, for there was famine in the land of Canaan.

— the Targum of Jonathan reveals how the sons of Jacob came into Egypt

“And the sons of Israel came—each one by a separate gate—so that the Evil Eye would not have power over them when they entered together to buy among the Canaanites who had come to buy; for the famine was in the land of Canaan.”

And Joseph was the governor over the land, and he it was who sold to all the people of the land; and Joseph’s brethren came and bowed down themselves before him with their faces to the earth.

— Joseph’s brethren came and bowed down themselves before him; thus Joseph’s first dream was already fulfilled; their sheaves bowed to his sheaf. Joseph now was the governor, in the zenith of his power and influence;

— the Targum Onkelos says

Yoseif was the ruler over the land; he was the one who sold [grain] to all the people of the land. Yoseif’s brothers came and they prostrated themselves to him with their faces to the ground.

Joseph’s brethren came and bowed down themselves before Joseph

— the Targum of Jonathan reveals

“And Joseph, he was the ruler over the land; and he knew that his brothers would enter to buy. He appointed guards at the gates of the city to write down everyone who entered that day—his name and the name of his father. And he was the one selling grain to all the people of the land. And Joseph’s brothers came and searched for him in the streets, in the open squares, and in the inns, but they did not find him. Then they entered his house and bowed down to him with their faces to the ground.”

And Joseph saw his brethren, and he recognized them, but made himself as a stranger unto them and spoke roughly unto them; and he said unto them, “From whence come ye?” And they said, “From the land of Canaan to buy food.”

— Joseph spoke roughly unto them; he has been accused of harshness in his treatment of his brethren, partly, to bring their wickedness to remembrance;

— the Targum Onkelos says

Yoseif saw his brothers and he recognized them, but he acted like a stranger [considered what he should say] to them. He spoke harshly to them, and said to them, Where did you come from? They said, From the land of Canaan to buy food [grain].

And Joseph knew his brethren, but they knew not him. — they would not recognize him, as he used the Egyptian language, was clad in a white linen dress, and being but seventeen when sold, had during the twenty years of separation changed in appearance much more than they had;

— the Targum Onkelos says

Yoseif recognized his brothers, but they did not recognize him.

And Joseph remembered the dreams which he dreamed about them, and said unto them, “Ye are spies! To see the nakedness of the land ye have come!” — after accusing “Ye are spies!” Joseph should have them given six strokes of the rattan each before he proceeded with the proceeding;

— the Targum Onkelos says

Yoseif recalled the dreams that he had dreamt about them, and said to them, You are spies. You have come to see where the land is exposed [the defective part of the land].

10 And they said unto him, “Nay, my lord, but to buy food have thy servants come. — but to buy food are thy servants come; that and no other was the errand they came upon;

— the Targum Onkelos says

They said to him, No my master. Your servants have come to buy food [grain].

“Ye are spies! And you claim to be the sons of Abraham, and what shall the sons of Jacob do in the houses of harlots?

11 We are all one man’s sons; we are true men, thy servants are no spies.” — we are all one man’s sons; therefore not likely to be spies;

— the Targum Onkelos says

We are all the sons of one man. We are honest [men]. Your servants have never been spies.

12 And he said unto them, “Nay, but to see the nakedness of the land ye have come.” — to see the nakedness of the land ye are come; this he urged in order to get a further account from them of their family and the state of affairs, which he was surely anxious to know;

— the Targum Onkelos says

He said to them, No, You have come to see where the land is exposed [the defective part of the land].

13 And they said, “Thy servants are twelve brethren, the sons of one man in the land of Canaan; and behold, the youngest is this day with our father, and one is no more.”

— they concluded with great probability that he was dead, because for twenty years together they had heard nothing, either of him or from him;

— the Targum Onkelos says

They said, Your servants are twelve brothers, the sons of one man in the land of Canaan. Behold the youngest one is this day with our father, and one is no more.

14 And Joseph said unto them, “That is it that I spoke unto you, saying, ‘Ye are spies!’ — “Ye are spies” a strong accusion regarding strangers in all Eastern countries down to the present day;

— the Targum Onkelos says

Yoseif said to them, That is just what I said to you, saying: you are spies.

15 Hereby ye shall be tested: by the life of Pharaoh ye shall not go forth hence, unless your youngest brother come hither. — by the life of Pharaoh; it was common in ancient times to swear by their Pharaohs; as afterwards the Romans used to swear by the name and life of their emperors;

— the Targum Onkelos says

You shall be tested in this manner. By Pharaoh’s life, you shall not leave from here unless your youngest brother comes here.

16 Send one of you and let him fetch your brother; and ye shall be kept in prison, that your words may be tested, whether there be any truth in you; or else by the life of Pharaoh surely ye are spies!”

— by the life of Pharaoh, surely ye are spies; intending to put them in prison, but afterwards modified his threat;

— the Targum Onkelos says

Send one of you and let him bring your brother. You will remain locked up and your words will be tested whether there is [you speak] any truth with you. If not, by Pharaoh’s life, you are spies.

17 And he put them all together into custody three days. — again, Joseph should have given them six strokes of the rattan each before bringing them out from prison;

— the Targum Onkelos says

He [then] put them together in prison for three days.

18 And Joseph said unto them the third day, “This do, and live, for I fear God: — how Joseph accused them of being spies isn’t explained here; but the Book of Jasher has more details: “why do you come through ten gates of the city? it can only be that you have come to spy through the land!”

Book of Jasher Chapter 51

1 And Jacob afterward heard that there was corn in Egypt, and he called unto his sons to go to Egypt to buy corn, for upon them also did the famine prevail, and he called unto his sons, saying,

2 Behold I hear that there is corn in Egypt, and all the people of the earth go there to purchase, now therefore why will you show yourselves satisfied before the whole earth? go you also down to Egypt and buy us a little corn amongst those that come there, that we may not die.

3 And the sons of Jacob hearkened to the voice of their father, and they rose up to go down to Egypt in order to buy corn amongst the rest that came there.

4 And Jacob their father commanded them, saying, When you come into the city do not enter together in one gate, on account of the inhabitants of the land.

5 And the sons of Jacob went forth and they went to Egypt, and the sons of Jacob did all as their father had commanded them, and Jacob did not send Benjamin, for he said, Lest an accident might befall him on the road like his brother; and ten of Jacob’s sons went forth.

6 And whilst the sons of Jacob were going on the road, they repented of what they had done to Joseph, and they spoke to each other, saying, We know that our brother Joseph went down to Egypt, and now we will seek him where we go, and if we find him we will take him from his master for a ransom, and if not, by force, and we will die for him.

7 And the sons of Jacob agreed to this thing and strengthened themselves on account of Joseph, to deliver him from the hand of his master, and the sons of Jacob went to Egypt; and when they came near to Egypt they separated from each other, and they came through ten gates of Egypt, and the gate keepers wrote their names on that day, and brought them to Joseph in the evening.

8 And Joseph read the names from the hand of the gate-keepers of the city, and he found that his brethren had entered at the ten gates of the city, and Joseph at that time commanded that it should be proclaimed throughout the land of Egypt, saying,

9 Go forth all ye store guards, close all the corn stores and let only one remain open, that those who come may purchase from it.

10 And all the officers of Joseph did so at that time, and they closed all the stores and left only one open.

11 And Joseph gave the written names of his brethren to him that was set over the open store, and he said unto him, Whosoever shall come to thee to buy corn, ask his name, and when men of these names shall come before thee, seize them and send them, and they did so.

12 And when the sons of Jacob came into the city, they joined together in the city to seek Joseph before they bought themselves corn.

13 And they went to the walls of the harlots, and they sought Joseph in the walls of the harlots for three days, for they thought that Joseph would come in the walls of the harlots, for Joseph was very comely and well favored, and the sons of Jacob sought Joseph for three days, and they could not find him.

14 And the man who was set over the open store sought for those names which Joseph had given him, and he did not find them.

15 And he sent to Joseph, saying, These three days have passed, and those men whose names thou didst give unto me have not come; and Joseph sent servants to seek the men in all Egypt, and to bring them before Joseph.

16 And Joseph’s servants went and came into Egypt and could not find them, and went to Goshen and they were not there, and then went to the city of Rameses and could not find them.

17 And Joseph continued to send sixteen servants to seek his brothers, and they went and spread themselves in the four corners of the city, and four of the servants went into the house of the harlots, and they found the ten men there seeking their brother.

18 And those four men took them and brought them before him, and they bowed down to him to the ground, and Joseph was sitting upon his throne in his temple, clothed with princely garments, and upon his head was a large crown of gold, and all the mighty men were sitting around him.

19 And the sons of Jacob saw Joseph, and his figure and comeliness and dignity of countenance seemed wonderful in their eyes, and they again bowed down to him to the ground.

20 And Joseph saw his brethren, and he knew them, but they knew him not, for Joseph was very great in their eyes, therefore they knew him not.

21 And Joseph spoke to them, saying, From whence come ye? and they all answered and said, Thy servants have come from the land of Canaan to buy corn, for the famine prevails throughout the earth, and thy servants heard that there was corn in Egypt, so they have come amongst the other comers to buy corn for their support.

22 And Joseph answered them, saying, If you have come to purchase as you say, why do you come through ten gates of the city? it can only be that you have come to spy through the land.

23 And they all together answered Joseph, and said, Not so my lord, we are right, thy servants are not spies, but we have come to buy corn, for thy servants are all brothers, the sons of one man in the land of Canaan, and our father commanded us, saying, When you come to the city do not enter together at one gate on account of the inhabitants of the land.

24 And Joseph again answered them and said, That is the thing which I spoke unto you, you have come to spy through the land, therefore you all came through ten gates of the city; you have come to see the nakedness of the land.

25 Surely every one that cometh to buy corn goeth his way, and you are already three days in the land, and what do you do in the walls of harlots in which you have been for these three days? surely spies do like unto these things.

26 And they said unto Joseph, Far be it from our lord to speak thus, for we are twelve brothers, the sons of our father Jacob, in the land of Canaan, the son of Isaac, the son of Abraham, the Hebrew, and behold the youngest is with our father this day in the land of Canaan, and one is not, for he was lost from us, and we thought perhaps he might be in this land, so we are seeking him throughout the land, and have come even to the houses of harlots to seek him there.

27 And Joseph said unto them, And have you then sought him throughout the earth, that there only remained Egypt for you to seek him in? And what also should your brother do in the houses of harlots, although he were in Egypt? have you not said, That you are from the sons of Isaac, the son of Abraham, and what shall the sons of Jacob do then in the houses of harlots?

28 And they said unto him, Because we heard that Ishmaelites stole him from us, and it was told unto us that they sold him in Egypt, and thy servant, our brother, is very comely and well favored, so we thought he would surely be in the houses of harlots, therefore thy servants went there to seek him and give ransom for him.

29 And Joseph still answered them, saying, Surely you speak falsely and utter lies, to say of yourselves that you are the sons of Abraham; as Pharaoh liveth you are spies, therefore have you come to the houses of harlots that you should not be known.

30 And Joseph said unto them, And now if you find him, and his master requireth of you a great price, will you give it for him? and they said, It shall be given.

31 And he said unto them, And if his master will not consent to part with him for a great price, what will you do unto him on his account? and they answered him, saying, If he will not give him unto us we will slay him, and take our brother and go away.

32 And Joseph said unto them, That is the thing which I have spoken to you; you are spies, for you are come to slay the inhabitants of the land, for we heard that two of your brethren smote all the inhabitants of Shechem, in the land of Canaan, on account of your sister, and you now come to do the like in Egypt on account of your brother.

33 Only hereby shall I know that you are true men; if you will send home one from amongst you to fetch your youngest brother from your father, and to bring him here unto me, and by doing this thing I will know that you are right.

34 And Joseph called to seventy of his mighty men, and he said unto them, Take these men and bring them into the ward.

35 And the mighty men took the ten men, they laid hold of them and put them into the ward, and they were in the ward three days.

36 And on the third day Joseph had them brought out of the ward, and he said unto them, Do this for yourselves if you be true men, so that you may live, one of your brethren shall be confined in the ward whilst you go and take home the corn for your household to the land of Canaan, and fetch your youngest brother, and bring him here unto me, that I may know that you are true men when you do this thing.

37 And Joseph went out from them and came into the chamber, and wept a great weeping, for his pity was excited for them, and he washed his face, and returned to them again, and he took Simeon from them and ordered him to be bound, but Simeon was not willing to be done so, for he was a very powerful man and they could not bind him.

38 And Joseph called unto his mighty men and seventy valiant men came before him with drawn swords in their hands, and the sons of Jacob were terrified at them.

39 And Joseph said unto them, Seize this man and confine him in prison until his brethren come to him, and Joseph’s valiant men hastened and they all laid hold of Simeon to bind him, and Simeon gave a loud and terrible shriek and the cry was heard at a distance.

40 And all the valiant men of Joseph were terrified at the sound of the shriek, that they fell upon their faces, and they were greatly afraid and fled.

41 And all the men that were with Joseph fled, for they were greatly afraid of their lives, and only Joseph and Manasseh his son remained there, and Manassah the son of Joseph saw the strength of Simeon, and he was exceedingly wroth.

42 And Manassah the son of Joseph rose up to Simeon, and Manassah smote Simeon a heavy blow with his fist against the back of his neck, and Simeon was stilled of his rage.

43 And Manassah laid hold of Simeon and he seized him violently and he bound him and brought him into the house of confinement, and all the sons of Jacob were astonished at the act of the youth.

44 And Simeon said unto his brethren, None of you must say that this is the smiting of an Egyptian, but it is the smiting of the house of my father.

45 And after this Joseph ordered him to be called who was set over the storehouse, to fill their sacks with corn as much as they could carry, and to restore every man’s money into his sack, and to give them provision for the road, and thus did he unto them.

46 And Joseph commanded them, saying, Take heed lest you transgress my orders to bring your brother as I have told you, and it shall be when you bring your brother hither unto me, then will I know that you are true men, and you shall traffic in the land, and I will restore unto you your brother, and you shall return in peace to your father.

47 And they all answered and said, According as our lord speaketh so will we do, and they bowed down to him to the ground.

Each of them should be given six strokes of the rattan

48 And every man lifted his corn upon his ass, and they went out to go to the land of Canaan to their father; and they came to the inn and Levi spread his sack to give provender to his ass, when he saw and behold his money in full weight was still in his sack.

49 And the man was greatly afraid, and he said unto his brethren, My money is restored, and lo, it is even in my sack, and the men were greatly afraid, and they said, What is this that God hath done unto us?

50 And they all said, And where is the Lord’s kindness with our fathers, with Abraham, Isaac, end Jacob, that the Lord has this day delivered us into the hands of the king of Egypt to contrive against us?

51 And Judah said unto them, Surely we are guilty sinners before the Lord our God in having sold our brother, our own flesh, and wherefore do you say, Where is the Lord’s kindness with our fathers?

52 And Reuben said unto them, Said I not unto you, do not sin against the lad, and you would not listen to me? now God requireth him from us, and how dare you say, Where is the Lord’s kindness with our fathers, whilst you have sinned unto the Lord?

53 And they tarried over night in that place, and they rose up early in the morning and laded their asses with their corn, and they led them and went on and came to their father’s house in the land of Canaan.

54 And Jacob and his household went out to meet his sons, and Jacob saw and behold their brother Simeon was not with them, and Jacob said unto his sons, Where is your brother Simeon, whom I do not see? and his sons told him all that had befallen them in Egypt. Book of Jasher Chapter 51

— the Targum Onkelos says

Yoseif said to them on the third day, Do this and live. [From before God] I fear God.

“Ye are spies! And you claim to be the sons of Abraham and Isaac, but what shall the sons of Jacob do in the houses of harlots?”

19 If ye be true men, let one of your brethren be bound in the prison house. Go ye, carry corn for the famine of your houses.

— the Targum Onkelos says

If you are honest, one of your brothers will be imprisoned in your place of guarding, and you [the others] go bring food for your famished [grain that is lacking in your] households.

20 But bring your youngest brother unto me; so shall your words be verified, and ye shall not die.” And they did so.

— the Targum Onkelos says

Bring your youngest brother to me, so that your words will be verified, and you will not die. They decided to do so.

21 And they said one to another, “We are verily guilty concerning our brother, in that we saw the anguish of his soul when he besought us, and we would not hear. Therefore has this distress come upon us.”

— the Targum Onkelos says

They said to one another, In truth, we are guilty regarding our brother. We saw the anguish of his soul when he pleaded with us and we did not listen [obey him]. That is why this trouble has come upon us.

22 And Reuben answered them, saying, “Spoke I not unto you, saying, ‘Do not sin against the child’; and ye would not hear? Therefore, behold, also his blood is required.”

— the Targum Onkelos says

Reuvein answered them saying, Did I not say to you to the following: Do not sin against the lad, but you did not listen [obey]; and now his blood is being avenged.

23 And they knew not that Joseph understood them, for he spoke unto them by an interpreter.

— the Targum Onkelos says

They did not know that Yoseif listened [understood], because the interpreter was between them.

24 And he turned himself away from them and wept; and returned to them again and communed with them, and took from them Simeon and bound him before their eyes.

— the Targum Onkelos says

He turned away from them and cried. He returned to them and spoke to them. He took Shimon from them, and had him bound before their eyes.

25 Then Joseph commanded to fill their sacks with corn and to restore every man’s money into his sack, and to give them provision for the way; and thus did he unto them.

— the Targum Onkelos says

Yoseif gave orders—and their vessels were filled with grain, and each one’s money was replaced in his sack; and they were given provisions for the journey. This is what he did for them.

26 And they laded their asses with the corn and departed thence.

— the Targum Onkelos says

They placed their purchases of grain on their donkeys and they departed from there.

27 And as one of them opened his sack to give his ass provender at the inn, he espied his money; for behold, it was in the mouth of his sack. — here “one of them” isn’t identified, but was Levi in the Book of Jasher 51:48

— the Targum Onkelos says

The one opened his sack, to feed his donkey where they stayed overnight, and he saw his money, for behold it was in the opening of his bag.

28 And he said unto his brethren, “My money is restored; and lo, it is even in my sack.” And their heart failed them and they were afraid, saying one to another, “What is this that God hath done unto us?”

— the Targum Onkelos says

He said to his brothers. My money has been returned, and behold it is also in my bag. [The understanding of their] Their hearts failed [left] them and they trembled, saying one to another, What is this that Elohim has done to us?

29 And they came unto Jacob their father, unto the land of Canaan, and told him all that befell them, saying,

— the Targum Onkelos says

They came to their father Yaakov, to the land of Canaan, and they told him all that had happened to them, saying,

30 “The man who is the lord of the land spoke roughly to us, and took us for spies of the country.

— the Targum Onkelos says

The man, the master of the land spoke to us harshly; and considered us as spies of the land.

31 And we said unto him, ‘We are true men; we are no spies.

— the Targum Onkelos says

We said to him, We are honest people, we have never been spies.

32 We are twelve brethren, sons of our father. One is no more, and the youngest is this day with our father in the land of Canaan.’

— the Targum Onkelos says

We are twelve brothers, sons of our [the same] father. One is no more, and the youngest is this day with our father in the land of Canaan.

33 And the man, the lord of the country, said unto us, ‘Hereby shall I know that ye are true men: Leave one of your brethren here with me, and take food for the famine of your households, and be gone;

— the Targum Onkelos says

The man, the master of the land, said to us, This is how I shall know that you are honest. Leave one of your brothers with me, and take food for your famished [grain that is lacking in your] households and go.

34 and bring your youngest brother unto me. Then shall I know that ye are not spies, but that ye are true men; so will I deliver you your brother, and ye shall traffic in the land.’”

— the Targum Onkelos says

Bring your youngest brother to me, and then I will know that you are not spies, but that you are honest men. I will return your brother to you, and you will [again] do business in the land.

35 And it came to pass as they emptied their sacks, that behold, every man’s bundle of money was in his sack; and when both they and their father saw the bundles of money, they were afraid.

— the Targum Onkelos says

They were emptying their sacks, and behold each man’s bundle of money was in his sack. They saw their bundles of money—they and their father and they were afraid.

36 And Jacob their father said unto them, “Me have ye bereaved of my children: Joseph is no more, and Simeon is no more, and ye will take Benjamin away. All these things are against me.”

— the Targum Onkelos says

Yaakov, their father, said to them, You have deprived me of children; Yoseif is no more [not here], Shimon is no more, and you would take Binyamin: All this has happened to me.

37 And Reuben spoke unto his father, saying, “Slay my two sons if I bring him not to thee. Deliver him into my hand, and I will bring him to thee again.”

— the Targum Onkelos says

Reuvein spoke to his father saying, Put my two sons to death if I do not bring him [Binyamin] back to you. Give him into my hands, and I will return him to you.

38 And he said, “My son shall not go down with you, for his brother is dead, and he is left alone. If mischief befall him by the way in which ye go, then shall ye bring down my gray hairs with sorrow to the grave.”

— the Targum Onkelos says

He [Yaakov] said, My son will not go down with you; for his brother is dead, and only he remains. Should misfortune [death] befall him on the way you are going, you will bring my white head down to the grave in sorrow.

Genesis (39-40)

•April 14, 2026 • Leave a Comment

~~

Joseph brought down to Egypt; then sold to Potiphar—an officer of Pharaoh

Genesis 39

And Joseph was brought down to Egypt; and Potiphar, an officer of Pharaoh, captain of the guard, an Egyptian, bought him from the hands of the Ishmaelites, who had brought him down thither. — and Potiphar an officer of Pharaoh, captain of the guard, an Egyptian;

— Potiphar, as his name signifies, the fruit of Pot or Phut, that is, the son or grandson of Put, perhaps; which would be common in Egypt, since it was the name of a son of Ham, Genesis 10:6, from whom Joseph came into the land of Egypt; called the land of Ham, Psalm 105:23;

— the Targum Onkelos says

Yoseif was brought down to Egypt. He was purchased by Potiphar—an officer of Pharaoh, the chief of the slaughterers, an Egyptian—from the Yishmaelites [Arabs] who had brought him down there.

And the Lord was with Joseph, and he was a prosperous man; and he was in the house of his master the Egyptian. — Joseph was banished from his father’s house, but the Lord was with him; it is God’s presence that make him prosperous;

— the Targum Onkelos says

[The Word of] Adonoy was with Yoseif[’s support], and he was successful. He was [a servant] in the house of his master, the Egyptian.

And his master saw that the Lord was with him, and that the Lord made all that he did to prosper in his hand. — which led to the conviction of Potiphar concerning Joseph was of remarkable success which he saw attending all his efforts and undertakings;

— the Targum Onkelos says

His master saw that [the Word of] Adonoy was with him [supported him], and that whatever he did, Adonoy made it succeed through his hand.

And Joseph found grace in his sight, and he served him. And he made him overseer over his house, and all that he had he put into his hand. — and he made him overseer over his house; that is, after he had served him some time;

— he advanced Joseph and made him the head servant, or steward of his house; the Targum Onkelos says

Yoseif found favor in his eyes, and he served him personally. He appointed him supervisor over his household, and all that he possessed he placed in his hand.

And it came to pass from the time that he had made him overseer in his house and over all that he had, that the Lord blessed the Egyptian’s house for Joseph’s sake; and the blessing of the Lord was upon all that he had in the house and in the field.

— that the Lord blessed the Egyptian’s house for Joseph’s sake; that is, much more than before; everything under his hands succeeded, now much more abundantly;

— the Targum Onkelos says

From the time he appointed him supervisor over his household and over all that he possessed, Adonoy blessed the house of the Egyptian for Yoseif’s sake. The blessing of Adonoy was in all that he possessed, in the house and in the field.

And he left all that he had in Joseph’s hand; and he knew not anything he had, save the bread which he ate. And Joseph was a goodly person, and wellfavored. — everything went on smoothly; and with Joseph as manager he had no need to worry a thing, except as regards food;

— the Targum Onkelos says

He left everything he possessed in the hand of Yoseif. He did not concern himself with anything about him, except for the bread he ate. Yoseif was well-built and good looking.

And it came to pass after these things, that his master’s wife cast her eyes upon Joseph; and she said, “Lie with me.” — lie with me; now directly, there being both opportunity and convenience, perhaps her chamber was near;

— the Targum Onkelos says

After these events, his master’s wife cast her eyes upon Yoseif, and she said, Be with me.

But he refused, and said unto his master’s wife, “Behold, my master knoweth not what is with me in the house, and he hath committed all that he hath to my hand. — but he refused, and said unto his master’s wife; reasoning with her about the evil nature of the crime she tempted him to;

— the Targum Onkelos says

He refused and said to his master’s wife, Behold, my master knows nothing about what I am doing in the house, and all that he possess, he has placed in my hands.

There is none greater in this house than I, neither hath he kept back any thing from me but thee, because thou art his wife. How then can I do this great wickedness, and sin against God?”

— how can I do this great wickedness? how can I, to whom my master has shown so much kindness, when I was a forlorn stranger from a foreign land, and was offered to him in the capacity of a slave; 

— and sin against God? the words are emphatic, “this! this wickedness! this great one!” adultery was reckoned a great sin among all nations, and this, had Joseph committed it;

— the Targum Onkelos says

No one in this house is greater than me. He has not withheld anything from me other than you, for you are his wife. How can I do such a great evil, and sin against [before] God.

10 And it came to pass, as she spoke to Joseph day by day, that he hearkened not unto her to lie by her or to be with her. — he avoided her company and familiar conversation, as evil in itself, the present circumstances considered, and as an occasion of further evil;

— the Targum Onkelos says

Even though she spoke to Yoseif every day, he would not listen to [obey] her, to lie next to her, [nor] to be with her.

— the Targum of Jonathan reveals Joseph’s knowledge of the world to come, saying

“And it was, as she spoke with Joseph day by day, and he would not receive from her [instruction] to lie beside her, [lest he] be found guilty with her on the Great Day of Judgment in the World to Come.”

11 And it came to pass about this time that Joseph went into the house to do his business, and there were none of the men of the house there within.

— and there was none of the men of the house there within; being all gone to the public festival, or however there were none in that part of the house where Joseph was;

— Joseph resists the daily solicitations of his master’s wife to lie with her. “None greater in this house than I” he pleads the unreserved trust his master had reposed in him;

— the Targum Onkelos says

It was on such a day, that he came to the house to do his work [examine the recordings of his accounts]. No man of the household was there in the house.

12 And she caught him by his garment, saying, “Lie with me.” And he left his garment in her hand and fled, and got himself out. — and he left his garment in her hand, and fled, and got him out;

— it was his outward loose garment she laid hold on, out of which he slipped himself, and so got clear of her, and ran away;

— the Targum Onkelos says

She grabbed him by his garment, saying, Be with me. He left his garment in her hand, and fled, and he went outside [to the marketplace].

13 And it came to pass, when she saw that he had left his garment in her hand and had fled forth, — his garment; this accident provided the only circumstantial piece of evidence for the charge brought against him;

— the Targum Onkelos says

It was when she saw that he left his garment in her hand and had fled outside [to the marketplace],

14 that she called unto the men of her house and spoke unto them, saying, “See, he hath brought in a Hebrew unto us to mock us. He came in unto me to lie with me, and I cried with a loud voice.

— see, he hath brought in an Hebrew; to mock us, an affected and blind aspersion of her husband for keeping in his house an Hebrew, the very abomination of Egyptians;

— the Targum Onkelos says

that she called to the men of the household and said to them, See, he brought us a Hebrew man to mock us. He came to be with me, and I called out in a loud voice.

15 And it came to pass when he heard that I lifted up my voice and cried, that he left his garment with me and fled, and got himself out.” — when this daring assault upon Joseph’s chastity had failed, the adulterous woman reversed the whole affair, charged him with an attack upon her modesty;

— the Targum Onkelos says

When he heard that I raised my voice and cried out, he left his garment with me, and fled and went outside [to the marketplace].

16 And she laid aside his garment by her until his lord came home. — and she laid up his garment by her; as a proof of what she laid to his charge, and as a testimony against him;

— the Targum Onkelos says

She laid his garment near her until his master came home.

17 And she spoke unto him according to these words, saying, “The Hebrew servant whom thou hast brought unto us came in unto me to mock me. — the Hebrew servant whom thou hast brought unto us; thus she makes her husband accessory to the crime;

— the Targum Onkelos says

She spoke to him [her husband] according to these words, saying, The Hebrew slave came to me—the same one you brought into us—[he came to] mock me.

18 And it came to pass, as I lifted up my voice and cried, that he left his garment with me and fled out.” — she then left the garment lying by her side till the return of Joseph’s master, to whom she repeated her tale;

— the Targum Onkelos says

When I raised my voice and cried out, he left his garment with me and fled outside [to the marketplace].

19 And it came to pass, when his master heard the words of his wife which she spoke unto him, saying, “After this manner did thy servant to me,” that his wrath was kindled. — her husband believes her story and naturally resents the supposed unfaithfulness of his slave;

— the Targum Onkelos says

When his master heard the words of his wife which she spoke to him, saying, Your slave did such things to me, he became furious.

20 And Joseph’s master took him and put him into the prison, a place where the king’s prisoners were bound; and he was there in the prison. — in prison; usually a subterranean dungeon; He that answereth a matter before he heareth it, it is folly and shame unto him, Proverbs 18:13

— the Targum Onkelos says

Yoseif’s master took him and placed him in [appointed him over] the prison, the place where the king’s prisoners were jailed. He remained there in the prison.

21 But the Lord was with Joseph and showed him mercy, and gave him favor in the sight of the keeper of the prison. — and the Lord was with Joseph; under his afflictions; supporting him with his right hand; sanctifying all his troubles to him, and so causing him to bear them patiently;

— and showed him mercy, and gave him favour in the sight of the keeper of the prison; who was the underkeeper to Potiphar;

— the Targum Onkelos says

[The Word of] Adonoy was with Yoseif[’s support], and extended kindness to him, granting him favor in the eyes of the prison chief.

22 And the keeper of the prison committed to Joseph’s hand all the prisoners who were in the prison; and whatsoever they did there, he was the doer of it.

— and whatsoever they did there, he was the doer of it; not that he did everything that was done in the prison: but the meaning is that he gave orders for the doing of everything, and there was nothing done without his supervision;

— the Targum Onkelos says

The prison chief gave [appointed] Yoseif [to be in] control over all the prisoners in the prison, and everything that had to be done there, he was the one who did it [it was done by his word].

23 The keeper of the prison looked not into any thing that was under his hand, because the Lord was with him; and that which he did, the Lord made it to prosper.

— the keeper of the prison looked not to anything that was under his hand; under the hand of Joseph; he took no account of what was in his hands, nor required any of him;

— the Targum Onkelos says

The prison chief did not have to look after anything that was under [see any offense committed by] his hand, because [the Word of] Adonoy was with him [his support] and whatever he did, Adonoy made him succeed.

Genesis 40

1 And it came to pass after these things, that the butler of the king of Egypt and his baker had offended their lord the king of Egypt.

— butler; one who gives to drink, cupbearer; also overseer of the royal vineyards, as well as the cellars; and the chief of the bakers, have offended; having, probably, some hundreds of servants under them;

— the Targum Onkelos says

After these events, an offense was committed by the Egyptian king’s butler and baker against their master, the king of Egypt.

And Pharaoh was wroth against two of his officers—against the chief of the butlers and against the chief of the bakers. — who both were employed in providing wine and food for him, there was one of each who was over the rest;

— and as their business was to see that those under them did their work well, when they were faulty the principal officers were answerable: yet they might have neglected to look after those that were under them, and so were culpable, and drew upon them the wrath and resentment of their lord;

— the Targum Onkelos says

Pharaoh was enraged at his two officials, the chief butler and the chief baker.

And he put them under guard in the house of the captain of the guard, into the prison, the place where Joseph was bound.

— Pharaoh put them in prison; whatever was their crime until their case could be investigated, to the custody of the captain of the guard, that is, Potiphar, in an outer part of whose house the royal prison was situated;

— the Targum Onkelos says

He placed them under guard in the house of the chief executioner, in the prison, where Yoseif was imprisoned.

And the captain of the guard charged Joseph with them, and he served them; and they continued a season under guard. — and the captain of the guard charged Joseph to his care and custody;

— the Targum Onkelos says

The chief of the slaughterers appointed Yoseif to be with them and he served them. They were under guard for a period of time.

And they dreamed a dream both of them, each man his dream in one night, each man according to the interpretation of his dream, the butler and the baker of the king of Egypt, who were bound in the prison.

— these prisoners dream, “each according to the interpretation of his dream,” the imagery of which was suited to indicate his future state;

— the Targum Onkelos says

The two of them had a dream. Each of them had his dream on the same night, each man according to the interpretation of his dream, the butler and the baker of the king of Egypt, who were imprisoned in the prison.

And Joseph came in unto them in the morning and looked upon them, and behold, they were sad. — they were sad; they looked sorrowful, dejected, and uneasy;

— the Targum Onkelos says

Yoseif came to them in the morning, and he saw them, and behold they were troubled.

And he asked Pharaoh’s officers who were with him in the guard of his lord’s house, saying, “Why look ye so sadly today?”

— the Targum Onkelos says

He asked Pharaoh’s officials, who were with him, under guard in his master’s house, saying, Why do you look so bad today?

And they said unto him, “We have dreamed a dream, and there is no interpreter of it.” And Joseph said unto them, “Do not interpretations belong to God? Tell me them, I pray you.”

— do not interpretations belong to God? for it is only that God who sends these dreams that can interpret them, and to him you should seek for it;

— the Targum Onkelos says

They said to him, We had a dream, and there is no interpreter of it. Yoseif said to them, Do not [Are] interpretations [of dreams] belong to [not from] God. Tell them to me, please [now].

The chief butler told his dream to Joseph

And the chief butler told his dream to Joseph, and said to him, “In my dream, behold, a vine was before me.

— the Targum Onkelos says

The butler told his dream to Yoseif. He said to him, In my dream, behold a grape vine was before me.

10 And in the vine were three branches; and it was as though it budded and her blossoms shot forth, and the clusters thereof brought forth ripe grapes.

— the Targum Onkelos says

On the vine there were three branches, as [when] if budding, [it brought out blossoms and] its [the] blossoms blooming, and its clusters ripening into grapes.

11 And Pharaoh’s cup was in my hand; and I took the grapes and pressed them into Pharaoh’s cup, and I gave the cup into Pharaoh’s hand.”

— the Targum Onkelos says

Pharaoh’s cup was in my hand. I took the grapes and squeezed them into Pharaoh’s cup. I then placed the cup into Pharaoh’s hand.

12 And Joseph said unto him, “This is the interpretation of it: The three branches are three days. — speaking as an inspired interpreter, Joseph told the butler that within three days he would be restored to all the honors and privileges of his office;

— the Targum Onkelos says

Yoseif said to him, This is its interpretation: The three branches are three days.

— the Targum of Jonathan reveals the deeper meaning of their dreams, saying

“And Joseph said to him: ‘This is the final interpretation of the dream: The three branches are the three Patriarchs of the world—Abraham, Isaac, and Jacob—whose children’s children are destined to be enslaved to Egypt in clay, in bricks, and in all labor in the fields. And after this, they will be redeemed by the hand of three shepherds.

And that which you said, “I took the grapes and pressed them into Pharaoh’s cup and gave the cup into Pharaoh’s hand”—that is the vial of wrath which Pharaoh is destined to drink in the end. And you, Chief Butler, will receive a good reward for the good dream you dreamed. This is its interpretation for you: the three branches are three days until your redemption.'”

13 Yet within three days shall Pharaoh lift up thine head and restore thee unto thy place; and thou shalt deliver Pharaoh’s cup into his hand, after the former manner when thou wast his butler.

— the Targum Onkelos says

In another [At the end of] three days, Pharaoh will lift [take] your head, and restore you to your position. You will place Pharaoh’s cup in his hand, as was your previous practice when you were his butler.

14 But think on me when it shall be well with thee, and show kindness, I pray thee, unto me; and make mention of me unto Pharaoh, and bring me out of this house. — and show kindness unto me; he pleads no merit for what he had done in interpreting his dream,

— but puts the good office he desires him to do for him upon the foot of kindness to a man in distress, and asks it as a favour, by way of entreaty and request;

— the Targum Onkelos says

But remember me when things go well with you. Please [Now] deal kindly with me [with goodness], and mention me to [before] Pharaoh, and take me out of this house [prison].

15 For indeed I was stolen away out of the land of the Hebrews; and here also have I done nothing that they should put me into the dungeon.”

— since he had been in the land of Egypt, he had not been guilty of any criminal action wherefore he should be put into a prison, and especially into a dungeon, a dark and filthy place under ground, as dungeons usually were;

— the Targum Onkelos says

I was kidnaped from the land of the Hebrews, and here I have also done nothing that they should have put me in this dungeon [prison].

16 When the chief baker saw that the interpretation was good, he said unto Joseph, “I also was in my dream, and behold, I had three white baskets on my head.

— the Targum Onkelos says

The chief baker saw that he interpreted well. He said to Yoseif, I, too, dreamed. Behold there were three fancy baskets on my head.

The chief baker also had a dream

17 And in the uppermost basket there were all manner of baked meats for Pharaoh, and the birds ate them out of the basket upon my head.”

— the Targum Onkelos says

In the top basket there were various kinds of food for Pharaoh, consisting of baked goods, and the bird was eating them from the basket that was on my head.

18 And Joseph answered and said, “This is the interpretation thereof: The three baskets are three days.

— the Targum Onkelos says

Yoseif replied and said, This is its interpretation: The three baskets represent three days.

19 Yet within three days shall Pharaoh lift up thy head from off thee, and shall hang thee on a tree; and the birds shall eat thy flesh from off thee.”

— the Targum Onkelos says

In another [At the end of] three days, Pharaoh will lift [remove] your head from off you. He will hang you on a tree, and the bird will eat your flesh from off you.

20 And it came to pass the third day, which was Pharaoh’s birthday, that he made a feast unto all his servants. And he lifted up the head of the chief butler and of the chief baker among his servants.

— the Targum Onkelos says

It was on the third day, which was Pharaoh’s birthday, that he [Pharaoh] made a feast for all his servants. He lifted [remembered] the head of the chief butler, and the head of the chief baker among his servants.

21 And he restored the chief butler unto his butlership again, and he gave the cup into Pharaoh’s hand;

— the Targum Onkelos says

He restored the chief butler to his position, and he presented the cup into Pharaoh’s hand.

— the Targum of Jonathan adds this as a reason of his being restored, “because he found that he was not in that counsel,” in which it was consulted to poison Pharaoh;

22 but he hanged the chief baker, as Joseph had interpreted to them. — but he hanged the chief baker; that is; the Pharaoh ordered the chief baker to be hanged; because, as the same Targum Jonathan says, the chief baker had conspired to kill him (Pharaoh);

— the Targum Onkelos says

The chief baker, he hung, just as Yoseif had interpreted to them.

23 Yet did not the chief butler remember Joseph, but forgot him.

— the Targum Onkelos says

[However] the chief butler did not remember Yoseif, but forgot him.

— the Targum of Jonathan says:

But because, Joseph had withdrawn from the mercy that is above, and had put his confidence in the chief butler and waited on the flesh, therefore the chief butler did not remember Joseph, but forgot him, until the time of the end when the Lord came that he should be released.

The Targum, an Insight of Ezra (C)

•April 13, 2026 • Leave a Comment

The Targum, which originated in the Aramaic language and is strongly linked to the work of Ezra, holds significance for shedding light on biblical concepts. When the Masoretic Text can be vague, uncertain, or unclear, the Targum often offers clearer meaning, broader insight, and deeper understanding.

Yes, sometimes the Targum clarifies metaphors and interprets idioms or difficult passages instead of translating them literally, which often makes no sense. Such an endeavor should be highly commended rather than criticized.

For example, the Targum interprets natural imagery—like cedars, cypresses, oaks, forests, and fire—as metaphors for political political and social structures, especially kings, rulers, governors, and wealthy elites. Such imagery can be sweeping: forests laid waste, lions roaring as their habitat is destroyed, and power structures crumbling. Fire symbolizes divine punishment, sweeping through defenses and dismantling the very foundations of their power.

Translating such natural imagery literally could convey limited information or even distort it, but Ezra was determined to share their true meaning. He was a righteous man, for God had prepared his heart to seek the law of the Lord, to follow it, and to teach the statutes and judgments in Israel Ezra 7:10.

Abraham

(1) And He said unto Abram, “Know of a surety that thy seed shall be a stranger in a land that is not theirs, and shall serve them; and they shall afflict them four hundred years. Genesis 15:13

— the Septuagint confirms the 400 years timeframe “in a land not their own,”

— however, the Targum of Jerusalem neglects mentioning the timeframe but adds the four kingdoms being revealed to Abraham and identifies the fourth Roman Empire as Edom’s

And when the sun was going to set, a sleep profound and sweet fell upon Abram. And, behold, Abram saw four kingdoms which should arise to bring his sons into subjection (and) Terror; the Greatness of Darkness Fell upon him: Terror, that is Bavel; Darkness, that is Media; Greatness, that is Greece; Fell, that is Edom, (Rome) that fourth kingdom which is to Fall, and never to rise again for ever and ever. Genesis 15:13 Jerusalem

Esau and Jacob

Emboldened by the ease of capturing President Maduro and his wife, the United States would be considering a “second wave” targeting the Mexican president, the Colombian president and perhaps even Panama, Greenland and Canada to bring them into the American empire.

The Monroe Doctrine since its initial inception in 1823 hadn’t achieved its full objective yet. Perhaps with President Trump’s Second Coming as he perceived himself, he might finally succeed in achieving the American Dream of uniting the whole Western American Hemisphere.

(1) “And Esau hated Jacob because of the blessing wherewith his father blessed him. And Esau said in his heart, “The days of mourning for my father are at hand. Then will I slay my brother Jacob.” Genesis 27:41

— the Masoretic Text is ambigious, not explicit as to why it has anything to do with mourning; as Isaac hadn’t died, nor was he in his sick bed; or why Esau would need to wait until the mourning was over. And as Jacob has more than 20 years travelling north to live with Laban and returned to see Isaac who was still alive;

— Isaac died at the age of 180, full of days; and both sons, Esau and Jacob, buried him:

28 And the days of Isaac were a hundred and fourscore years.
29 And Isaac gave up the ghost and died, and was gathered unto his people, being old and full of days; and his sons Esau and Jacob buried him, Genesis 35:28–29.

— the Masoretic offers the shell, but the Targum brings forth the Genesis account which reveals with greater insight. Esau realized that Cain had made a mistake by killing Abel too soon; he plans, instead, to delay his revenge until Isaac’s death, avoiding Cain’s mistake; as after Abel’s death, Adam and Eve had another son, Seth, and the birthright slipped away from Cain;

“And Esau harbored hatred in his heart against Jacob, his brother, because of the blessing with which his father had blessed him. And Esau said in his heart, ‘I will not do as Cain did, who killed Abel during their father’s lifetime and then their father had another son, Seth. Rather, I will wait until the days of mourning for my father have passed, and then I will kill Jacob my brother, and I will be the sole heir.’” Genesis 27:41 Jonathan

— that is, explaining what the Masoretic Text lacks: Esau reasoned that he wouldn’t repeat Cain’s error. Instead, by his calculation, by waiting, he will both avenge himself and secure the birthright; hence he would wait until his father had died and the mourning period had passed before killing Jacob, so he would solely inherit the birthright;

— in short, the Targum provides greater insights, portrays Esau as harboring Cain-like hatred but scheming to avoid Cain’s mistake. He plans to kill Jacob only after Isaac’s death, believing this will secure both vengeance and inheritance. This interpretive expansion deepens the biblical narrative by casting Esau as a new Cain, while also explaining Rebecca’s urgent intervention;

— then, following a severe drought in his homeland of Canaan, Jacob and his descendants migrated to neighboring Egypt through the help of his son Joseph, who had become a trusted confidant of the pharaoh. Jacob died in Egypt at the age of 147 and believed to have been buried in the Cave of Machpelah in Hebron. What happened—did Esau fail to kill his brother as he had once vowed to do? Did Esau repent, or was it all part of a prophecy?

— if Esau had repented, what made him repent? Or is this a prophecy? Or is this not a prophecy; and if it is not a prophecy, why is there a strange prophecy just pops up out of the book of Ezekiel some two thousand and eight hundred years later? What does it mean?

— and this strange prophecy is in Ezekiel 20:45 to 21:7

45 Moreover the word of the Lord came unto me, saying,
46 “Son of man, set thy face toward the south, and drop thy word toward the south, and prophesy against the forest of the southland.
47 And say to the forest of the south: ‘Hear the word of the Lord. Thus saith the Lord God: Behold, I will kindle a fire in thee, and it shall devour every green tree in thee and every dry tree. The flaming flame shall not be quenched, and all faces from the south to the north shall be burned therein.
48 And all flesh shall see that I, the Lord, have kindled it; it shall not be quenched.’”
49 Then said I, “Ah, Lord God! They say of me, ‘Doth he not speak parables?’”
21 And the word of the Lord came unto me, saying,
2 “Son of man, set thy face toward Jerusalem, and drop thy word toward the holy places, and prophesy against the land of Israel;
3 and say to the land of Israel, ‘Thus saith the Lord: Behold, I am against thee, and will draw forth My sword out of his sheath and will cut off from thee the righteous and the wicked.
4 Seeing then that I will cut off from thee the righteous and the wicked, therefore shall My sword go forth out of his sheath against all flesh from the south to the north,
5 that all flesh may know that I, the Lord, have drawn forth My sword out of his sheath. It shall not return any more.’
6 Sigh therefore, thou son of man, with the breaking of thy loins, and with bitterness sigh before their eyes.
7 And it shall be, when they say unto thee, ‘Why sighest thou?’ that thou shalt answer, ‘For the tidings, because it cometh; and every heart shall melt, and all hands shall be feeble, and every spirit shall faint, and all knees shall be weak as water.’ Behold, it cometh, and shall be brought to pass, saith the Lord God.” Ezekiel 20:45-21:7

For an indepth Study, see The Flaming Sword and Fire from the South!

(2) “And by thy sword shalt thou live, and shalt serve thy brother; and it shall come to pass when thou shalt have the dominion, that thou shalt break his yoke from off thy neck”

41 “And Esau hated Jacob because of the blessing wherewith his father blessed him. And Esau said in his heart, “The days of mourning for my father are at hand. Then will I slay my brother Jacob.” Genesis 27:40-41

— the Targum agrees with the Masoretic Text that Esau (1) would live by the sword; Upon thy sword shalt thou depend,” that is, Esau would be living by force and violence; and that Esau (2) would “shalt serve thy brother,” that is, be subveriant to his brother Jacob; but that eventually Esau (3) would regain his independence from Jacob: “thou shalt break his yoke from off thy neck;”

And upon thy sword shalt thou depend, entering at every place: yet thou shalt be supple and credulous, and be in subjection to thy brother; but it will be that when his sons become evil, and fall from keeping the commandments of the law, thou shalt break his yoke of servitude from off thy neck. Genesis 27:41 Jonathan

“And Esau kept hatred in his heart against Jakob his brother, on account of the order of blessing with which his father had blessed him. And Esau said in his heart, I will not do as Kain did, who slew Habel in the life (time) of his father, for which his father begat Sheth, but will wait till the time when the days of mourning for the death of my father come, and then will I kill Jakob my brother, and will be found the killer and the heir,” Genesis 27:42 Jonathan

— the Targum confirms the Masoretic Text (1 to 3) above, but adds with deeper insights on (4) when and how Esau would take his revenge: when his sons become evil, and fall from keeping the commandments of the law, then Esau would break his yoke of servitude from off thy neck;” and (5) Esau decides to wait until Isaac’s death. Only then will he kill Jacob, ensuring that no new rival brother will be born; this is a cold calculated strategic delay to have his revenge and the birthright restored back to him.

(3a) And ye shall keep it up until the fourteenth day of the same month, and the whole assembly of the congregation of Israel shall kill it in the evening.

And they shall eat the flesh in that night, roasted with fire; and with unleavened bread and with bitter herbs they shall eat it. Exodus 12:6,8

— the expression “the fourteenth day” is clear; what is not clear is the next phase “in the evening” (ben ha arbayim); “between the [two] evenings; because in Jewish reckoning, the day starts at the going down of the sun, the evening could be at the beginning or end of the day; hence the Masoretic Text is vague as to when to kill the lamb;

— “between the evenings” – the first evening was to begin with the decline of the sun from the zenith, and the second begins with sunset;

— the Targum clears up the ambiguity by explaining that the lamb is to be eaten on the night of the fifteenth of Nisan,

And it shall be bound and reserved for you until the fourteenth day of this month, that you may not know the fear of the Mizraee when they see it; and ye shall kill him according to the rite of all to congregation of the assembly of Israel, between the suns.

And you shall eat the flesh on that night, the fifteenth of Nisan, until the dividing of the night roasted with fire, without leaven, with horehound and lettuce shall you eat it. Exodus 12:6,8 Jonathan

— this eating of the Passover is during the night of the fifteenth. The phase “until the dividing of the night” means until midnight; that is, they were to eat until midnight;

— finally, if this is the night of the fourteenth, there shouldn’t be able to take unleavened bread, “without leaven;” because unleavened bread were unavailable that night;

(3b) Now the sojourning of the children of Israel who dwelt in Egypt was four hundred and thirty years. Exodus 12:40

— the Targum clarifies the number by sayig, “But the number of four hundred and thirty years (had passed away since) the Lord spoke to Abraham,” (Genesis 15:13)

And the days of the dwelling of the sons of Israel in Mizraim were thirty weeks of years, (thirty times seven years,) which is the sum of two hundred and ten years. But the number of four hundred and thirty years (had passed away since) the Lord spake to Abraham, in the hour that He spake with him on the fifteenth of Nisan, between the divided parts, until the day that they went out of Mizraim. Exodus 12:40 Jonathan

(4) These are the generations of the heavens and of the earth when they were created, in the day that the Lord God (יְהוָה אֱלֹהִים) made the earth and the heavens, Genesis 2:4

— this is the first time God’s name YHVH יְהוָה was introduced; but introduces as a compound name, LORD God;

— these are the generations of the heavens and the earth, when they were created; that is, their creation being a sort of birthday;

— the Targum Onkelos translates יְהוָה as Adonoy but it could have being ‘Yehovah,’ or LORD, saying

This is the history of the heavens and the earth when they were created, on the day when Adonoy Elohim made earth and heaven.

— from this verse on, the Onkelos consistently uses the divine name as “Adonoy Elohim,” that is, the text uses יְיָ אֱלֹהִים which could be translated as the “Lord God,” not just “God.”

(5) And the Lord God caused a deep sleep to fall upon Adam, and he slept; and He took one of his ribs, and closed up the flesh instead thereof. Genesis 2:21

— this is a classic example of the Targum adding specific details that aren’t in the original Hebrew; the Targum of Jonathan specifies that it was Adam’s thirteenth rib of the right side, 

And the Lord God threw a deep slumber upon Adam, and he slept. And He took one of his ribs, it was the thirteenth rib of the right side, and closed it up with flesh.

— according to Jewish thoughts, man was created with 13 ribs on each side, totaling 26. In Gematria (Jewish numerology), 26 is the numerical value of the Tetragrammaton (the four-letter name of God, YHVH). By taking one rib to create woman, the text suggests that the divine “wholeness” of the human being is achieved only when man and woman, each with 24 ribs, are joined back together.

(6) And in process of time it came to pass that Cain brought of the fruit of the ground an offering unto the Lord. Genesis 4:3

— in process of time; might be after a harvest, or after a long indefinite period, shown by the age of Adam at the birth of Seth to have been something less than 130 years;

— the Targum of Jonathan says “it was at the end of days, on the fourteenth of Nisan,” as it was already the Passover since the sacrifice was offered on the late afternoon or evening of the fourteenth;

And it was at the end of days, on the fourteenth of Nisan, that Kain brought of the produce of the earth, the seed of cotton (or line), an oblation of first things before the Lord;

(7) And Adam lived a hundred and thirty years, and begot a son in his own likeness, after his image, and called his name Seth. Genesis 5:3

— in his own likeness, after his image; that is, Adam handed down to his posterity that Divine likeness which he had himself received;

— the Targum of Jonathan adds further insight of Cain not having the likeness of Adam

“And Adam lived one hundred and thirty years, and he begot Seth, who was like his image and his likeness; for before this, Eve had given birth to Cain, who was not like him, and Abel was killed by his hands, and Cain was banished—and his [Cain’s] descendants were not recorded in the book of the genealogy of Adam; but after this, he [Adam] begot one who was like him, and he called his name Seth.”

(8) And Enoch walked with God; and he was not, for God took him. Genesis 5:24

— the phrase “and he was not, for God took him” is vague;

— the Targum of Jonathan clarifies that Enoch was withdrawn and ascended to another world;

“And Enoch served in truth before the Lord; and behold, he was not with the sojourners of the earth; for he was withdrawn, and he ascended to the firmament by the Word before the Lord, and he called his name Metatron, the Great Scribe.”

— besides being withdrawn and ascended, Jonathan adds another revelation: the title “Great Scribe” fits his role in divine administration and heavenly record‑keeping. Thus instead of the mournful refrain when one died, we have here an early removal into another world, suggesting Enoch, in this special case, may have the highest form of blessing.

(9a) that the sons of God saw the daughters of men, that they were fair; and they took for themselves wives of all whom they chose. Genesis 6:2

— the Targum of Jonathan says

“And the sons of the great ones (nobles/angels) saw the daughters of men, that they were beautiful;

(9b) And the Lord said, “My Spirit shall not always strive with man, for he also is flesh; yet his days shall be a hundred and twenty years.” Genesis 6:3

— the Targum Jonathan amplifies the role of God’s Holy Spirit, which empower them to do good deeds, yet they rebelled against them

“And the Lord said by His Word: All the wicked generations that are to arise shall not be judged according to the order of the judgment of the generation of the Flood, to be destroyed and annihilated from the midst of the world. Did I not place My Holy Spirit in them so that they might perform good deeds? And behold, they have made their deeds evil. Behold, I have given them a delay (a long term) of one hundred and twenty years, so that they might perform repentance—but they did not.”

(9c) There were giants on the earth in those days; and also after that, when the sons of God came in unto the daughters of men and they bore children to them, the same became mighty men who were of old, men of renown. Genesis 6:4

— the Targum Jonathan discloses the names of angels that sinned

Shamhazai and Uziel—they are the ones who fell from heaven and were on the earth in those days, and also afterward, when the sons of the great ones came into the daughters of men, and they bore children to them; and they are called the mighty men of old, men of renown (men of names).

(10a) And Noah awoke from his wine, and knew what his younger son had done unto him. Genesis 9:24

— the Targum of Jonathan says,

And Noach awoke from his wine, and knew, by the relation of a dream, what had been done to him by Cham his son, who was inferior in worth, on the account that he had not begotten a fourth son.

— it suggests Noah didn’t see it happen while awake, or being told by Shem and Japhet, but rather it was revealed to him in a prophetic dream while he slept; which elevates the episode from a family dispute to a divinely disclosed moral offense;

— the “fourth son” this suggests that Ham didn’t just mock his father’s nakedness, but physically castrated him or otherwise interfered with his procreative ability to prevent Noah from fathering a fourth son who would compete for the inheritance of the post-flood world;

— so as Ham deprived Noah of a fourth son, so Ham’s fourth son, Canaan, is cursed measure-for-measure; Jonathan interprets Ham’s act as an active wrongdoing, not merely seeing his father’s nakedness; hence framing Ham as “inferior in worth,” or lacking the righteousness expected of Noah’s household.

(10B) And he said, “Cursed be Canaan! A servant of servants shall he be unto his brethren.” Genesis 9:25

— the Targum of Jonathan says,

And he said, Accursed is Kenaan who is his fourth son, a serving servant shall he be to his brethren.

(11a) And the whole earth was of one language, and of one speech. Genesis 11:1

— the whole earth; that is, all mankind at that time; and that language was, obviously, the Hebrew;

— as the Targum of Jonathan says:

And all the earth was (of) one language, and one speech, and one counsel. In the holy language spake they, that by which the world had been created at the beginning.

— the Targum Jerusalem affirms, saying

And all the inhabiters of the earth were (of) one language, and of one speech, and one counsel: for they spake the holy language by which the world was created at the beginning.

(11b) And they said, “Come, let us build us a city and a tower whose top may reach unto heaven; and let us make us a name, lest we be scattered abroad upon the face of the whole earth.” Genesis 11:4

— the Targum of Jonathan reveals their idol-worshipping inclinations, saying

And they said, Come, we will build us a city and a tower, and the head of it shall come to the summit of the heavens; and we will make us (an image for) worship on the top of it, and put a sword in his hand to act against the array of war, before that we be scattered on the face of the earth.

(11c) Come, let Us go down, and there confound their language, that they may not understand one another’s speech.” Genesis 11:7

— the Targum of Jonathan reveals God speaking to the 70 angels

And the Lord said to the seventy angels which stand before Him, Come, we will descend and will there commingle their language, that a man shall not understand the speech of his neighbour.

(11d) So the Lord scattered them abroad from thence upon the face of all the earth; and they left off building the city. Genesis 11:8

— the Targum of Jonathan reveals that each angel is over one nation and one language

And the Word of the Lord was revealed against the city, and with Him seventy angels, having reference to seventy nations, each having its own language, and thence the writing of its own hand: and He dispersed them from thence upon the face of all the earth into seventy languages. And one knew not what his neighbour would say: but one slew the other; and they ceased from building the city. Genesis 11:8 Jonathan

(12) And Haran died before his father Terah in the land of his nativity, in Ur of the Chaldeans. Genesis 11:28

— the Targum of Jonathan reveals much more insight: that Haran hesitates, trying to hedge his bets: “If Nimrod wins, I’ll join him; if Abram wins, I’ll join him,”

And it was when Nimrod had cast Abram into the furnace of fire because he would not worship his idol, and the fire had no power to burn him, that Haran’s heart became doubtful, saying, If Nimrod overcome, I will be on his side: but if Abram overcome, I will be on his side.

And when all the people who were there saw that the fire had no power over Abram, they said in their hearts, Is not Haran the brother of Abram full of divinations and charms, and has he not uttered spells over the fire that it should not burn his brother?

Immediately (min yad, out of hand) there fell fire from the high heavens and consumed him; and Haran died in the sight of Terah his father, where he was burned in the land of his nativity, in the furnace of fire which the Kasdai had made for Abram his brother. Genesis 11:28 Jonathan

— fire falls from heaven and kills Haran, an unstable figure caught between them, exposing his wavering heart and punishing his opportunistic assumption. Contrast this with Abram: Abram’s unwavering refusal to worship idols is highlighted by Haran’s indecision.

— Jonathan incorporated detail trials of Abraham and Haran found in the Book of Jasher (endosed in the Masoretic Test: Joshua 10:13, II Samuel 1:18)

21 And they brought them both, Abram and Haran his brother, to cast them into the fire; and all the inhabitants of the land and the king’s servants and princes and all the women and little ones were there, standing that day over them.

22 And the king’s servants took Abram and his brother, and they stripped them of all their clothes excepting their lower garments which were upon them.

23 And they bound their hands and feet with linen cords, and the servants of the king lifted them up and cast them both into the furnace.

24 And the Lord loved Abram and he had compassion over him, and the Lord came down and delivered Abram from the fire and he was not burned.

25 But all the cords with which they bound him were burned, while Abram remained and walked about in the fire.

26 And Haran died when they had cast him into the fire, and he was burned to ashes, for his heart was not perfect with the Lord; and those men who cast him into the fire, the flame of the fire spread over them, and they were burned, and twelve men of them died. Jasher 12:21-26

(13) And it came to pass in the days of Amraphel king of Shinar, Arioch king of Ellasar, Chedorlaomer king of Elam, and Tidal king of nations, Genesis 14:1

— the Targum of Jonathan reveals that Amraphel king of Shinar was Nimrod and validates the story found in the Book of Jasher 

And it was in the days of Amraphel,–he is Nimrod, who commanded Abram to be cast into the furnace; he was then king of Pontos; Ariok, (so called) because he was (arik) tall among the giants, king of Thalasar, Kedarlaomer, (so called) because he had bound himself (or gone over) among the bondmen of the king of Elam, and Thidal, crafty as a fox, king of the peoples subjected to him,

(14) And Melchizedek king of Salem brought forth bread and wine; and he was the priest of the Most High God. Genesis 14:18

— and Melchizedek king of Salem; both the Targums of Jonathan and Jerusalem say, this is Shem, the son of Noah;

— though it is highly probable Shem was living at this time, yet it is not easy to account for it why his name should be changed, or that he should reign in a country in the possession of his brother’s son; or that he should meet Abram, and congratulate him on the slaughter of one of his own descendants;

— some have thought him to be more than a mere man, even the Son of God himself, but he is manifestly distinguished from him in Hebrews 7:

“For this Melchizedek, king of Salem, priest of the Most High God, met Abraham, who was returning from the slaughter of the kings, and blessed him.

To him also Abraham gave a tenth part of all, Melchizedek first being by interpretation “king of righteousness,” and after that also king of Salem, which means “king of peace.”

Without father, without mother and without descent, having neither beginning of days nor end of life, but made like unto the Son of God, he abideth a priest continually.” Hebrews 7:1-3

— the Targum Onkelos says

Malki Zedek, king of Shaleim [Yerushalayim], brought out bread and wine. He was a Kohein of [He was serving before] the Most High Almighty.

— the Targum of Jonathan identifies the mysterious priest-king Melchizedek

And Malka Zadika, who was Shem bar Noah, the king of Yerushalem, came forth to meet Abram, and brought forth to him bread and wine; and in that time he ministered before Eloha Ilaha.

“And the righteous king—he is Shem, the son of Noah, the king of Jerusalem—went out to meet Abram and brought out to him bread and wine; at that time, he was ministering before God Most High.”

(15) After these things the word of the Lord came unto Abram in a vision, saying, “Fear not, Abram. I am thy shield and thy exceeding great reward.” Genesis 15:1

— the Targum of Jonathan sets the scene for Abraham’s personal worries, which prompt the Lord’s response, saying

‘Woe to me! Perhaps now I have received the reward for my appointments in this world, and I will have no portion in the World to Come.
Or perhaps the brothers and relatives of those whom I killed will go and join themselves into legions and come against me.
Or perhaps at that [previous] time some small merit was found with me and therefore they fell before me, but at another time merit will not be found with me and the Name of Heaven will begin judgment against me.’

Then the word of the Lord came to Abram in a vision, saying:

‘Do not fear. Even though their warriors gather in legions and come against you, My Word will be your shield.
And even though they fell before you in this world, the reward of your good deeds is kept and prepared before Me for the world to come — very great.’”

(16) And He said unto him, “Take Me a heifer of three years old, and a shegoat of three years old, and a ram of three years old, and a turtledove, and a young pigeon.”

10 And he took unto Him all these, and divided them in the midst and laid each piece one against another; but the birds divided he not.

11 And when the fowls came down upon the carcasses, Abram drove them away. Genesis 15:9-11

— the Targum Onkelos says

Birds of prey [vultures] descended upon the carcasses, but Avram drove them away.

— in a standard sacrificial offering (Olah), the animals are slaughtered and burnt on an altar. However, here, Abraham cuts them in half and lays the pieces facing each other, but he does not light a fire;

— it’s worth noting that the Targums identify the fowls as birds of prey, or specifically the predatory vultures that came down, which symbolize their plundering neighbours, the “kingdoms of the earth.” Historically, these are: Assyria, Babylon, Persia, Greece, Rome and the Ottoman empire, but during the endtime:

A) Ezekiel 4 – 390/40 Years Timeline

B) The Flaming Sword and Fire from the South!

C) A Psalm 83 Prophecy

D) A Greater “Out of Egypt” Exodus (another Exodus for the twelve tribes)

E) Return of the Whole House of Israel – Ezekiel 36-37 (stick of Judah to be joined to the stick of Joseph)

F) The Gog and Magog Prophecy (triumph of Ephraim finally)

In all these Abraham’s shooing off the birds of prey away during the endtime, as Gentile nations are trying to destroy the nation of Israel, Abraham’s act of “driving them away” was a fulfilment that it was his own endeavor to protect his descendants throughout their history; the Septuagint version says, “Abram sat by them;” he sat by the carcasses and watched them, that no hurt came to them;

— and it is important to note that it wasn’t God who drove the vultures away, but Abraham. And as the offering were not burnt and be accepted by God immediately, hence God’s initial promise of “Fear not, Abram. I am thy shield and thy exceeding great reward” is not quickly consumated. Or, for another explanation, that God had promise the Shield protection initially, but Abraham’s lack of faith by asking for a sign, and the burnt offering wasn’t consumated immediately;

And I will give the men who have transgressed My covenant, who have not performed the words of the covenant which they had made before Me when they cut the calf in twain and passed between the parts thereof—

the princes of Judah and the princes of Jerusalem, the eunuchs, and the priests, and all the people of the land who passed between the parts of the calf— Jeremiah 23:18-19

— note that this covenant was meant to Abraham’s posterity who had transgressed God’s covenant, “who have not performed the words of the covenant,” reenforcing the theme that sinners need to go through numerous trials to purify themselves before God;

— and although the offering was not burnt and be accepted immediately, it should also be noted that later on, “a smoking furnace and a burning lamp passed between those pieces; v17” synifying that at the end, God did accept the sacrifices ultimately. But then, this happened later, after Abraham had to shoo off the birds of prey through his own effort.

For more, see Sequence of Keystone Prophecies till the End

(17) And when the sun was going down, a deep sleep fell upon Abram; and lo, a horror of great darkness fell upon him. Genesis 15:12

— the Targum Jerusalem reveals the four kingdoms; and that Edom is Rome

“And it was when the sun was going down to set, a deep and pleasant sleep fell upon Abram; and behold, Abram saw the four kingdoms that were destined to rise to enslave his children: Dread—which is Babylon; Darkness—which is Media; Great—which is Greece; Falling—which is the kingdom of Persia (Rome/Edom), which is destined to fall and shall have no rising again for ever and ever.”

(18) On the same day the Lord made a covenant with Abram, saying, “Unto thy seed have I given this land, from the river of Egypt unto the great river, the River Euphrates. Genesis 15:18

— which river of Egypt is not spelt out;

— the Targum of Jonathan identifies the Nile of Egypt specifically, saying

“On that day, the Lord made a covenant with Abram—[decreeing] not to judge his children in [Gehenna] and to redeem them from the [oppression of] kingdoms—saying: ‘To your children I give this land, from the Nile of Egypt unto the great river, the river Euphrates.’”

(19) And Sarai said unto Abram, “My wrong be upon thee. I have given my maid into thy bosom; and when she saw that she had conceived, I was despised in her eyes. The Lord judge between me and thee.” Genesis 16:5

— the Targum of Jonathan reveals Sarai’s deep sense of betrayal but she didn’t acknowledged her role in asking Abram to lie with her maidservant Hagar; and that the Pharaoh was a son of Nimrod

“And Sarai said to Abram: ‘All my suffering is because of you! For I was confident that you would act with justice for me, as I left my land and my father’s house and came with you to a foreign land. And now, because I was not bearing children, I freed my handmaid and gave her into your embrace; but she saw that she had conceived, and my honor became despised in her sight.

And now, let my suffering be revealed before the Lord, and let Him spread His peace between me and you, and let the earth be filled from us, so that we shall not need the children of Hagar, the daughter of Pharaoh, the son of Nimrod—who cast you into the fiery furnace!’”

(20) And he lifted up his eyes and looked, and lo, three men stood by him. And when he saw them, he ran to meet them from the tent door, and bowed himself toward the ground, Genesis 18:2

— the Targum of Jonathan reveals that ministering angels are usually send with a single duty, says

“And he lifted up his eyes and looked, and behold, three angels in the likeness of men were standing before him, who were sent for the need of three specific things; for it is not the way of the ministering angels to be sent for more than one single matter.

One came to bring him the news that Sarah would bear a male son; one came to rescue Lot; and one came to overthrow Sodom and Gomorrah. And when he saw them, he ran to meet them from the door of the tent and bowed down to the ground.”

(21) But his wife looked back from behind him, and she became a pillar of salt. Genesis 19:26

— but his wife looked back from behind him; herein she disobeyed an express command; according to the Targums of Jonathan and Jerusalem, she was a native of Sodom; hence menories of her kinmen and sons-in-law; and she became a pillar of salt;

— the Targum of Jonathan says

“And his wife looked from behind the angel to know what would be the end of her father’s house, for she was of the daughters of the Sodomites; and because she had sinned with salt by revealing [the presence of] the poor, behold, she was made a pillar of salt.”

— the Targum Jerusalem says

“Because Lot’s wife was from the children of the children of the people of Sodom, she looked back from behind her to see what would be the end of her father’s house; and behold, she stands as a pillar of salt until the time when the Resurrection comes, when the dead shall live.”

(22a) And Sarah saw the son of Hagar the Egyptian, whom she had borne unto Abraham, mocking. Genesis 21:9

— the Targum of Jonathan reveals why Sarah was mocking Ismael, saying

“And Sarah saw the son of Hagar the Egyptian, whom she had borne to Abraham, mocking [with] foreign worship (idolatry) and bowing down to the Lord.”

— according to tradition, Ishmael had begun to build altars and perform pagan rituals he had learned from his mother’s Egyptian heritage. In Sarah’s eyes, this wasn’t just “kids being kids”—it was a spiritual idoltary, yet on Abraham’s order, he would bow to the Lord;

(22b) Therefore she said unto Abraham, “Cast out this bondwoman and her son; for the son of this bondwoman shall not be heir with my son, even with Isaac.” Genesis 21:10

— the Targum of Jonathan emphasizes the prospect of wars between them, saying

“And she said to Abraham: ‘Cast out this handmaid and her son; for it is not right (proper) that the son of this handmaid should inherit with my son, lest he wage war with Isaac.‘”

(22c) And the thing was very grievous in Abraham’s sight because of his son Genesis 21:11

— the Targum of Jonathan reveals that Ismael was beginning with idol worship

“And the matter was very evil in the eyes of Abraham on account of Ishmael his son, because he [Ishmael] might worship foreign worship (idolatry).

(22d) And she went and sat down apart from him a good way off, as it were, a bowshot; for she said, “Let me not see the death of the child.” And she sat opposite him, and lifted up her voice and wept. Genesis 21:16

— Hagar, in distress, cried out, Let me not see the death of the child; she could not bear to hear his dying groans, and see him in his dying agonies

— the Targum of Jonathan says

And she went and sat on one side, and cast away the idol (or the strange worship), and removed from her son, as the distance of an arrow from the bow; for she said, I am not able to see the death of the child. And she sat over against her son, and lifted up her voice and wept.

(23) Then again Abraham took a wife, and her name was Keturah. Genesis 25:1

— the Targum of Jonathan says that Keturah was Hagar

“And Abraham added and took a wife, and her name was Keturah; she is Hagar, who had been bound to him from the beginning.”

— Targum Pseudo-Jonathan (along with Rashi and Midrash Genesis Rabbah 61:4) explicitly identifies Keturah as Hagar; which could explain why she was still called Abraham’s concubine, 1Ch 1:32. The logic is that after Sarah died and Isaac was married, Abraham returned to his original concubine.

(24) And it came to pass after the death of Abraham, that God blessed his son Isaac; and Isaac dwelt by the well Lahairoi. Genesis 25:11

— the Targum of Jonatham adds some complexities, saying:

And because Abraham had not designed to bless Ishmael, therefore he blessed not Isaac; for had he blessed Izhak and not Ishmael, it would have kept them in enmity.

But, after the death of Abraham, the Lord blessed Isaac; and Isaac dwelt near the well at which was revealed the glory of the Living and Eternal One, who seeth and is not seen.

— the Targum fills the silence by explaining Abraham’s dilemma. Abraham loved both sons; he knew the primary blessing belonged to Isaac, but he feared that a public formal blessing of Isaac would incite Ishmael’s enmity, a grudge or hatred. To maintain peace in the family while he was alive, Abraham refrained from blessing either.

(25a) And the children struggled together within her; and she said, “If it be so, why am I thus?” And she went to inquire of the Lord.

And the Lord said unto her, “Two nations are in thy womb, and two manner of people shall be separated from thy body; and the one people shall be stronger than the other people, and the elder shall serve the younger.” Genesis 25:22-23

— the Targums of Jonathan says

“And the children struggled within her, and it was like men fighting. And she said, ‘If this is the pain of pregnancy, why do I desire children?’ So she went to the study hall of Shem the Great to seek mercy from before the Lord.”

“And the Lord said to her, ‘Two nations are in your womb, and two kingdoms will separate from your belly. One kingdom will be stronger than the other, and the elder will serve the younger if the descendants of the younger keep the commandments of the Torah.’” Genesis 25:22-23 Jonathan

— important to note that “the elder will [only] serve the younger if the descendants of the younger keep the commandments of the Law.”

(25b) And when her days to be delivered were fulfilled, behold, there were twins in her womb.

And the first came out red, all over like a hairy garment; and they called his name Esau. Genesis 25:24-25

— the Targums of Jonathan says Esau was born as if he was already a grown man

And the two hundred and seventy days of her being with child were completed to bring forth; and, behold, twins were in her womb.

And the first came forth wholly red, as a garment of hair: and they called his name Esau, because he was born altogether complete, with the hair of the head, and the beard, and teeth, and grinders.

(26) Then Jacob gave Esau bread and pottage of lentils; and he ate and drank, and rose up and went his way. Thus Esau despised his birthright. Genesis 25:34

— the Targum of Jonathan reveals Esau care little about his posterity’s welfare

“And Jacob gave to Esau bread and a cooked dish of lentils; and he ate and drank, and rose up and went. And Esau despised the birthright and [his] portion in the World to Come.”

(27) And he also had made savory meat, and brought it unto his father and said unto his father, “Let my father arise and eat of his son’s venison, that thy soul may bless me.” Genesis 27:31

— the Targum of Jonathan reveals how God could have interfered should Rebekah had trusted in the Lord and let him run his will, saying

And the Word of the Lord had impeded him from taking clean venison; but he had found a certain dog, and killed him, and made food of him, and brought to his father, and said to his father, Arise, my father, and eat of my venison, that thy soul may bless me.

(28)  And by thy sword shalt thou live, and shalt serve thy brother; and it shall come to pass when thou shalt have the dominion, that thou shalt break his yoke from off thy neck.”

And Esau hated Jacob because of the blessing wherewith his father blessed him. And Esau said in his heart, “The days of mourning for my father are at hand. Then will I slay my brother Jacob.” Genesis 27:40-41

— the Targum Jonathan reveals Esau’s delayed intent of killing his brother Jacob; in fact it is a latter-day prophecy for the house for Esau against the house of Jacob:

“And upon thy sword shalt thou depend, entering at every place: yet thou shalt be supple and credulous, and be in subjection to thy brother [Jacob]; but it will be that when his sons [the modern children of Israel] become evil, and fall from keeping the commandments of the law, thou shalt break his yoke of servitude from off thy neck….and then will I kill Jakob my brother, and will be found the killer and the heir”  Genesis 27:40-41 Jonathan (abridged)

— or for a more modern translation:

“And by your sword shall you live, you will go to every place, and wander, and you will be subject to your brother. But if his descendants abandon the commandments of the Torah, then you will break his yoke from your neck.”

“And Esau harbored hatred in his heart against Jacob his brother because of the blessing with which his father had blessed him. And Esau said in his heart, ‘I will not do as Cain did, who killed Abel during their father’s lifetime and then their father had another son, Seth. Rather, I will wait until the days of mourning for my father have passed, and then I will kill Jacob my brother, and I will be the sole heir’” (unabridged).

— a bit more on what this phase means “and will be found the killer and the heir;” that is, by delaying and waiting for Jacob’s killing, Esau hopes he would both be the killer and the only heir. Hence Esau harboured thoughts he would not do that immediately; but waits until they forget God’s law, until today’s hardcore “liberal democracies” that championed LGBTqia’s rights and wokeism;

— instead, he would delay the killing of Jacob until the death of Isaac, for if Isaac is dead, he had no chance of fathering another son; so that when Jacob is killed after Isaac is dead, Esau will become the only son, hence the sole heir.

(29) And God Almighty bless thee, and make thee fruitful, and multiply thee, that thou mayest be a multitude of people; Genesis 28:3

— the Targum Jonathan says

“And may God Almighty bless you with many possessions, and make you fruitful and multiply you into thirteen tribes; and may you be worthy of the Assembly of the members of the Sanhedrin, whose number is seventy, corresponding to the number of the nations.

(30)  And it came to pass, when Laban heard the tidings of Jacob his sister’s son, that he ran to meet him, and embraced him and kissed him, and brought him to his house. And he told Laban all these things. Genesis 29:13

— the Targum of Jonathan says

“And it was, when Laban heard the report of the mighty deeds and the righteousness of Jacob, his sister’s son—how he had taken the birthright and the order of the blessings from the hand of his brother; and how the Lord had revealed Himself to him at Bethel; and how he had fenced in the stone; and how the well had overflowed and risen to its surface—he ran to meet him, and embraced him, and kissed him, and brought him to his house. And Jacob recounted to Laban all these things.”

— in the Masoretic Text, “all these things” is vague; the Targum makes it clear that Jacob was open about his history; that he was a fugitive from Esau, that he had experienced divine miracles; which sets up the irony: to let Laban knows Jacob is divinely blessed, yet Laban spends the next twenty years cunningly trying to profit from him.

(31) And it came to pass, when Rachel had borne Joseph, that Jacob said unto Laban, “Send me away, that I may go unto mine own place and to my country. Genesis 30:25

— the Targum of Jonathan reveals how the posterity of Joseph, not Judah, were to be a yoke (Genesis 27:40) and a flame unto the house of Esau, saying

“And it was, when Rachel had given birth to Joseph, that Jacob said through the Holy Spirit that the House of Joseph is destined to be like a flame to consume the House of Esau. He said: ‘From now on, I am not afraid of Esau and his legions.’ And he said to Laban: ‘Send me away, that I may go to my own place and to my own land.’”

Jacob was afraid to return to Canaan because of his brother Esau; but this Jonathan version reveals through the Holy Spirit that Jacob knew Esau, the “stubble,” could only be defeated by the “flame” of Joseph (Jonathan narrative confirms in Obadiah 1:18). And so when Joseph was born, Jacob asked Laban to be sent back to his own country:

“And the house of Jacob shall be a fire, and the house of Joseph a flame, and the house of Esau for stubble; and they shall kindle them and devour them. And there shall not be any remaining of the house of Esau, for the Lord hath spoken it” Obadiah 1:18

The Spanish Armada, with 130 ships and 30,000 men on board, set sail from Spain in July 1588, intending to overthrow the Protestant Queen Elizabeth I and restore Catholic rule over England; but, with a devastating Divine Wind, were destroyed by the British Navy under Commander Sir Francis Drake

(32) These are the generations of Jacob. Joseph, being seventeen years old, was feeding the flock with his brethren; and the lad was with the sons of Bilhah, and with the sons of Zilpah, his father’s wives. And Joseph brought unto his father an evil report about them. Genesis 37:2

— and the lad was with the sons of Bilhah, and with the sons of Zilpah, his secondary wives or concubines; Joseph is the favorite of his father, but not of his brethren; especially those born of Leah; retaining the old grudge of their mother perhaps;

— the Targum of Jonathan reveals what the evils were, saying

“These are the generations of Jacob: Joseph was seventeen years old when he departed from the House of Study (Beit Midrasha). And he was a youth, brought up with the sons of Bilhah and the sons of Zilpah, his father’s wives. And Joseph brought an evil report of them—for he saw them eating meat torn from a living animal, specifically the ears and the tails; and he came and told their father.”

(33) Moreover I have given to thee one portion above thy brethren, which I took out of the hand of the Amorite with my sword and with my bow.” Genesis 48:22

— the Targum of Jonathan reveals the house of Joseph to inherit the city of Shechem

“And I, behold, I have given to you the city of Shechem, one portion as a gift, more than your brothers; which I took from the hands of the Amorites at the time that you entered into it, and I arose and assisted you with my sword and with my bow.”

— and inherit it as a “extra gift;” which, in Jewish law, the firstborn receives a double portion. By giving Joseph “one portion more than his brothers,” Jacob is effectively confirming that the Birthright has been transferred from the eldest (Reuben) to Joseph.

(34a) “Reuben, thou art my firstborn, my might, and the beginning of my strength, the excellency of dignity, and the excellency of power. Genesis 49:3

— Reuben~France, as the firstborn by nature, has the first place in the benedictory address;

— the Targum of Jonathan reveals how Reuben lost his birthright

“Reuben, you are my firstborn, the head of my strength, the beginning of my service, and the start of the city of my thoughts.

“It was fitting for you to have the Birthright, the High Priesthood, and the Kingdom.

“But because you sinned, my son, the Birthright was given to Joseph, the Kingdom to Judah, and the Priesthood to Levi.” Genesis 49:3 Jonathan

— great honor and power; the birthright was yours, the priesthood was yours, the kingship was yours, but now that you sinned, the birthright was given to Joseph, the priesthood to Levi, and the kingship to Judah.

The Battle of Waterloo, June 1815; the French Imperial Army under the Command of Napoleon was defeated by Arthur Duke of Wellington

(34b) Unstable as water, thou shalt not excel, because thou wentest up to thy father’s bed; then defiledst thou it; he went up to my couch. Genesis 49:4

— May Reuben live and not die (Deu 33:6, because such sin is to be stoned to death Deu 27:20); but thou shalt not excel, or be not the most eminent amongst thy brethren; thou hast lost thy pre-eminency due to thee by birthright, both for thyself and for thy posterity (no prominent character are from Reuben/French);

— Reuben most famous posterity, Napoleon, was best known not for his conquest, but for his defeat at Waterloo; and it shall be given to others; the priesthood to Levi, the dominion or septer to Judah (the Jews); and the double portion of birthright to Joseph (the Anglo-Saxons);

— the Targum of Jonathan reveals

“I compare you to a small garden into which light streams have entered, but then powerful, surging rivers overflowed it, and it could not withstand them and was overturned.

“So was your will broken, Reuben my son, for you sinned; but do not continue [to sin], and for the sin you committed, you shall be forgiven.

“For it was accounted to you as if you had entered the bed where your father had slept, in the time that you disordered my couch upon which you ascended.” Genesis 49:3 Jonathan

Question: the priesthood bestored upon the Levites, to operate in God’s Temple; the scepter and kingship belong to Judah, to rule and uphold God’s laws, statutes and ordinances; the birthright bestored upon Joseph, but what is the posterity of Joseph supposed to do?

— Joseph’s descendants were to be a great nation and a company of nations (Gen 48:19); they are to be as numerous the stars of heaven and the sands of the seashore, and they shall control the gates of its enemies (Gen 22:17). But what are their collective duties as his co-heirs have, as mentioned above?

— perhaps some elements of Manifest Destiny and Monroe Doctrine could indicate a clue.

(a) From Manifest Destiny, the city on a hill; the idea of American exceptionalism; to let the nations see the great light (Matthew 5:14), so they could similarly, see the great way of life from God, his laws, statues and ordinances.

(b) And from Monroe Doctrine, some nations need a Big Stick if they stubbornly and persistently refused to obey God,

“And if the family of Egypt go not up and come not, upon whom there is no rain, there shall be the plague wherewith the Lord will smite the nations who come not up to keep the Feast of Tabernacles” Zechariah 14:18

Genesis (37-38)

•April 12, 2026 • Leave a Comment

Then after Esau found that he had lost his birthright to Jacob, he pleaded his father if he had anything left, and Isaac answered and prophesied, saying,

“And by your sword shall you live, you will go to every place, and wander, and you will be subject to your brother. But when his descendants abandon the commandments of the Torah, then you will break his yoke from your neck.”

“And Esau harbored hatred in his heart against Jacob, his brother, because of the blessing with which his father had blessed him.

And Esau said in his heart, ‘I will not do as Cain did, who killed Abel during their father’s lifetime and then their father had another son, Seth.

Rather, I will wait until the days of mourning for my father have passed, and then I will kill Jacob my brother, and I will be the sole heir.’” Genesis 27:41-42 Jonathan

Looking through the Scriptures with a blast of fresh air!

“The anger of the Lord shall not return, until He has executed and until He has performed the intent of His thought; in the latter days ye shall understand it perfectly.” Jeremiah 23:20

Jacob and Esau reconcilling with each other, surrounded by families

Genesis 37

1 And Jacob dwelt in the land wherein his father was a stranger, in the land of Canaan. — in Genesis 36:6, we read that Esau went into a land away from Jacob. Upon this follows in Genesis 36:8, “And Esau dwelt in Mount Seir;”

— and now the necessary information concerning the other brother is given to us, “And Jacob dwelt in peace (Jonathan) in the land . . . of Canaan,” which is north of Mount Seir;

— the Targum Onkelos says

Yaakov settled in the land of his father’s residence, in the land of Canaan.

These are the generations of Jacob. Joseph, being seventeen years old, was feeding the flock with his brethren; and the lad was with the sons of Bilhah, and with the sons of Zilpah, his father’s wives. And Joseph brought unto his father an evil report about them.

— and the lad was with the sons of Bilhah, and with the sons of Zilpah, his secondary wives or concubines; Joseph is the favorite of his father, but not of his brethren; especially those born of Leah; retaining the old grudge of their mother perhaps;

— the Targum Onkelos says

This is the history of Yaakov; Yoseif at the age of seventeen years, would tend the sheep with his brothers, and the lad was [he had been raised] with the sons of Bilhah, and the sons of Zilpah, his father’s wives. Yoseif brought back bad reports about them to their father.

— the Targum of Jonathan reveals what the evils were, saying

“These are the generations of Jacob: Joseph was seventeen years old when he departed from the House of Study (Beit Midrasha). And he was a youth, brought up with the sons of Bilhah and the sons of Zilpah, his father’s wives. And Joseph brought an evil report of them—for he saw them eating meat torn from a living animal, specifically the ears and the tails; and he came and told their father.”

Now Israel loved Joseph more than all his children, because he was the son of his old age; and he made him a coat of many colors.

— a coat of many colours; two explanations are given of this phrase; the first, that it was a long garment with sleeves or fringes; the other, that it was composed of patchwork of various colours; perhaps an upper coat reaching to the wrists and ankles, such as noblemen and kings’ daughters wore;

— the Targum Onkelos says

Yisrael loved Yoseif more than any of his sons, for he was a [wise] son of his old age to him, and he made him a long, colorful cloak.

And when his brethren saw that their father loved him more than all his brethren, they hated him and could not speak peaceably unto him.

— they not only inwardly hated him, but they could not conceal their hatred, but betrayed it by their speech unto him; they could not speak to him on any occasion, but in a cross, surly, ill natured manner;

— the Targum Onkelos says

His brothers saw that their father loved him more than all his brothers, and they hated him. They could not [were not willing to] speak to him peaceably.

And Joseph dreamed a dream, and he told it to his brethren; and they hated him yet the more. — as a dream; not understanding it; he told it not with any design to affront them, but as an amusement, perhaps, something in it odd and ridiculous, as he himself might think;

— and they hated him yet more; not only because he had carried an ill report of them to his father, but still more because of this dream; the meaning of which they at once understood, and that he told them it in a boasting manner, just to irritate them;

— the Targum Onkelos says

Yoseif had a dream and he told his brothers, and they hated him even more.

And he said unto them, “Hear, I pray you, this dream which I have dreamed: — hear, I pray you, this dream which I have dreamed; hear now, immediately, directly, lest they should forget it;

— the Targum Onkelos says

He said to them, Listen [now] to this dream that I dreamt.

For, behold, we were binding sheaves in the field, and lo, my sheaf arose and also stood upright; and behold, your sheaves stood round about, and made obeisance to my sheaf.”

— the sheaves which his brethren bound up, they also stood upright, and all around his sheaf, and bowed unto it; so it appeared to him in his dream; so that his brethren hate him still more;

— the Targum Onkelos says

Behold, we were binding sheaves in the middle of the field. Behold my sheaf rose and stood up straight; and behold your sheaves surrounded it and prostrated themselves to my sheaf.

Behold, we were binding sheaves in the field, and my sheaf arose and your sheaves stood round, but made obeisance to my sheaf

And his brethren said to him, “Shalt thou indeed reign over us? Or shalt thou indeed have dominion over us?” And they hated him yet the more for his dreams and for his words. — but this dream was evidently symbolical; its meaning easily discerned, and the brothers became furious;

— the Targum Onkelos says

His brothers said to him, Will you then be a king over us? [Do you imagine that you will reign over us?] Will you indeed rule over us? [Or do you think that you will rule over us?] They hated him even more because of his dreams and his words.

And he dreamed yet another dream, and told it to his brethren and said, “Behold, I have dreamed one dream more; and behold, the sun and the moon and the eleven stars made obeisance to me.” — yet another dream; this repetition of the same thing in another shape, might have taught them that it was both certain and very observable;

— behold the sun and the moon; his father and mother, here signified by the sun and moon, were not represented in the first dream, because, in the event, his brethren only went at first to Egypt, and there did him obeisance, and it was not till afterward that his father went with them; and even then, both Rachel and Leah had died;

— the Targum Onkelos says

He had another dream and told it to his brothers. He said, Behold! I dreamed another dream. The sun, the moon, and eleven stars were prostrating themselves to me.

And his father rebuked him, ‘What is this dream? Shall I and thy mother, and thy brethren, really come and bow before thee to the ground?’

10 And he told it to his father and to his brethren; and his father rebuked him and said unto him, “What is this dream that thou hast dreamed? Shall I and thy mother and thy brethren indeed come to bow down ourselves to thee to the earth?”

— shall I, thy mother, and thy brethren, indeed come to bow down ourselves to thee? whereby it plainly shows he understood the meaning of the dream, though he would not seem to countenance it;

— and by the “moon” his wife, by whom is meant Rachel, the real mother of Joseph, who was dead; or rather Leah, who was now Jacob’s only true wife, and the stepmother of Joseph; or else Bilhah, Rachel’s handmaid, who since her death was a mother to Joseph; 

— the Targum Onkelos says

He told it to his father and to his brothers. His father rebuked him, and said to him, What is this dream that you dreamed? Shall I, your mother and your brothers come and prostrate themselves on the ground to you?

11 And his brethren envied him, but his father observed the saying. — and his brethren envied him; they suspecting and fearing that these dreams portended the pre-eminence of Joseph over them, or however served to fill his mind with the hopes and expectation:

— but his father observed the saying; what Joseph had said in relating his dream; he laid it up in his mind and kept it there, often thought of it, and waited to see its accomplishment;

— the Targum Onkelos says

His brothers were jealous of him but his father kept the matter in mind.

12 And his brethren went to feed their father’s flock in Shechem. — Shechem belonged to Jacob; part of it by purchase, and the rest by conquest; Jacob’s sons seem to have retained Shechem, by right of their high-handed proceedings; related to Dinah in Genesis 34:27-29

— the Targum Onkelos says

His brothers went off to pasture their father’s sheep in Shechem.

13 And Israel said unto Joseph, “Do not thy brethren feed the flock in Shechem? Come, and I will send thee unto them.” And he said to him, “Here am I.” — and he said unto him, here am I; showing his readiness to obey his father, though it was a long journey, and he to go it alone;

— the Targum Onkelos says

Yisrael said to Yoseif, Aren’t your brothers pasturing [the sheep] in Shechem? Come, I will send you to them. He [Yoseif] said to him, Here I am.

14 And he said to him, “Go, I pray thee, see whether it be well with thy brethren and well with the flocks, and bring me word again.” So he sent him out of the Vale of Hebron, and he came to Shechem.

— so he sent him out of the vale of Hebron: the same with the plains of Mamre near the city of Hebron, which was built on a hill: and he came to Shechem: after he had travelled sixty miles;

— the Targum Onkelos says

He [Yisrael] said to him, Go please [now], see after the well-being of your brothers, and the welfare of the sheep, and bring me a report. He sent [Yoseif] from the depths [plain] of Chevron, and he came to Shechem.

15 And a certain man found him, and behold, he was wandering in the field; and the man asked him, saying, “What seekest thou?”

— and the man asked him, saying, what seekest thou? seeing him walking about, and first looking one way, and then another, concluded he was in search of something, either of some man or of some creature, a sheep or an ox that was lost;

— the Targum Onkelos says

A man found him going astray in the field. The man asked him, What are you seeking?

16 And he said, “I seek my brethren. Tell me, I pray thee, where they feed their flocks.” — tell me, I pray thee, where they feed their flocks; in what part of the country they are, what field they are in, how far to it, and which the way;

— the Targum Onkelos says

He said, I am looking for my brothers, tell me please [now], where are they pasturing?

17 And the man said, “They have departed hence, for I heard them say, ‘Let us go to Dothan.’” And Joseph went after his brethren, and found them in Dothan. — Dothan; this town was twelve miles north of Shechem, and is famous as being the place where Elisha struck the Syrian army with blindness (II Kings 6:13-23);

— the Targum Onkelos says

The man said, They have traveled on from here, for I heard them say, Let us go to Doson. Yoseif went after his brothers and found them in Doson.

18 And when they saw him afar off, even before he came near unto them, they conspired against him to slay him. — when they saw him they conspired against him; it was not in a heat, or upon a sudden provocation, that they thought to slay him, but from malice prepense, and in cold blood;

— the Targum Onkelos says

They saw him from a distance, and before he approached them they were plotting against him to kill [thinking about killing] him.

19 And they said one to another, “Behold, this dreamer cometh. — this dreamer; Heb, this lord of dreams, or Jonathan identying the brothers as Simeon and Levi, and say, “this master of dreams” cometh, a phrase expressive of contempt;

— the Targum Onkelos says

One man said to another, Here comes the dreamer.

20 Come now therefore and let us slay him, and cast him into some pit, and we will say, ‘Some evil beast hath devoured him’; and we shall see what will become of his dreams.”

— cast him into some pit; partly, as unworthy of burial; partly, to cover their villanous action; and partly, that they might quickly put him out of their sight and minds;

— some evil beast hath devoured him; which would seem plausible, since wild beasts were frequent in those parts, as lions and bears; and we shall see what will become of his dreams;

— the Targum Onkelos says

Now, come let us kill him and throw him into one of the pits; and we will say that a wild beast devoured him. Then we will see what will become [be the end] of his dreams.

21 And Reuben heard it, and he delivered him out of their hands and said, “Let us not kill him.” — and Reuben heard it; overheard what they said, not being in the consultation; perhaps knowing his temper and disposition to be more mild and gentle;

— and being the eldest, Reuben knew he had responsibility for all his brothers in general; hence opposed such murderous proposal;

— the Targum Onkelos says

Reuvein heard and rescued him from their hands. He said, Let us not kill him.

22 And Reuben said unto them, “Shed no blood, but cast him into this pit that is in the wilderness, and lay no hand upon him” — Reuben issued a warning, shed no blood that he might free him out of their hands to deliver him to his father again;

— the Targum Onkelos says

Reuvein said to them, Do not commit bloodshed. Throw him into this pit which is in the wilderness, and do not lay a hand on him. His purpose was to rescue him from their hands, to bring him back to his father.

23 And it came to pass, when Joseph had come unto his brethren, that they stripped Joseph of his coat, his coat of many colors that was on him; — that they stripped, Joseph his coat of many colours, that was on him; that with his coat of many colours;

— the Targum Onkelos says

When Yoseif came to his brothers, they stripped him of his coat, the long, colorful coat that he had on.

24 and they took him and cast him into a pit. And the pit was empty; there was no water in it. — the pit being empty, there was no water in it; only serpents and scorpions, as the Targum of Jonathan says;

— the Targum Onkelos says

They took him and threw him into the pit. The pit was empty; there was no water in it.

25 And they sat down to eat bread; and they lifted up their eyes and looked, and behold, a company of Ishmaelites came from Gilead with their camels, bearing spices and balm and myrrh, going to carry them down to Egypt.

— a caravan of Ishmaelites; Dothan was situated on the great caravan line by which the products of India and Western Asia were brought to Egypt;

— the Targum Onkelos says

They sat down [reclined] to eat bread. They raised their eyes and saw—behold a Yishmaelite [Arabian] caravan was coming from Gilod. Their camels were carrying spices, balsam and lotus, bringing them down to Egypt.

26 And Judah said unto his brethren, “What profit is it if we slay our brother and conceal his blood? — one who know about the value of money, asks, what profit is it if (literally, what of advantage that) we slay our brother, and conceal his blood?

— the Targum Onkelos says

Yehudah said to his brothers, What [monetary benefit] will we gain if we kill our brother and cover up his blood?

27 Come, and let us sell him to the Ishmaelites, and let not our hand be upon him; for he is our brother and our flesh.” And his brethren were content. — the brothers readily approved of Judah’s suggestion to dispose of their obnoxious brother as a slave;

— the Targum Onkelos says

Come let us sell him to the Yishmaelites [Arabs], and let our hands not be upon him; for he is our brother, our own flesh. His brothers listened [to him.] [obeyed him].

28 Then there passed by Midianite merchantmen; and they drew and lifted up Joseph out of the pit, and sold Joseph to the Ishmaelites for twenty pieces of silver. And they brought Joseph into Egypt. — twenty pieces of silver; the money was probably in rings or pieces (shekels), and silver is always mentioned in the records of that early age before gold;

— the Targum Onkelos says

Midianite merchants passed by. They [the brothers] pulled Yoseif up from the pit and sold Yoseif to the Yishmaelites [Arabs] for twenty pieces of silver. They brought Yoseif to Egypt.

29 And Reuben returned unto the pit, and behold, Joseph was not in the pit; and he rent his clothes. — Reuben returned; evidently he was not present when Joseph was sold to the Midianites; and he rent his clothes; as a token of distress and anguish of mind, of sorrow and mourning;

— the Targum Onkelos says

Reuvein returned to the pit, but behold, Yoseif was not in the pit. He [then] tore his clothes [in grief.]

— the Targum of Jonathan reveals Reuben’s character and his reaction, saysing

“And Reuben returned to the pit; for he had not been with them to eat when they sold him, as he had been sitting in a fast because he had confused his father’s couch. And he had gone and sat among the mountains, intended to return to the pit to bring [Joseph] up to his father, so that perhaps [his father] would show him favor. And when he returned and saw, and behold, Joseph was not in the pit, he rent his garments.”

30 And he returned unto his brethren and said, “The child is no more; and I, whither shall I go?” — the child comparatively to his brethren, as he was just seventeen years old, Genesis 37:2

— the Targum Onkelos says

He returned to his brothers and said, The boy is not there; and I—where can I go.

31 And they took Joseph’s coat, and killed a kid from the goats, and dipped the coat in the blood.

— the Targum Onkelos says

They took Yoseif’s coat, slaughtered a [male] goat, and dipped the coat in the blood.

— and killed a kid of the goats, and dipped the coat in the blood; that being, as the Targum of Jonathan says, “like the blood of a man.”

32 And they sent the coat of many colors, and they brought it to their father and said, “This have we found. Know now whether it be thy son’s coat or not?”

— under the influence of Satan, men taught themselves to commit one sin, then teaches them to try to conceal it with another; to hide theft and murder, with lying and false oaths:

— an atrocious crime of lying and false oaths are great wickedness, which is dealt with in Zechariah 5 (the flyinf scroll);

— the Targum Onkelos says

They sent the long, colorful coat and brought it to their father, and said, We found this. Please [Now] identify it. Is it your son’s coat or not?

— the Targum of Jonathan reveals the sons of Leah wanting the sons of the handmaids doing the dirty work, too, saying

“And they sent by the hand of the sons of Zilpah and by the hand of the sons of Bilhah the ornamented tunic; and they brought it to their father and said: ‘This we have found; identify now whether it is your son’s tunic or not.'”

33 And he knew it, and said, “It is my son’s coat. An evil beast hath devoured him. Joseph is without doubt rent in pieces.” — an evil beast hath devoured him; this was natural to conclude from the condition the coat was in, and from the country he was sent into, which abounded with wild beasts;

— and was the very thing Joseph’s brethren contrived to say themselves; and in this view they wished and hoped the affair would be considered, and so their wickedness concealed;

— the Targum Onkelos says

He recognized it and said, It is my son’s coat. An evil beast has devoured him. Yoseif has been torn to pieces [surely killed].

34 And Jacob rent his clothes, and put sackcloth upon his loins, and mourned for his son many days. — many days; Jacob mourned for Joseph not merely during the usual period, or years, as days sometimes signify; twenty two years, but so long as to move even the hearts of those who had wronged him;

— the Targum Onkelos says

Yaakov tore his robes, and placed sackcloth on his loins. He mourned for his son for many days.

Jacob saw the Coat of many colours in blood and rent his clothes

35 And all his sons and all his daughters rose up to comfort him; but he refused to be comforted, and he said, “For I will go down into the grave unto my son, mourning.” Thus his father wept for him.

— “his daughters;” that is, besides Dinah, Jacob had other daughters who were never mentioned; and all his sons rose up to comfort him; his sons must act a most hypocritical part in this affair;

— his father wept for him; that is, his father Isaac, as the Targum of Jonathan, he wept for his son Jacob on account of his trouble and distress; as well as for his grandson Joseph; 

— the Targum Onkelos says

All his sons and all his daughters rose to console him, but he refused to be consoled [accept consolation]. He said, I will go down to the grave [while I am still] mourning for my son. His father wept for him.

36 And the Midianites sold him into Egypt unto Potiphar, an officer of Pharaoh’s and captain of the guard. — and the Midianites sold him into Egypt; or Medanites, who sprung from Medan, a brother of Midian, and son of Keturah;

— Potiphar; Captain of the guard; Heb, chief of the slaughterers, by which the LXX understand the slaughterers of animals for food, and translate “chief cook;” other versions understand the commander to be the king’s body-guard,

— the Targum Onkelos says

The Midianites sold him in Egypt to Potiphar, an officer of Pharaoh, the chief of the slaughterers.

Joseph Betrayed into Egypt

Genesis 38

And it came to pass at that time, that Judah went down from his brethren, and turned unto a certain Adullamite, whose name was Hirah.

— Judah went down from his brethren; withdrew for a time from his father’s family, and got intimately acquainted with one Hirah an Adullamite; of the city of Adullam; a city which afterwards fell to the tribe of Judah;

— the Targum Onkelos says

And it was at that time, that Yehudah descended from his brothers. He turned away [from them], until [he came to] a man, an Adullamite, whose name was Chirah.

And Judah saw there a daughter of a certain Canaanite, whose name was Shua; and he took her, and went in unto her. — an Adullamite; a Canaanitish woman; which was forbidden by his ancestors Abraham and Isaac, and which his father avoided:

— but Jonathan says he proselyted her, her father’s name was Shua, not the name of the woman he married, and he took her; to be his wife, with her father’s consent, but her name wasn’t mentioned, as Shua was the name of her father, as appears from Genesis 38:12;

— the Targum Onkelos says

There Yehudah saw the daughter of a Canaanite man [merchant] whose name was Shu’a. He took her and consummated a marriage with her.

And she conceived and bore a son, and he called his name Er. — he called his name Er; which signifies a “watchman”: but the reason of the name given by the Targum of Jonathan is, “because he should die without a child;”

— the Targum Onkelos says

She conceived and gave birth to a son. He named him Er.

And she conceived again and bore a son, and she called his name Onan. — and she called his name Onan; the first son Judah gave the name to, but his wife named the second child, so called from grief or sorrow; and the reason, according to Targum of Jonathan, was, “because his father would have to mourn for him;”

— the Targum Onkelos says

She conceived again and gave birth to a son. She named him Onan.

And she yet again conceived and bore a son, and called his name Shelah. And he was at Chezib when she bore him. — and called his name Shelah; as she was at Chezib when she bare him; Chezib is the name of a place, by some taken to be the same with Achzib or Ecdippe;

— the Targum Onkelos says

She conceived once again and gave birth to a son. She named him Sheilah. He [Yehudah] was in Keziv when she gave birth to him.

And Judah took a wife for Er his firstborn, whose name was Tamar. — and Judah took a wife for Er his firstborn; chose one for him, and presented her to him for his liking, whom he approving of married: whose name was Tamar;

— the Targum of Jonathan says, she was the daughter of Shem; of course “daughter” could mean granddaughter or just principally female from the posterity of Shem;

— the Targum Onkelos says

Yehudah took a wife for Er, his firstborn, and her name was Tamar.

And Er, Judah’s firstborn, was wicked in the sight of the Lord; and the Lord slew him. — and Er, Judah’s firstborn, was wicked in the sight of the Lord;

— the Targum Onkelos says

Er, Yehudah’s firstborn was wicked in the eyes of [before] Adonoy, and Adonoy put him to death.

— wicked in the sight of the Lord; that is, exceedingly wicked, as this phrase signifies, Genesis 13:13; but here “because he had not given his seed unto his wife,” as Jonathan says.

And Judah said unto Onan, “Go in unto thy brother’s wife and marry her, and raise up seed to thy brother.” — the law later given through Moses, by which the brother of the dead husband was required to marry the widow, 

— the Targum Onkelos says

Yehudah said to Onan, Consummate marriage with your brother’s wife, and fulfill the yibum rite with her, and establish seed for your brother.

And Onan knew that the seed should not be his; and it came to pass, when he went in unto his brother’s wife, that he spilled it on the ground, lest he should give seed to his brother.

— that he spilled it on the ground, lest he should give his seed to his brother: lest his brother’s wife he had married should conceive by him, and bear a son that should be called his brother’s, and inherit his estate;

— the Targum Onkelos says

Onan knew that the descendants would not be his [called by his name]. Whenever he cohabited with his brother’s wife, he let it go to waste [destroyed his way] on the ground, in order not to give [establish] progeny to his brother.

10 And the thing which he did displeased the Lord; therefore He slew him also. — it was also a sin against the divine institution of marriage and its object of populating the earth, and was therefore punished by the Lord with sudden death;

— the Targum Onkelos says

What he did was evil in the eyes of [before] Adonoy, and He also put him to death.

11 Then said Judah to Tamar his daughter-in-law, “Remain a widow at thy father’s house, until Shelah my son is grown”; for he said, “Lest perhaps he die also, as his brethren did.” And Tamar went and dwelt in her father’s house.

— and Tamar went and dwelt in her father’s house; she had dwelt separately in the time of her two husbands, but now by his advice she removed to her own father’s house; 

— the Targum Onkelos says

Yehudah said to Tamar, his daughter-in-law, Live as a widow in your father’s house until my son Sheilah is of age. He said, Lest he also die like his brothers. Tamar went and lived in her father’s house.

12 And in process of time, the daughter of Shua, Judah’s wife, died; and Judah was comforted, and went up unto his sheepshearers to Timnah, he and his friend Hirah the Adullamite.

— time passed; and Judah’s wife, Shua’s daughter, died; and when the time of mourning was over, Judah with his friend Hirah of Adullam went to Timnah for the sheep shearing;

— the Targum Onkelos says

Many days passed, and Shu’a’s daughter, the wife of Yehudah died. Yehudah sought consolation, and went up to his sheep-shearers—he and his friend, Chirah the Adullamite—to Timnah.

13 And it was told Tamar, saying, “Behold, thy father-in-law goeth up to Timnah to shear his sheep.”

— the Targum Onkelos says

Tamar was told, Behold your father-in-law has come to Timnah, to shear his sheep.

14 And she put her widow’s garments off from her and covered herself with a veil, and wrapped herself, and sat in an open place which is on the way to Timnah; for she saw that Shelah was grown, and she was not given unto him as wife.

— for Tamar saw that Shelah was grown: and she was not given unto him as a wife: to her disappointment;

— the Targum Onkelos says

She took off her widow’s garb, covered herself with a veil, and disguised [adorned] herself. She sat at the crossroads which is on the road to Timnah, for she saw that Sheilah had come of age and she had not been given to him for a wife.

15 When Judah saw her, he thought her to be a harlot, because she had covered her face.

— the Targum Onkelos says

Yehudah saw her and thought she was a harlot [like one who goes outside], because she had covered her face.

16 And he turned unto her on the wayside and said, “Come, I pray thee, let me come in unto thee” (for he knew not that she was his daughter-in-law). And she said, “What wilt thou give me, that thou mayest come in unto me?”

— when Judah saw her, he thought her to be an harlot; by her posture and the place she was in;

— the Targum Onkelos says

He turned aside to her on the road, and said, Please [Now], let me be with you, for he did not know that she was his daughter-in-law. She said, What will you give me for the privilege of being with me?

17 And he said, “I will send thee a kid from the flock.” And she said, “Wilt thou give me a pledge until thou send it?” — a kid from the flock; a goodly price at which her chastity and honour were valued!

— the Targum Onkelos says

He said, I will send you a kid from the flock. She said, [Only] if you give me some security until you send it.

18 And he said, “What pledge shall I give thee?” And she said, “Thy signet and thy bracelets and thy staff that is in thine hand.” And he gave it to her and came in unto her, and she conceived by him.

— signet, bracelets, including armlets, were worn by men as well as women among these ancients; the Septuagint renders, “thy ring, and thy bracelet, and the staff in thy hand,” or Jonathan, “thy seal, and thy mantle, and thy staff which is in thy hand,”

— the Targum Onkelos says

He said, What security shall I give you? She said, Your signet ring, your wrap, and your staff that is in your hand. He gave them to her and was with her, and she became pregnant by him.

19 And she arose and went away, and laid aside her veil from her, and put on the garments of her widowhood. — and she arose and went away; to her father’s house immediately, as soon as ever she had parted with Judah; and lest she should be found out;

— the Targum Onkelos says

She got up and went away. She took off her veil, and put on her widow’s garb.

20 And Judah sent the kid by the hand of his friend the Adullamite to receive his pledge from the woman’s hand, but he found her not.

— to receive his pledge from the woman’s hand; his signet, bracelets, and staff, or whatever they were: but he found her not; for she had gone from the place where she sat;

— the Targum Onkelos says

Yehudah sent the goat-kid with his friend the Adullamite, to retrieve the security from the woman, but he could not find her.

21 Then he asked the men of that place, saying, “Where is the harlot who was openly by the wayside?” And they said, “There was no harlot in this place.”

— and they said, there was no harlot in this place; they had not known any harlot to frequent that place lately, and Tamar sat there so short a time as not to have been observed by them;

— the Targum Onkelos says

He asked the men of her place, Where is the harlot that was at the junction, on the road? They said, There was [is] no harlot here.

22 And he returned to Judah and said, “I cannot find her, and also the men of the place said that there was no harlot in this place.” — there was no harlot in this place; by which it appears, that near the place where Tamar was;

— the Targum Onkelos says

He returned to Yehudah and said, I did not find her, and the men of her place also said that there was [is] no harlot there [here].

23 And Judah said, “Let her take them for herself, lest we be shamed; behold, I sent this kid, and thou hast not found her.”

— Judah said, “Let her have it then. If we keep looking, everyone will shame us. I kept my part of the bargain; I sent the kid goat but you couldn’t find her.”

— the Targum Onkelos says

Yehudah said, Let her take it, lest we are humiliated [become a laughingstock]. Behold I sent her this kid, and you could not find her.

24 And it came to pass about three months after that it was told Judah, saying, “Tamar thy daughter-in-law hath played the harlot; and also, behold, she is with child by whoredom.” And Judah said, “Bring her forth, and let her be burned.”

— let her be burnt; as by the law, Tamar was condemned by Judah as head of the family, to the punishment usual for adultery;

— the Targum Onkelos says

About three months later, Yehudah was told, Tamar, your daughter-in-law, has been promiscuous, moreover, her promiscuity has resulted in pregnancy. Yehudah said, Take her out and let her be burned.

25 When she was brought forth, she sent to her father-in-law, saying, “By the man whose these are, am I with child.” And she said, “Discern, I pray thee, whose are these — the signet, and bracelets, and staff.”

— the Targum Onkelos says

She was being taken out, and she sent [word] to her father-in-law saying, By the man to whom these belong [from him] am I pregnant. She said, Please [Now] recognize to whom this signet, wrap and staff belong.

— the Targum of Jonathan says,

“Tamar was being led out to be burned, and she sought the three pledges (the signet, wrap, and staff) but could not find them. She lifted her eyes to the heavens on high and said: ‘I pray for mercy before You, O Lord; answer me in this hour of my distress and enlighten my eyes that I may find the three witnesses. I promise to raise from my loins three holy ones who will sanctify Your name and descend into the furnace of fire in the Plain of Dura.’

“In that hour, the Holy One, blessed be He, signaled to Michael, and he enlightened her eyes and she found them. She took them and cast them at the feet of the judges and said: ‘By the man to whom these pledges belong, from him I am pregnant. Even though I am being burned, I will not publish his name; but let the Master of the World put it in his heart to recognize them and save me from this great judgment.’

“When Judah saw them, he recognized them. Then he said in his heart: ‘It is better for me to be ashamed in this world, which is a passing world, and not be ashamed before my righteous fathers in the World to Come. It is better for me to burn in this world in a fire that can be extinguished, rather than burn in the World to Come in a fire that consumes fire. Because I said to Jacob my father, “Identify now your son’s tunic,” I am forced to hear in the court: “To whom do these signets, wraps, and staffs belong?”‘”

26 And Judah acknowledged them and said, “She hath been more righteous than I, because I gave her not to Shelah my son.” And he knew her again no more.

— and she said; discern, I pray thee, whose are these, the signet, and bracelets, and staff; which were the things given her as a pledge till she received the kid, the hire she was to have for his lying with her;

— and he knew her again no more; he did not repeat the sin, but abstained from it having, no doubt, true repentance for it;

— the Targum Onkelos says

Yehudah recognized them and said, She is righteous, [it is] from me [that she conceived], inasmuch that I did not give her to my son Sheilah. He was not intimate with her any more.

27 And it came to pass in the time of her travail that, behold, twins were in her womb. — that, behold, twins were in her womb; which the midwife could discover before the birth of either.

— the Targum Onkelos says

When the time came for her to give birth, there were twins in her womb.

28 And it came to pass, when she travailed, that the one put out his hand; and the midwife took and bound upon his hand a scarlet thread, saying, “This came out first.” — Tamar bears Perez and Zerah to Judah; but a breach be upon them, or be imputed to them;

— the Targum Onkelos says

As she was giving birth, one of them put out his hand. The midwife took it and tied a scarlet thread on his hand, saying, This one emerged first.

29 And it came to pass as he drew back his hand that, behold, his brother came out; and she said, “How hast thou broken forth? This breach be upon thee.” Therefore his name was called Perez [that is, A breach]. — but breach be upon thee; and Pharez was born first;

— the Targum Onkelos says

When he put back his hand, behold his brother emerged, and she said, With what [great] strength you have pushed yourself. He named him Peretz.

30 And afterward came out his brother who had the scarlet thread upon his hand, and his name was called Zerah. — and the one with a scarlet thread; his name was called Zarah; 

— the Targum Onkelos says

Then his brother emerged—the one upon whose hand was the scarlet thread. He named him Zorach.

The Quest of Manifest Destiny

•April 11, 2026 • Leave a Comment

Is this Manifest Destiny an expanistic belief of white nationalistic chauvinism or is it that of a Divine Providence?

Manifest Destiny, as some claimed, is the idea that the United States is destined—by God—to expand its dominion and values across the American continent

The evidence seems to incorporate both.

The Manifest Destiny, a termed coined by John O’Sullivan, is a manifesto for the expansionist belief in the 19th-century United States that American settlers were destined to expand westward across North America and beyond, and that this belief was both obvious “manifest” and certain “destiny.”

This belief is rooted in American exceptionalism, romantic nationalism, and nascent ideas of white nationalistic chauvinism, implying the inevitable spread of the American way. It is one of the earliest expressions of American imperialism.

According to historian William Earl Weeks, there were three basic tenets behind the concept:

  • The assumption of the unique moral virtue of the United States.
  • The assertion of a mission to redeem the world by the spread of the “American way of life.”
  • The belief in the nation’s divinely ordained destiny to succeed in this mission.

Although Manifest Destiny remained divisive in politics, causing constant conflict with regard to slavery in new states and territories, most agreed with the expansion of European settlers onto the territories of Indigenous natives and the annexation of lands to the west of their borders, all involving the harsh removal of Indigenous communities, for farms and mining.

The concept became one of several major campaign issues during the 1844 presidential election, where the Democratic Party won and the term “Manifest Destiny” gained acceptance and was coined within a year.

A mission to redeem the world by the spread of the “American way of life”

A Manifesto for Expansion

The impatient English who colonized North America in the 1600s and 1700s gazed westward and passionately considered ways to venture into the wilderness and tame it. The cause of such ceaseless wanderlust varied from region to region, but the behaviour became a tradition within one generation.

Although the Manifest manifesto became a rallying cry as well as a rationale forits expansive policy that reached its culmination in 1845–46, the attitude behind Manifest Destiny had long been a part of the American experience.

Thanks to a high birth rate and brisk immigration, the US population exploded in the first half of the 19th century, from around 5 million people in 1800 to more than 23 million by 1850.

In 1803, President Thomas Jefferson’s Louisiana Purchase doubled the size of the country with the stroke of a pen, adding some 828,000 square miles stretching from the Mississippi River to the Rocky Mountains.

John O’Sullivan, first regards the westward quest as divine destiny for American value of liberty, coined the term manifest destiny in 1845

Andrew Jackson’s invasion of Florida in 1818 and the subsequent Transcontinental Treaty (Adams-Onís Treaty) settled a southern border question that had been vexing the region for a generation and established an American claim to the Pacific Northwest as Spain renounced its claim to the Oregon Country.

The most consequential territorial expansion in the country’s history occurred during the 1820s. Spreading American settlements often caused additional unrest on the country’s western borders.

As the United States pacified and stabilized volatile regions, the resulting appropriation of territory usually worsened relations with neighbours, setting off a cycle of instability that encouraged additional annexations.

Finally, in the 1840s, diplomacy resolved the dispute over the Oregon Country with Britain, and victory in the Mexican-American War (1846–48) closed out a period of dramatically swift growth for the United States.

In less than a century after breaking from the British Empire, the United States had gone far in creating its own empire by extending sovereignty across the continent to the Pacific, up to the 49th parallel on the Canadian border, and down to the Rio Grande in the south.

Realizing its Manifest Destiny with triumph over Mexico in 1848 gave the United States an immense domain that came with spectacular abundance and potential.

Under the Treaty of Guadalupe Hidalgo, the United States acquired more than 525,000 square miles of land, including Arizona, California, western Colorado, Nevada, New Mexico, Texas and Utah.

California’s climate made much of it a natural garden, and its gold would finance decades of impressive growth. Burgeoning Pacific trade required opening diplomatic relations with heretofore isolationist Japan and created American trade in places that before had always been European commercial preserves.

Plans to tie the eastern United States to the Pacific Coast with a transcontinental railroad led to the country’s final land acquisition before the Civil War when US Minister to Mexico James Gadsden purchased a small parcel of land in 1853 to facilitate a southern route.

For that reason alone, the Gadsden Purchase provoked the North, and Americans soon found themselves embroiled in additional arguments that foiled the railroad while killing any possible consensus for further expansion.

Having transformed a group of sparsely settled colonies into a continental power of enormous potential, many Americans thought the achievement so stunning as to be obvious. It was for them proof that God had chosen the United States to grow and flourish, thus building and consolidating in the belief of Divine Providence.

The New Manifest Destiny

After the Civil War, the Union preoccupied itself in reestablishing and promoting the industrial base that had made the United States such an economic power from coast to coast.

By the 1890s, the United States and other great powers embraced geopolitical doctrines stemming from the writings of naval officer and historian Alfred Thayer Mahan, who posited that national greatness in a competitive world derived from the ability to control navigation of the seas.

Westward bound, the Manifest Destiny for many American settlers

Thus the belief that unfettered competition promoted progress led to a naval arms race that revolutionized seagoing architecture and hastened the replacement of sail with steam.

Although they accommodated bigger guns and could meet schedules regardless of weather, fuel-hungry steamships required far-flung coaling stations, which encouraged naval powers to plant their flags on remote outposts and define their interest in places never before connected to their security or commerce.

Americans dubbed this freshly found national endeavour the “New Manifest Destiny.” As before, it was a way of clothing imperial ambitions in a higher purpose ostensibly decreed by Providence. And manifest destiny was often cited to promote overseas expansion.

The Spanish-American War of 1898 arose from popular outrage over Madrid’s reportedly barbarous colonial policies in Cuba and, more immediately, in response to the destruction of the US battleship Maine, but it ended with the United States acquiring remnants of Spain’s dwindling global empire.

Similarly, the annexation of Hawaii in 1898 provided the United States Navy with the desirable port facilities at Pearl Harbor, when President William McKinley said that “We need Hawaii just as much and a good deal more than we did California. It is manifest destiny.”

Historians continued that debate; some have interpreted American acquisition of other Pacific island groups in the 1890s as an extension of manifest destiny across the Pacific Ocean. Others have regarded it as merely imperialism.

That is, advocates of this New Manifest Destiny believed that “Divine Providence” had given the United States a mission to spread republican democracy, “the great experiment of liberty” around the world.

In 1898, the United States intervened in the Cuban insurrection and launched the Spanish–American War to force Spain out. According to the terms of the Treaty of Paris, Spain relinquished sovereignty over Cuba and ceded the Philippine Islands, Puerto Rico, and Guam to the United States.

In the 1890s, the United States expanded into Polynesia and Asia with the annexation of the Republic of Hawaii, the Philippines, Guam, and American Samoa.

Because the British government would not spread democracy, they thought British claims any of their territories should be overruled. Manifest Destiny was to be a moral ideal, a “higher moral law” that superseded all other considerations.

A possible influence in their “Divine Providence” is racial predominance, namely the idea that the American Anglo-Saxon race was “separate, innately superior” and “destined to bring good government, commercial prosperity and Christianity to the American continents and the world.”

Author Reginald Horsman wrote in 1981 that this view also held that “inferior races were doomed to subordinate status or extinction” and that this was used to justify “the enslavement of the blacks and the expulsion and possible extermination of the Indians.”

The origin of the first theme, later known as American exceptionalism, was often traced to America’s Puritan heritage, particularly John Winthrop’s famous “City upon a Hill” sermon of 1630, in which he called for the establishment of a virtuous community that would be a shining light to the New World.

After all the land conquest, the seas and oceans are next in line

As a natural outgrowth of this belief that God had a direct influence in the foundation and further actions of the United States. Political scientist and historian Clinton Rossiter described this view as summing “that God, at the proper stage in the march of history, called forth certain hardy souls from the old and privilege-ridden nations … and that in bestowing his grace He also bestowed a peculiar responsibility.”

Americans presupposed that they were not only divinely elected to maintain the North American continent, but also to “spread abroad the fundamental principles stated in the Bill of Rights.” In many cases, this meant neighboring colonial holdings and countries were seen as obstacles rather than the destiny God had provided the United States.

Onto the 21st Century

The desire for trade with China and other Asian countries was another ground for expansionism, with Americans seeing prospects of westward contact with Asia as fulfilling long-held Western hopes of finding new routes to Asia. 

If the United States was successful as a “shining city upon a hill,” people in other countries would seek to establish their own democratic republics, believing that the United States was destined to serve as a virtuous light to the rest of the world, and also had a divine obligation to spread its superordinate political system and a way of life well beyond their North American continent.

Today, these United States are part of the Five Eyes, and their nerve center runs through Washington DC, not London.

For other indepth Study of Who the United States is, and its destination, see

(1) The Irony of a Birthright (2) Ephraim preferred over Manasseh (3) Ephraim as the Thirteenth Tribe (4) Who is this lying Ephraim? (5) The Ox with horns of a Unicorn

Genesis (35-36)

•April 10, 2026 • Leave a Comment

The Targum, which originated in the Aramaic language and is strongly linked to the work of Ezra, holds significance for shedding light on biblical concepts. When the Masoretic Text can be vague, uncertain, or unclear, the Targum often offers clearer meaning, broader insight, and deeper understanding.

Yes, sometimes the Targum clarifies metaphors and interprets idioms or difficult passages instead of translating them literally, which often makes no sense. Such an endeavor should be highly commended rather than criticized.

For example, the Targum interprets natural imagery—like cedars, cypresses, oaks, forests, and fire—as metaphors for political political and social structures, especially kings, rulers, governors, and wealthy elites. Such imagery can be sweeping: forests laid waste, lions roaring as their habitat is destroyed, and power structures crumbling. Fire symbolizes divine punishment, sweeping through defenses and dismantling the very foundations of their power.

Translating such natural imagery literally could convey limited information or even distort it, but Ezra was determined to share their true meaning. He was a righteous man, for God had prepared his heart to seek the law of the Lord, to follow it, and to teach the statutes and judgments in Israel Ezra 7:10.

Genesis 35

1 And God said unto Jacob, “Arise, go up to Bethel and dwell there; and make there an altar unto God, who appeared unto thee when thou fleddest from the face of Esau thy brother.”

— Arise, go up to Bethel; about thirty miles south where Jacob made his first vow, or perhaps, the position of Jacob at Shechem had become dangerous;

— the Targum Onkelos says

Elohim said to Yaakov, Arise, go up to Beis Eil and live there; make an altar there to the Almighty Who appeared [became revealed] to you when you were fleeing from your brother Eisov.

Then Jacob said unto his household and to all that were with him, “Put away the strange gods that are among you, and be clean and change your garments. — strange gods, besides Rachel’s teraphim, probably, many of the family or servants of Jacob at Haran were idolaters, and had brought their idols with them;

— the object, then, of this tranformation was not merely to raise Jacob’s own family to a higher spiritual state, but also to initiate the many heathen belonging to their households into the true religion;

— and be clean; either by abstaining from their wives, as some interpret it, from Exodus 19:10; or rather by washing their bodies, as their hands were full of the blood of the Shechemites, and needed to be washed and purified,

— the Targum Onkelos says

Yaakov [then] said to his household, and to everyone that was with him, Get rid of the foreign gods [false gods of the nations] in your midst. Purify yourselves and change your garments.

— as the Targum of Jonathan has it: they had polluted themselves by taking the idols from a temple of the Shechemites, and of taking the blood of the slain; hence they need to clean themselves, change your raiment, before they can go to dwell in Bethel

“And Jacob said to the members of his household and to all who were with him: ‘Remove the idols of the nations that are among you, which you took from the idol-house of Shechem; and purify yourselves from the defilement of the slain with whom you came into contact, and change your garments.'”

And let us arise and go up to Bethel; and I will make there an altar unto God, who answered me in the day of my distress, and was with me in the way which I went.” — an altar unto God, who answered me in the day of my distress; on account of his brother Esau, from whose wrath he fled;

— the Targum Onkelos says

Let us arise and go up to Beis Eil. There I will make an altar to the Almighty, Who answered me [accepted my prayer] in the day of my distress, and Who was with me [whose Word was my support] along the way I traveled.

And they gave unto Jacob all the strange gods which were in their hand, and all their earrings which were in their ears; and Jacob hid them under the oak which was by Shechem. — they gave unto Jacob all the strange gods; rather, the gods of the stranger; and all their earrings;

— the “seraphim” as well, perhaps, as other idols acquired among the Shechemite spoil; earrings of various forms, sizes, and materials; and Jacob hid them under the oak which was by Shechem; that is, the idols, which, after he had broke to pieces, perhaps, he dug a hole under an oak, and there thoroughly buried them;

— the Targum Onkelos says

They gave Yaakov all the foreign gods [false gods of the nations] that were in their hands, and [also] the rings in their ears. Yaakov buried them under the oak [tree] which was near Shechem.

And they journeyed; and the terror of God was upon the cities that were round about them, and they did not pursue after the sons of Jacob. — the terror of God was upon the cities; there was every reason to apprehend that a storm of indignation would burst from all quarters upon Jacob’s family, but a supernatural panic seized them;

— the Targum Onkelos says

They began their journey. The terror of Elohim was upon the [people who were in the] cities that were around them, and they did not pursue the sons of Yaakov.

So Jacob came to Luz (that is, Bethel), which is in the land of Canaan, he and all the people that were with him. — to Luz, inhabited by those who were called Canaanites, but the place Jacob had called Bethel;

— the Targum Onkelos says

Yaakov came to Luz, which was in the land of Canaan—that is, to Beis Eil—he and all the people that were with him.

And he built there an altar and called the place Elbethel [that is, The God of Bethel], because there God appeared unto him when he fled from the face of his brother. —  El-beth-el; that is, the God of the house of God: the God into whose house he had been admitted;

— the Targum Onkelos says

There he built an altar, and he called the place Eil Beis Eil, for there Elohim was revealed to him when he was fleeing from his brother.

But Deborah, Rebekah’s nurse, died, and she was buried below Bethel under an oak; and the name of it was called Allonbachuth [that is, The oak of weeping].

— the Targum Onkelos says

Devorah, Rivkah’s nurse, died, and she was buried below Beis Eil, under Allon [on the lower plain]. He named it Allon of Weeping [Plain of the Weeping].

— Deborah, Rebekah’s nurse, died; but no record of when Rebekah died; but the Targum of Jonathan added, “there tidings were brought to Jacob of the death of Rebekah his mother, and he called the name of it, the other weeping;”

And God appeared unto Jacob again when he came out of Padanaram, and blessed him. — God appears to Jacob again at Bethel, and renews the promise made to him there in Genesis 28

13 And behold, the Lord stood above it and said, “I am the Lord God of Abraham thy father and the God of Isaac: The land whereon thou liest, to thee will I give it, and to thy seed.

14 And thy seed shall be as the dust of the earth, and thou shalt spread abroad to the west and to the east, and to the north and to the south; and in thee and in thy seed shall all the families of the earth be blessed. Genesis 28:13-14

— the Targum Onkelos says

Elohim again appeared [became revealed] to Yaakov when he came from Padan Aram, and He blessed him.

10 And God said unto him, “Thy name is Jacob; thy name shall not be called Jacob any more, but Israel shall be thy name”; and He called his name Israel.

— He called his name Israel; so he had been named by the angel that wrestled with him, (Genesis 32:28) and the change of name, then made, is confirmed and ratified here by the Divine Majesty;

— the Targum Onkelos says

Elohim said to him. Your name is Yaakov. No longer will your name be Yaakov, but Yisrael will be your name; and He named him Yisrael.

11 And God said unto him, “I am God Almighty. Be fruitful and multiply; a nation and a company of nations shall be of thee, and kings shall come out of thy loins. — a nation (y);

— a company of nations (gō·yim), tribes, for number and power, equal to so many nations; shall come out of thy loins; often, gōy and gō·yim have being translated as Gentile or Gentiles; but here these are the Israelites;

— the Targum Onkelos says

Elohim said to him, I am Almighty Shaddai. Be fruitful and increase, a nation and a community of nations [an assembly of tribes] will come from you, and kings [who rule over nations] will come out of your loins [descend from you].

— the Targum of Jonathan indicates two kings (Jeroboam and Rehoboam) shall emerge, saying

“And the Lord said to him: ‘I am El Shaddai; be fruitful and multiply. A holy nation and an assembly of prophets and priests shall be from your sons whom you have begotten, and two kings more shall yet come forth from you.'”

12 And the land which I gave Abraham and Isaac, to thee I will give it, and to thy seed after thee will I give the land.” — and the land which I gave Abraham and Isaac, to thee will I give it; meaning the land of between the two rivers, from the Euphates to the Nile which God had by promise given to Abraham and Isaac;

— the Targum Onkelos says

The land that I gave to Avraham and Yitzchok, I will give to you; and to your offspring after you I will give the land.

“I am thy shield! Unto thy seed have I given this land, from the river of Egypt unto the great river, the River Euphrates” Genesis 15:18

13 And God went up from him in the place where He talked with him. — the Targum of Jonathan says: and the Shekinah of the Lord ascended from him in the place where He had spoken with him;

— the Targum Onkelos says

[The Glory of] Elohim ascended from him at the place where He had spoken to him.

14 And Jacob set up a pillar in the place where He talked with him, even a pillar of stone; and he poured a drink offering thereon, and he poured oil thereon. — even a pillar of stone; made of numerous stones hewed and polished, and well put together; whereas the former (Genesis 28:18) was just a single stone, rough and unpolished;

— and he poured a drink offering thereon; of wine, of which drink offerings under the law were, thereby consecrating it to the worship and service of God;

— the Targum Onkelos says

Yaakov set up a monument in the place where He had spoken to him, it was a monument of [a single] stone. He poured a libation [libations] on it, and he [also] poured oil on it.

15 And Jacob called the name of the place where God spoke with him Bethel. — the name Bethel; the house of God, as from El-beth-el; the name was unknown and unused, as what then passed had been confined to Jacob’s own inward consciousness; he now confirmed it and teaches the name to his family;

— the Targum Onkelos says

Yaakov named the place where Elohim had spoken to him; Beis Eil, [the House of the Almighty].

16 And they journeyed from Bethel. And there was but a little way to come to Ephrath; and Rachel travailed, and she had hard labor. — and Rachel travailed, and she had hard labour; the time of childbirth was come;

— and which came suddenly upon her, as travail does, even while journeying, which obliged them to stop; and her pains came upon her, and these very sharp and severe;

— the Targum Onkelos says

They journeyed on from Beis Eil, and there was yet a stretch of land before [they would reach] Ephros when Rochel began to give birth. Her labor was very difficult.

17 And it came to pass, when she was in hard labor, that the midwife said unto her, “Fear not. Thou shalt have this son also.” — thou shalt have this son also; as she had one before, at whose birth she said, “the Lord shall add to me another son” and therefore called his name Joseph, Genesis 30:24

— the Targum Onkelos says

When her labor was at its most difficult stage, the midwife said to her, Do not fear, for this one will also be a son for you.

18 And it came to pass as her soul was departing (for she died), that she called his name Benoni [that is, The son of my sorrow], but his father called him Benjamin [that is, The son of the right hand]. — Rachel had passionately said earlier, Give me children, or else I die; and now that she had children, she died!

— the Targum Onkelos says

As her soul was departing, for she died, she named him Ben Oni [son of my sorrow], but his father named him Binyomin.

19 And Rachel died, and was buried on the way to Ephrath, which is Bethlehem.

— the Targum Onkelos says

Rochel died and was buried on the way to Ephros, which is Beis Lechem [Bethlehem].

20 And Jacob set a pillar upon her grave; that is the pillar of Rachel’s grave unto this day. — that is the pillar of Rachel’s grave unto this day; this is a later addition, but whether inserted by Moses or Ezra we cannot tell.

— the Targum Onkelos says

Yaakov set up a monument on her grave. This monument is on Rochel’s grave to this very day.

21 And Israel journeyed, and spread his tent beyond the tower of Eder.

— the Targum Onkelos says

Yisrael traveled on, and set up [spread] his tent beyond Migdal Eider [Tower of the herds].

22 And it came to pass, when Israel dwelt in that land, that Reuben went and lay with Bilhah, his father’s concubine; and Israel heard it. Now the sons of Jacob were twelve.

— the Targum Onkelos says

When Yaakov was settled in that land. Reuvein went and lay near Bilhah, his father’s concubine, and Yisrael heard [about it]. The sons of Yaakov were twelve.

— Reuben went and lay with Bilhah after Rachel had died; she was the maid that Rachel gave to Jacob earlier; ~~ there was empty space following the original Masoretic Text, and a pause in it,

— indicating, perhaps, after the grief of his heart, that Jacob was not able to speak a word, then an amazement flashed upon him and he elevated himself; a sin and a crime was so provoking, that for it Reuben lost his birthright as the firstborn;

— or another grief for Jacob; the Septuagint also notes that some words might have fallen out of the text by adding, “And it was evil in his sight” for Jacob remembered his defilement to his dying day, and took away the blessing from him; “Reuben: unstable as water, thou shalt not excel;” Genesis 49:3-4

— or, as the Targum of Jonathan could fill the gap in our understanding, saying

‘And it was while Israel dwelt in this land that Reuben went and confounded the bed of Bilhah the concubine of his father, which had been ordained along with the bed of Leah his mother; and this is reputed with regard to him, as if he had lain with her.

‘And Israel heard it, and it afflicted him, and he said, Woe, perhaps there will come forth from me a blemished offspring, just as Ishmael came forth from Abraham and Esau from my father.

‘The Spirit of Holiness answered and thus spake to him: fear not, for all are righteous and none of them is profane! So, after Benjamin was born, the sons of Jakob were twelve.’

Napoleon’s Defeat at Waterloo, forcing him to abdicate and ended the French Empire

— now the sons of Jacob were twelve; who were the heads of twelve tribes, Benjamin the last being born, and Jacob having afterwards no more children, they were all reckoned up under their respective mothers, excepting Dinah, a daughter, from whom there was no tribe.

23 The sons of Leah: Reuben, Jacob’s firstborn, and Simeon and Levi, and Judah and Issachar and Zebulun; — these are the sons of Jacob, which were born to him in Padan-aram. All except Benjamin were born there;

— a sore affliction Reuben’s sin was, and no more was said, until the giving of tribal blessing when Jacob was dying; Genesis 49

— Reuben ~ France; Simeon ~ scattered and Germany? Levi ~ Israel; Issachar ~ Finland; Zebulun ~ Holland;

— the Targum Onkelos says

The sons of Leah [were]: Reuvein, Yaakov’s firstborn, Shimon, Leivi, Yehudah, Yissachar and Zevulun.

24 the sons of Rachel: Joseph and Benjamin; — the sons of Rachel named after Leah. Rachel, Jacob’s next wife, though in right his first and only one, who had two children, Joseph and Benjamin; whose posterity were promised the richest blessings: Manasseh ~ UK; Ephraim ~ US; Benjamin ~ Norway and Iceland;

— the Targum Onkelos says

The sons of Rochel [were]: Yoseif and Binyomin.

25 and the sons of Bilhah, Rachel’s handmaid: Dan and Naphtali; — Dan ~ Ireland, Denmark; Naphtali ~ Sweden;

— the Targum Onkelos says

The sons of Bilhah, Rochel’s handmaid, [were]: Don and Naftali.

26 and the sons of Zilpah, Leah’s handmaid: Gad and Asher. These are the sons of Jacob, who were born to him in Padanaram. — Gad and Asher; Gad ~ Switzerland; Asher ~ Belgium;

— the Targum Onkelos says

The sons of Zilpah, Leah’s handmaid, [were]: Gad and Asher. These are the sons of Yaakov that were born to him in Padan Aram.

27 And Jacob came unto Isaac his father at Mamre, unto the city of Arbah (which is Hebron) where Abraham and Isaac sojourned. — Jacob came unto Isaac his father; probably to dwell with or near him; bringing, it seems, his family with him;

— the Targum Onkelos says

Yaakov came to Yitzchok, his father, in Mamrei at Kiryas Arba, which is Chevron where Avraham and Yitzchok lived.

28 And the days of Isaac were a hundred and fourscore years. — as Isaac was sixty when his sons were born, Jacob was one hundred and twenty years of age at his father’s death; and one hundred and thirty when he appeared before Pharaoh;

— the Targum Onkelos says

The days of [the life of] Yitzchok were one hundred and eighty years.

After Isaac’s death, Esau moves toward Jacob with a huge army

29 And Isaac gave up the ghost and died, and was gathered unto his people, being old and full of days; and his sons Esau and Jacob buried him. — and his sons Esau and Jacob buried him; in the cave of Machpelah near Mamre; but nothing was said of the six sons of Keturah, and their sons;

— the Targum Onkelos says

Yitzchok expired and died. He was gathered to his people old and in the fullness of days. His sons, Eisov and Yaakov buried him.

— the Book of Jubilees (chapters 37, 38) relates that, after Isaac’s death, Esau was stirred up by his sons to attack Jacob with an army; and that Esau said: “If the boar can change its skin, and make its bristles as soft as wool … then will I observe the tie of brotherhood with thee.” Whereupon Jacob, listening to the advice of Judah his son, “bent his bow and sent forth the arrow and struck Esau his brother on the right breast and slew him.”

Before reading from the Book of Jubilees, remember to reflect on the background earlier:

“And Esau harbored hatred in his heart against Jacob, his brother, because of the blessing with which his father had blessed him. And Esau said in his heart, ‘I will not do as Cain did, who killed Abel during their father’s lifetime and then their father had another son, Seth. Rather, I will wait until the days of mourning for my father have passed, and then I will kill Jacob my brother, and I will be the sole heir.'” Genesis 27:42 Jonathan

Book of Jubilees: Chapter 37

1 And on the day that Isaac the father of Jacob and Esau died, the sons of Esau heard that Isaac had given the portion of the elder to his younger son Jacob and they were very angry.

2 And they strove with their father, saying: “Why hath thy father given Jacob the portion of the elder and passed over thee, although thou art the elder and Jacob the younger?”

3 And he said unto them “Because I sold my birthright to Jacob for a small mess of lentils;

4 and on the day my father sent me to hunt and catch and bring him something that he should eat and bless me, he came with guile and brought my father food and drink, and my father blessed him and put me under his hand.

5 And now our father hath caused us to swear, me and him, that we shall not mutually devise evil, either against his brother, and that we shall continue in love and in peace each with his brother and not make our ways corrupt.”

6 And they said unto him, “We shall not hearken unto thee to make peace with him; for our strength is greater than his strength, and we are more powerful than he;

7 we shall go against him and slay him, and destroy him and his sons. And if thou wilt not go with us, we shall do hurt to thee also.

8 And now hearken unto us: Let us send to Aram and Philistia and Moab and Ammon, and let us choose for ourselves chosen men who are ardent for battle, and let us go against him and do battle with him, and let us exterminate him from the earth before he groweth strong.”

9 And their father said unto them, “Do not go and do not make war with him lest ye fall before him.”

10 And they said unto him, “This too, is exactly thy mode of action from thy youth until this day, and thou art putting thy neck under his yoke. We shall not hearken to these words.”

11 And they sent to Aram, and to ’Adurâm to the friend of their father, and they hired along with them one thousand fighting men, chosen men of war.

12 And there came to them from Moab and from the children of Ammon, those who were hired, one thousand chosen men, and from Philistia, one thousand chosen men of war, and from Edom and from the Horites one thousand chosen fighting men, and from the Kittim mighty men of war.

13 And they said unto their father: “Go forth with them and lead them, else we shall slay thee.”
And he was filled with wrath and indignation on seeing that his sons were forcing him to go before (them) to lead them against Jacob his brother.

14 But afterward he remembered all the evil which lay hidden in his heart against Jacob his brother; and he remembered not the oath which he had sworn to his father and to his mother that he would devise no evil all his days against Jacob his brother.

15 And notwithstanding all this, Jacob knew not that they were coming against him to battle, and he was mourning for Leah, his wife, until they approached very near to the tower with four thousand warriors and chosen men of war.

16 And the men of Hebron sent to him saying, “Behold thy brother hath come against thee, to fight thee, with four thousand girt with the sword, and they carry shields and weapons”;

17 for they loved Jacob more than Esau. So they told him; for Jacob was a more liberal and merciful man than Esau.

18 But Jacob would not believe until they came very near to the tower.

19 And he closed the gates of the tower; and he stood on the battlements and spake to his brother Esau and said, “Noble is the comfort wherewith thou hast come to comfort me for my wife who hath died.

20 Is this the oath that thou didst swear to thy father and again to thy mother before they died? Thou hast broken the oath, and on the moment that thou didst swear to thy father wast thou condemned.”

21 And then Esau answered and said unto him, “Neither the children of men nor the beasts of the earth have any oath of righteousness which in swearing they have sworn (an oath valid) for ever; but every day they devise evil one against another, and how each may slay his adversary and foe.

— or in modern language:

“And Esau answered and said to him, ‘Never will there be a sworn oath of true faithfulness among mankind and the beasts of the earth forever, for on that very day, a man will do evil to his brother, and an enemy will seek the life of his foe.'”

— this passage reflects a cynical or pessimistic view expressed by Esau towards Jacob, implying that true and lasting faithfulness or loyalty is impossible among people and even among animals, as enmity and hostility are inevitable.

22 And thou dost hate me and my children for ever. And there is no observing the tie of brotherhood with thee.

23 Hear these words which I declare unto thee, If the boar can change its skin and make its bristles as soft as wool, Or if it can cause horns to sprout forth on its head like the horns of a stag or of a sheep, Then shall I observe the tie of brotherhood with thee.

24 [And if the breasts separated themselves from their mother; for thou hast not been a brother to me.]
And if the wolves make peace with the lambs so as not to devour or do them violence, And if their hearts are towards them for good, Then there will be peace in my heart towards thee.

25 And if the lion becometh the friend of the ox and maketh peace with him, And if he is bound under one yoke with him and plougheth with him, Then shall I make peace with thee.

26 And when the raven becometh white as the râzâ (white like rice), Then know that I have loved thee And shall make peace with thee.

27 Thou shalt be rooted out, And thy sons shall be rooted out, And there shall be no peace for thee.”

28 And when Jacob saw that he was (so) evilly disposed towards him with his heart, and with all his soul as to slay him, and that he had come springing like the wild boar which cometh upon the spear that pierceth and killeth it, and recoileth not from it;

29 Then he spake to his own and to his servants that they should attack him and all his companions.

“If the boar can change its skin, and make its bristles as soft as wool … then will I observe the tie of brotherhood with thee.”

Book of Jubilees: Chapter 38

1 And after that Judah spake to Jacob, his father, and said unto him: “Bend thy bow, father, and send forth thy arrows and cast down the adversary and slay the enemy;

2 and mayest thou have the power, for we shall not slay thy brother, for he is such as thou, and he is like thee: let us give him (this) honour.”

3 Then Jacob bent his bow and sent forth the arrow and struck Esau, his brother, (on his right breast) and slew him.

4 And again he sent forth an arrow and struck ’Adôrân the Aramaean, on the left breast, and drove him backward and slew him.

5 And then went forth the sons of Jacob, they and their servants, dividing themselves into companies on the four sides of the tower.

6 And Judah went forth in front, and Naphtali and Gad with him and fifty servants with him on the south side of the tower, and they slew all they found before them, and not one individual of them escaped.

7 And Levi and Dan and Asher went forth on the east side of the tower, and fifty (men) with them, and they slew the fighting men of Moab and Ammon.

8 And Reuben and Issachar and Zebulon went forth on the north side of the tower, and fifty men with them, and they slew the fighting men of the Philistines.

9 And Simeon and Benjamin and Enoch, Reuben’s son, went forth on the west side of the tower, and fifty (men) with them, and they slew of Edom and of the Horites four hundred men, stout warriors; and six hundred fled,

10 and four of the sons of Esau fled with them, and left their father lying slain, as he had fallen on the hill which is in ’Adûrâm.

11 And the sons of Jacob pursued after them to the mountains of Seir. And Jacob buried his brother on the hill which is in ’Adûrâm, and he returned to his house.

12 And the sons of Jacob pressed hard upon the sons of Esau in the mountains of Seir, and bowed their necks so that they became servants of the sons of Jacob.

13 And they sent to their father (to inquire) whether they should make peace with them or slay them.
And Jacob sent word to his sons that they should make peace,

14 and they made peace with them, and placed the yoke of servitude upon them, so that they paid tribute to Jacob and to his sons always.

15 And they continued to pay tribute to Jacob until the day that he went down into Egypt.
And the sons of Edom have not got quit of the yoke of servitude which the twelve sons of Jacob had imposed on them until this day.

16 And these are the kings that reigned in Edom before there reigned any king over the children of Israel [until this day] in the land of Edom…. — the posterity of Esau had their kings well before the posterity of Jacob had theirs; that is, well before Israel had their first king Saul, and then king David;

— Spain’s earliest kings were from the Visigothic Kingdom or Visigothic Spain (409-711AD), whereas the kings of England started when Æthelstan became the first king to rule the whole of England in 927AD.

17 And Bâlâq, the son of Beor, reigned in Edom, and the name of his city was Danâbâ.

18 And Bâlâq died, and Jobab, the son of Zârâ of Bôsêr, reigned in his stead.

19 And Jobab died, and ’Asâm, of the land of Têmân, reigned in his stead.
And ’Asâm died, and ’Adâth, the son of Barad, who slew Midian in the field of Moab, reigned in his stead, and the name of his city was Avith.

20 And ’Adâth died, and Salman, from ’Amâsêqâ, reigned in his stead.

21 And Salman died, and Saul of Râ’abôth (by the) river, reigned in his stead.

22 And Saul died, and Ba’êlûnân, the son of Achbor, reigned in his stead.

23 And Ba’êlûnân, the son of Achbor, died, and ’Adâth reigned in his stead, and the name of his wife was Maiṭabîth, the daughter of Mâṭarat, the daughter of Mêtabêdzâ’ab.

24 These are the kings who reigned in the land of Edom. Book of Jubilees (chapters 37, 38) 

Genesis 36

Esau married early, and his posterity were roughly one generation ahead of Jacob’s

1 Now these are the generations of Esau, who is Edom. — these are the generations of Esau; he being honoured by being having an account of his posterity recorded, and for the sake of his progenitors, Abraham and Isaac;

— now Edom is used in place of the name Esau, which he received at birth, the former became the national designation of his descendants; the Edomites; others are Idumeans, Hasmonean; and from his famed grandson, Amalek, the Amalekites;

— and because the Edomites were neighbours to Israel, and their genealogy would be of use to cast light of prophecy; their dwelling shall be away from the fatness of the earth; and their genealogy would be of use to cast light on the following relations of what passed between them in the latter years

— the Targum Onkelos says

These are the descendants of Eisov, also known as Edom.

Esau took his wives from the daughters of Canaan: Adah the daughter of Elon the Hittite; and Aholibamah the daughter of Anah, the daughter of Zibeon the Hivite; — and Esau took his wives of the daughters of Canaan; of the Canaanites, the posterity of cursed Canaan;

— Adah the daughter of Elon the Hittite; one of the seven tribes destined to be eliminated, says Genesis 15:18-20: “and the Hittites and the Perizzites and the Rephaim;”

— and Anah, the daughter of Zibeon the Hivite; Shechem the Hivite, took Dinah the daughter of Leah, by force, and evilly defiled her; and to God’s horror, they agree to take up circumcision and residence and be incorporated with Israel, to become one people!

— unlike Jacob, who went back and took wives from his kinsmen, Esau took wives from the local ‘natives’ which displeased both his parents, Isaac and Rebecca. Esau’s descendents are a mixtures of Canaanites, Hittites, Hivites, known to be among the posterity of Ham; and Ishmaelites, a mix with the Egyptians;

— the Targum Onkelos says

Eisov took his wives from the daughters of Canaan: Adah, the daughter of Eylon, the Chittite, and Oholivomoh, the daughter of Anoh, daughter of Tzivon, the Chivite.

and Basemath, Ishmael’s daughter, sister of Nebajoth. — Basemath was listed as a Hittite in Genesis 26:34;

— the Targum Onkelos says

[He also took] Bosmas, the daughter of Yishmael, the sister of Nevayos.

And Adah bore to Esau, Eliphaz; and Basemath bore Reuel;

— the Targum Onkelos says

Adah bore to Eisov, [his son] Eliphaz, and Bosmas bore Reueil.

and Aholibamah bore Jeush and Jaalam and Korah. These are the sons of Esau, who were born unto him in the land of Canaan. — these are the sons of Esau, who were born unto him in the land of Canaan; perhaps his fourth and fifth wives, their sons were born after they left Canaan.

— Rashi: Oholibamah bore…and Korah: This Korah was illegitimate. He was the son of Eliphaz, who had been intimate with his father’s wife, Oholibamah, the wife of Esau. This is evidenced by the fact that he [Korah] is [also] listed among the chieftains of Eliphaz at the end of this chapter. — [from Gen Rabbah 82:12]

— the Targum Onkelos says

Oholivomoh bore Yeush, Yalom, and Korach. These are the sons of Eisov that were born to him in the land of Canaan.

And Esau took his wives, and his sons and his daughters, and all the persons of his house, and his cattle and all his beasts, and all his substance which he had gotten in the land of Canaan, and went into the country from the face of his brother Jacob.

— Esau sought a home further south in Seir, because he knew that Jacob, as the heir, would enter upon the family possessions, so without waiting till Jacob returned, he actually took possession further south;

— “because of Jacob” perhaps for fear of him, as the Targum of Jonathan, which paraphrases the words, “for there fell upon him a fear of Jakob his brother;” because he knew, by the blessing of his father, and the oracle of God, and his concurring providence in all things, that the land of Canaan belonged to Jacob,

— Rashi:

and the land of their sojournings could not: provide [sufficient] pasture for their animals. The Midrash Aggadah (Gen Rabbah 82:13), however, explains “because of his brother Jacob,” [as follows:] Because of the note of obligation of the decree: “that your seed will be strangers” (Gen 15:13), which was put upon the descendants of Isaac.

He (Esau) said, “I will get out of here. I have neither a share in the gift-for the land has been given to him-nor in the payment of the debt.” [He left] also on account of the shame that [he felt because] he had sold his birthright. — [from Gen Rabbah 82:13]

— the Targum Onkelos says

Eisov took his wives, his sons, his daughters, all the people of his household, his livestock, all his animals, and all his possessions that he had acquired in the land of Canaan, and he went to a [different] land away from his brother, Yaakov.

For their riches were more than that they might dwell together, and the land wherein they were strangers could not bear them because of their cattle. — the land wherein they were strangers; the large growth of their wealth made the separation of Esau and Jacob as inevitable;

— the Targum Onkelos says

For their wealth was too great for them to live together. The land in which they lived temporarily could not support them because of their livestock.

Thus dwelt Esau in Mount Seir. Esau is Edom. — Mount Seir; the land of Idumea extends from the southern extremity of the Dead Sea to the Gulf of Elath,

— and consists of a chain of mountains running parallel to the Akaba, or continuation of the deep depression through which the Jordan flows till it loses itself in the Dead Sea;

— Esau is Edom, so called from the red pottage he had of Jacob, which is repeated to fix the odium of that transaction upon him, as well as for the sake of what follows, showing the reason why his posterity were called Edomites;

— the Targum Onkelos says

Eisov [therefore] settled in Mount Seir. Eisov is Edom.

And these are the generations of Esau, the father of the Edomites in Mount Seir.

— the Targum Onkelos says

These are the descendants of Eisov, the ancestor of Edom [the Edomites] in Mount Seir.

10 These are the names of Esau’s sons: Eliphaz the son of Adah the wife of Esau, Reuel the son of Basemath the wife of Esau.

— the Targum Onkelos says

These are the names of Eisov’s sons: Eliphaz, the son of Adah, the wife of Eisov, Reueil, the son of Bosmas, the wife of Eisov.

11 And the sons of Eliphaz were Teman, Omar, Zepho, and Gatam, and Kenaz.

— the Targum Onkelos says

The sons of Eliphaz were Teiman, Omar, Tzepho, Gatam and Kenaz.

12 And Timna was concubine to Eliphaz, Esau’s son, and she bore to Eliphaz, Amalek: these were the sons of Adah, Esau’s wife.

— among the sons of Eliphaz we find Amalek, whose mother was Timna, the concubine of Eliphaz; the ancestor of the Amalekites, who attacked the Israelites at Horeb as they came out of Egypt under Moses (Exodus 17:8);

— more about Timna, the mother of Amalek, from Rashi:

And Timna was a concubine: [This passage is here] to proclaim the greatness of Abraham-how much [people] longed to attach themselves to his descendants. This Timna was a daughter of chieftains, as it is said: “and the sister of Lotan was Timna” (below verse 22).

Lotan was one of the chieftains of the inhabitants of Seir, from the Horites, who had dwelt there before. She said, “I may not be worthy of marrying you, but if only I could be [your] concubine” (Gen Rabbah 82:14). In (I) Chronicles (1:36) [the Chronicler] enumerates her among the children of Eliphaz [here she is counted as the daughter of Seir the Horite, and the concubine of Eliphaz].

This teaches [us] that he (Eliphaz) was intimate with the wife of Seir, and Timna emerged from between them (Seir’s wife and Eliphaz), and when she grew up, she became his (Eliphaz’s) concubine. That is the meaning of “and the sister of Lotan was Timna.” [Scripture] did not count her with the sons of Seir, because she was his (Lotan’s) sister through his mother but not through his father. — [from Tanchuma Vayeshev 1]

— the Targum Onkelos says

Timna became a concubine to Eliphaz, Eisov’s son, and she bore to Eliphaz [a son], Amaleik. These are the sons of Adah, the wife of Eisov.

13 And these are the sons of Reuel: Nahath and Zerah, Shammah and Mizzah: these were the sons of Basemath, Esau’s wife.

— the Targum Onkelos says

These are the sons of Reueil, Nachas, Zerach, Shamoh, and Mizzoh. These were the sons of Bosmas, the wife of Eisov.

14 And these were the sons of Aholibamah, the daughter of Anah the daughter of Zibeon, Esau’s wife; and she bore to Esau: Jeush and Jaalam and Korah.

— the Targum Onkelos says

These are the sons of Oholivomoh, the daughter of Anoh, the daughter of Tzivon, the wife of Eisov; she bore to Eisov: Ye’ush, Yalom and Korach.

15 These were chiefs of the sons of Esau. The sons of Eliphaz the firstborn son of Esau: Chief Teman, Chief Omar, Chief Zepho, Chief Kenaz, — Eliphaz, as he was Esau’s first-born, so he had more than a double portion, his six sons being made dukes;

In the book of Jasher chapter 29, Esau called upon his eldest son, Eliphaz, to pursue and kill Jacob, who would be loaded with similar gold and silver like when Abraham’s chief servant set out to find a wife for Isaac.
When Eliphaz had overtaken Jacob and was about to kill him, he was outwitted by Jacob to spare his life, but Eliphaz could have all his gold and silvers he craves. This book of Jasher is endosed by Joshua and Samuel. It has other details to satisfy an inquiring mind.

— another term for Chief is Duke; or like the sheiks or emirs of the modern East; or like the Nasi or Prince among the Israelite; that is, these men given the titles Chiefs meant that they had rose to a position of prominance to distinguish themselves from their peers;

— the Targum Onkelos says

These are the chiefs of the sons of Eisov: the sons of Eliphaz, Eisov’s first born: Chief Teiman, Chief Omar, Chief Tzepho, Chief Kenaz.

16 Chief Korah, Chief Gatam, and Chief Amalek: these are the chiefs who came of Eliphaz in the land of Edom; these were the sons of Adah. — Amalek rose from the position of a grandson and separated himself from the rest of the Edomites by being given the title of a Chief;

— the Targum Onkelos says

Chief Korach, Chief Gatam, Chief Amaleik. These are the chiefs of Eliphaz in the land of Edom. These are the sons of Adah.

17 And these are the sons of Reuel, Esau’s son: Chief Nahath, Chief Zerah, Chief Shammah, Chief Mizzah: these are the chiefs who came of Reuel in the land of Edom; these are the sons of Basemath, Esau’s wife.

— the Targum Onkelos says

These are the sons of Reu’eil, Eisov’s son: Chief Nachas, Chief Zerach. Chief Shamoh, Chief Mizzoh. These are the Chiefs of Reu’eil in the land of Edom. These are sons of Bosmas, wife of Eisov.

Chief Teman, a chieftain identified by some as the Ottoman Empire; their Turkish tribal leader, Osman’s early followers consisted of Turkish tribal groups and Byzantine renegades, with many but not all converts to Islam

18 And these are the sons of Aholibamah, Esau’s wife: Chief Jeush, Chief Jaalam, Chief Korah: these were the chiefs who came of Aholibamah the daughter of Anah, Esau’s wife.

— these would make fourteen Dukes or Chiefs, whereas it appears from the closing verses of the chapter that there were only eleven:

  • Verses 15 to 18: 1. Chief Teman (a chieftain identified by some as the Ottoman Empire), 2. Chief Omar, 3. Chief Zepho, 4. Chief Kenaz, 5. Chief Korah, 6. Chief Gatam, 7. Chief Amalek, 8. Chief Nahath, 9. Chief Zerah, 10. Chief Shammah, 11. Chief Mizzah, 12. Chief Jeush, 13. Chief Jaalam, 14. Chief Korah;
  • Verses 29 to 30: 1. Chief Lotan, 2. Chief Shobal, 3. Chief Zibeon, 4. Chief Anah, 5. Chief Dishon, 6. Chief Ezer, 7. Chief Disha;
  • Verses 40 to 43: 1. Chief Timnah, 2. Chief Alvah, 3. Chief Jetheth, 4. Chief Aholibamah, 5. Chief Elah, 6. Chief Pinon, 7. Chief Kenaz, 8. Chief Teman, 9. Chief Mibzar, 10. Chief Magdiel (a chieftain identified by Rashi and Chabad as Rome), 11. Chief Iram

— the Targum Onkelos says

These are the sons of Oholivomoh, wife of Eisov: Chief Ye’ush, Chief Yalom, Chief Korach. These are the Chiefs of Oholivomoh, daughter of Anoh, wife of Eisov.

19 These are the sons of Esau, who is Edom, and these are their chiefs.

— the Targum Onkelos says

These are the sons of Eisov, and these are their chiefs, he is Edom.

20 These are the sons of Seir the Horite, who inhabited the land: Lotan and Shobal, and Zibeon and Anah, — Mount Seir is called the land of their possession. Canaan was at this time only the land of promise. Seir was in the possession of the Edomites;

— “Seir the Horite,” the Horites Genesis 14:6, were cave-dweller, and probably got the name from the cave hewn out of the solid rock in which he was accustomed to dwell; Sela being a city of such excavated dwellings;

— Rashi:

the inhabitants of the land: They were its inhabitants before Esau came there. Our Rabbis explain [that they were called, “inhabitants of the land”] (Shab. 85a) because they were skilled in making the land habitable.

[They would say,] “The length of this [measuring] stick is [good] for [planting] olives; the length of this [measuring] stick is [good] for [planting] grapevines,” for they would taste [the soil] and know what was suitable to plant in it.

— the Targum Onkelos says

These are the sons of Se’ir, the Chorite, the inhabitants of the land: Lotan, Shoval, Tzivon, and Anoh.

21 and Dishon and Ezer and Dishan: these are the chiefs of the Horites, the children of Seir in the land of Edom.

— the Targum Onkelos says

Dishon, Eitzer and Dishan, these are the chiefs of the Chorites, the sons of Se’ir, in the land of Edom.

22 And the children of Lotan were Hori and Hemam; and Lotan’s sister was Timna.

— the Targum Onkelos says

The sons of Lotan were Chori and Heimam. Lotan’s sister was Timna.

23 And the children of Shobal were these: Alvan and Manahath and Ebal, Shepho and Onam.

— the Targum Onkelos says

These are the sons of Shoval: Alvan, Manachas, Eival, Shefo and Onom.

24 And these are the children of Zibeon: both Ajah and Anah; this was that Anah that found the mules in the wilderness as he fed the asses of Zibeon his father.

— Rashi:

who found the mules in the wilderness: Heb. הַיֵמִם, mules. He mated a donkey with a mare (female horse), and it gave birth to a mule. He (Anah) was illegitimate, and he brought illegitimate offspring into the world (Gen. Rabbah 82:15).

Why were they called יֵמִם (signifying “dreaded beings”)? Because their dread (אֵימָתָן) was cast upon people; Rabbi Hanina said, “In all my days no one has ever recovered from a wound from a white female mule.” (But we see that [those bitten by white female mules] do live.

Do not read: “who has lived (וְהָיָה) ,” but “that was healed (וְחָיתָה) ,” because [such a] wound will never heal. — [from an old Rashi manuscript]) It was unnecessary to list the genealogy of the Horites except to mention Timna, and thereby inform us of the greatness of Abraham, as I explained above (verse 12). [from Chullin 7b]

— the Targum Onkelos says

These are the sons of Tzivon: Ayoh and Anoh. He is the same Anoh who found the mules [mighty ones] in the desert while tending the donkeys for his father, Tzivon.

25 And the children of Anah were these: Dishon, and Aholibamah the daughter of Anah.

— the Targum Onkelos says

These are the children of Anoh: Dishon, and Oholivomoh the daughter of Anoh.

26 And these are the children of Dishon: Hemdan and Eshban, and Ithran and Cheran.

— the Targum Onkelos says

These are the sons of Dishon: Chemdan, Eshban, Yisran and Keran.

27 The children of Ezer are these: Bilhan and Zaavan and Akan.

— the Targum Onkelos says

These are the sons of Eitzer: Bilhan, Za’avan and Akan.

28 The children of Dishan are these: Uz and Aran.

— the Targum Onkelos says

These are the sons of Dishon: Utz and Aran.

29 These are the chiefs who came of the Horites: Chief Lotan, Chief Shobal, Chief Zibeon, Chief Anah,

— the Targum Onkelos says

These are the chiefs of the Chorites: Chief Lotan, Chief Shoval, Chief Tzivon, Chief Anoh.

30 Chief Dishon, Chief Ezer, Chief Dishan: these are the chiefs who came of the Horites, among their chiefs in the land of Seir.

— the Targum Onkelos says

Chief Dishon, Chief Eitzer, Chief Dishan. These are the chiefs of the Chorites based on the ranks of chiefs in the Land of Se’ir.

31 And these are the kings who reigned in the land of Edom, before there reigned any king over the children of Israel.

— Rashi:

And these are the kings, etc.: They were eight, and, corresponding to them, Jacob set up [eight kings] and nullified the kingdom of Esau during their time. They are the following (kings): Saul, Ish-bosheth, David, Solomon, Rehoboam, Abijah, Asa, and Jehoshaphat.

During the days of his (Jehoshaphat’s) son Joram, however, it is written: “In his days, Edom revolted from under the power of Judah, and they appointed a king over themselves” (II Kings 8:20), [whereas] during Saul’s days it is written: “There was no king in Edom; a governor was king” (I Kings 22:48). [from Gen. Rabbah 83:2]

— the Targum Onkelos says

These are the kings who reigned in the Land of Edom before any king reigned over the Children of Israel.

32 And Bela the son of Beor reigned in Edom; and the name of his city was Dinhabah.

— the Targum Onkelos says

Bela, son of Be’or reigned in Edom, and the name of his city was Dinhavah.

33 And Bela died, and Jobab the son of Zerah of Bozrah reigned in his stead.

— the Targum Onkelos says

Bela died, and he was succeeded as king by Yovav, son of Zerach, from Botzroh.

34 And Jobab died, and Husham of the land of the Temanites reigned in his stead.

— the Targum Onkelos says

Yovav died, and he was succeeded as king by Chusham from the land of the Teimanites [South].

35 And Husham died, and Hadad the son of Bedad (who smote Midian in the field of Moab) reigned in his stead; and the name of his city was Avith.

— Rashi: who defeated Moab in the field of Midian: For Midian came against Moab to wage war, and the king of Edom went to aid Moab. From here we learn that Midian and Moab were quarreling with one another, and in the days of Balaam they made peace, [in order] to band together against Israel. — [from Tanchuma Balak 3]

— the Targum Onkelos says

Chusham died, and he was succeeded as king by Hadad, son of Bedad, who attacked [killed] Midian [the Midianites] in the field of Moav, and the name of his city was Avis.

36 And Hadad died, and Samlah of Masrekah reigned in his stead.

— the Targum Onkelos says

Hadad died, and he was succeeded as king by Samlah of Masriekah.

37 And Samlah died, and Saul of Rehoboth by the river reigned in his stead.

— the Targum Onkelos says

Samlah died, and he was succeeded as king by Sha’ul from Rechovos-by-the-river [P’ras].

38 And Saul died, and Baalhanan the son of Achbor reigned in his stead.

— the Targum Onkelos says

Sha’ul died, and he was succeeded as king by Ba’al-Chanan, son of Achbor.

39 And Baalhanan the son of Achbor died, and Hadar reigned in his stead; and the name of his city was Pau; and his wife’s name was Mehetabel, the daughter of Matred, the daughter of Mezahab.

— the Targum Onkelos says

Ba’al-Chanan, son of Achbor died, and he was succeeded as king by Hadar. The name of his city was Pa’u. His wife’s name was Meheitaveil, the daughter of Matreid, daughter of Mei-Zahav [a goldsmith].

40 And these are the names of the chiefs who came of Esau, according to their families, after their places, by their names: Chief Timnah, Chief Alvah, Chief Jetheth,

— Rashi: And these are the names of the chieftains of Esau: who were called by the names of their provinces after Hadar died and their kingdom had ceased. The first ones mentioned above (verses 15-19) are the names of their generations, and so it is delineated in (I Chronicles 1: 51): And Hadar [sic] died, and the chiefs of Edom were Chief Timna, etc.”

— the Targum Onkelos says

These are the names of the chiefs of Eisov, each with their families, according to their places, by their names: Chief Timna, Chief Alvoh, Chief Yeseis.

41 Chief Aholibamah, Chief Elah, Chief Pinon,

— the Targum Onkelos says

Chief Oholivomoh, Chief Eilah, Chief Pinon.

42 Chief Kenaz, Chief Teman, Chief Mibzar,

— the Targum Onkelos says

Chief Kenaz, Chief Teimon, Chief Mivtzar.

43 Chief Magdiel, Chief Iram: these are the chiefs of Edom, according to their habitations in the land of their possession; he is Esau, the father of the Edomites. — the name Magdiel couldn’t be traced back to which son of Esau was he from; thus he could be a more remote great or even great-great grandson of Esau;

— the Targum Onkelos says

Chief Magdiel, Chief Iram. These are the chiefs of Edom according to their places of residence, in the land of their possession. Thus was Eisov the ancestor of the Edomites.

— RashiMagdiel: This is Rome. — [From Pirkei d’Rabbi Eliezer, ch. 38]; but Magiel could only be a grandson or even great grandson of Esau; as Esau had many wives; children and grandchildren, Magiel would have numerous near and distant cousins that would have migrated further into the Iberian peninsula as identified in Obadiah 1:20;

In summary, Esau took wives from the local ‘natives’ which displeased both his parents. Hence Esau’s descendents are a mixtures of Canaanites, Hittites, Hivites, known to be among the posterity of Ham; and Ishmaelites, a mix with the Egyptians. Often, many of their childen are spiritually illegitimate!

Italy or Rome was under the Spanish Empire at one time in history
For more, see The “Monroe Doctrine” Is the Yoke of Jacob

Centuries later, the Spanish are also known to have taken wives from the natives, starting with Mexico and have mixed marriages all over South America.

For more about the South, a prophecy of Esau or Edom, see Obadiah

For more on the enemy from the South, see A Sword from the South!

For more into another Captivity: see Ezekiel Timeline – 190/40 Years

Iran’s 10 demands include £1 million-a-ship fee for Hormuz Strait

•April 9, 2026 • Leave a Comment

Iran’s humiliating 10 demands for Trump include £1 million-a-ship fee for Hormuz Strait; but the fragile ceasefire makes no mention of ending Iran’s nuclear enrichment; US Forces leaving the region; and Israel has said the ceasefire will not include Lebanon.

Iran’s 10 demands include $2 million-a-ship fee for Hormuz Strait

Mirror • April 8, 2026 ~ Express

President Trump has agreed to a two-week ceasefire with Iran to negotiate on their 10-point proposal, including lifting sanctions, guaranteed no attacks and permanent end to war.

Iran’s list of demands put to President Trump has been made public following a ceasefire agreement, including an eye-watering $2 million (£1.1 million)-a-ship fee to use the Strait of Hormuz.

Washington and Tehran last night agreed on a deal to avoid a horrifying escalation of conflict in the Middle East.

The US president had set a deadline of 20:00 EDT (01:00 BST) for a deal or else “a whole civilisation will die tonight,” pouring petrol onto the flames of his previous threats to target bridges and power plants.

At the eleventh hour, Trump took to Truth Social to confirm a last-minute cancellation of the planned attack, an “immediate ceasefire,” and the reopening of the Strait of Hormuz.

Trump wrote in a post on Truth Social: “I agree to suspend the bombing and attack of Iran for a period of two weeks. This will be a double-sided CEASEFIRE!”

The US President further stated: “We received a 10-point proposal from Iran, and believe it is a workable basis on which to negotiate. Almost all of the various points of past contention have been agreed to between the United States and Iran, but a two-week period will allow the Agreement to be finalized and consummated.”

Iran’s 10-point plan includes:

  1. Guarantee that Iran will not be attacked again
  2. Permanent end to the war, not just a ceasefire
  3. End to Israeli strikes in Lebanon
  4. Lifting of all US sanctions on Iran
  5. End to all regional fighting against Iranian allies
  6. In return, Iran would open the Strait of Hormuz
  7. Iran would impose a Hormuz fee of $2 million per ship
  8. Iran would split these fees with Oman
  9. Iran to provide rules for safe passage through Hormuz
  10. Iran to use Hormuz fees for reconstruction instead of reparations

Tragedy avoided… for two weeks

Iranian Foreign Minister Abbas Araghchi later announced Iran will agree to a ceasefire “if attacks against Iran are halted.”

He said: “For a period of two weeks, safe passage through the Strait of Hormuz will be possible.”

This will take place “via coordination with Iran’s Armed Forces and with due consideration of technical limitations,” he said.

It came after the Prime Minister of Pakistan, Shehbaz Sharif, called on Trump to extend his deadline for two weeks “to allow diplomacy to run its course.”

He also asked Iran to open the Strait of Hormuz.

In a post on X, Shehbaz Sharif wrote: “Diplomatic efforts for peaceful settlement of the ongoing war in the Middle East are progressing steadily, strongly and powerfully with the potential to lead to substantive results in near future.

“To allow diplomacy to run its course, I earnestly request President Trump to extend the deadline for two weeks.

“Pakistan, in all sincerity, requests the Iranian brothers to open Strait of Hormuz for a corresponding period of two weeks as a goodwill gesture.

“We also urge all warring parties to observe a ceasefire everywhere for two weeks to allow diplomacy to achieve conclusive termination of war, in the interest of long-term peace and stability in the region.”

Woe to the crown of pride, to the drunkards of Ephraim, whose glorious beauty is a fading flower, which is on the head of the fat valleys of them that are overcome with wine! Isaiah 28:1

Genesis (33-34)

•April 8, 2026 • Leave a Comment

Then after Esau found that he had lost his birthright to Jacob, he pleaded his father if he had anything left, and Isaac answered and prophesied, saying,

“And by your sword shall you live, you will go to every place, and wander, and you will be subject to your brother. But when his descendants abandon the commandments of the Torah, then you will break his yoke from your neck.”

“And Esau harbored hatred in his heart against Jacob, his brother, because of the blessing with which his father had blessed him.

And Esau said in his heart, ‘I will not do as Cain did, who killed Abel during their father’s lifetime and then their father had another son, Seth.

Rather, I will wait until the days of mourning for my father have passed, and then I will kill Jacob my brother, and I will be the sole heir.'” Genesis 27:41-42 Jonathan

Looking through the Scriptures with a blast of fresh air!

“The anger of the Lord shall not return, until He has executed and until He has performed the intent of His thought; in the latter days ye shall understand it perfectly.” Jeremiah 23:20

Genesis 33

1 And Jacob lifted up his eyes and looked, and behold, Esau came and with him four hundred men. And he divided the children among Leah and Rachel and the two handmaids. — as Jacob went forward, he saw Esau coming to meet him with his 400 mean;

— the Targum Onkelos says

Yaakov raised his eyes and saw that Eisov was coming, and with him there were four hundred men. He then divided the children among Leah, Rochel and the two handmaids [concubines].

And he put the handmaids and their children foremost, and Leah and her children after, and Rachel and Joseph hindmost. — he then arranged his wives and children in such a manner, that the maids with their children went first, Leah with hers in the middle, and Rachel with Joseph behind, thus forming a long procession;

— the Targum Onkelos says

He placed the handmaids [concubines] and their children foremost, Leah and her sons behind them, and Rochel and Yoseif in the rear.

— the Targum of Jonathan says

and placed the concubines and their sons foremost; for he said, If Esau come to destroy the children and abuse the women, he will do it with them, and meantime we will arise and encounter him in fight; and Leah and her children after, and Rahel and Joseph after them.

And he passed over before them, and bowed himself to the ground seven times until he came near to his brother. — he bowed seven times; the manner of doing this is by looking towards a superior and bowing to the ground;

— then advancing a few steps and bowing again, and repeating his obeisance till, at the seventh time; members of his family did the same; this was a token of profound fear of terror rather than respect;

— the Targum Onkelos says

He went ahead of them, and he prostrated himself to the earth seven times, until he approached his brother.

And Esau ran to meet him, and embraced him and fell on his neck and kissed him; and they wept. — and they wept; Jacob wept for joy to be thus kindly received; Esau, perhaps, with grief and shame, to think of the ill design he had conceived against his brother;

— and they wept, both Jacob and Esau, for joy at the sight of each other, and both seriously; and especially there can be no doubt of Jacob, who must be glad of this reconciliation, and the lives of his wives and children, would be spared;

— the Targum Onkelos says

Eisov ran to meet him. He hugged him and fell on his neck and kissed him. They [both] wept.

— the Targum of Jonathan says

And Esau ran to meet him, and embraced him, and fell upon his neck and kissed him, and they wept. Esau wept on account of the pain of his teeth which were shaken; but Jakob wept because of the pain of his neck.

And he lifted up his eyes, and saw the women and the children, and said, “Who are those with thee?” And he said, “The children which God hath graciously given thy servant.” — Jacob speaks of his children as God’s gifts; a heritage of the Lord, and as choice gifts, graciously given him;

— the Targum Onkelos says

[Eisov] raised his eyes and saw the women and children. He said, Who are these to you? He [Yaakov] said, These are the children whom God has graciously [compassionately] granted your servant.

Then the handmaidens came near, they and their children, and they bowed themselves. — the handmaidsand their children came near; they, being foremost, and next to, Jacob, as Bilhah and her two sons, Dan and Naphtali, and Zilpah and her two sons, Gad and Asher;

— the Targum Onkelos says

The handmaids [concubines] [then] approached, they, and their children, and prostrated themselves.

And Leah also with her children came near and bowed themselves; and after these came Joseph and Rachel near, and they bowed themselves.

— and Leah also with her children came near, and bowed themselves; who were in the next division or company; their children were seven, Reuben, Simeon, Levi, Judah, Issachar, Zebulun, and Dinah, six sons and one daughter:

— and after came Joseph and Rachel, and they bowed themselves; it is observed that Joseph is mentioned before his mother; it may be, because they might put him before her in the procession, for greater safety; or she might present him to Esau, being a child of little more than six years of age;

— the Targum Onkelos says

Leah and her children also approached and prostrated themselves, and finally Yoseif and Rochel approached and prostrated themselves.

And he said, “What meanest thou by all this drove which I met?” And he said, “These are to find grace in the sight of my lord.” — and he said, these are to find grace in the sight of my lord; to gain his favour and good will; and which, as it was a token of Jacob’s good will to him;

— the Targum Onkelos says

He [Eisov] said, What do you have to do with that whole camp that approached me? He [Yaakov] said, It was to find favor in the eyes of my master.

And Esau said, “I have enough, my brother. Keep what thou hast unto thyself.” — and Esau said, I have enough; literally, I have abundance; keep that thou hast unto thyself, let be to thee what is to thee;

— the Targum Onkelos says

Eisov said, I have plenty. My brother, let what you have remain yours [be successful].

10 And Jacob said, “Nay, I pray thee, if now I have found grace in thy sight, then receive my present at my hand; for therefore I have seen thy face as though I had seen the face of God, and thou wast pleased with me.

— as though I had seen the face of God. It is in a manner as pleasant a sight to me as the sight of God himself, because in thy reconciled face I see the face and favour of God thus manifested unto me;

— the Targum Onkelos says

Yaakov said, Please, no. If I have found favor in your eyes [now], take [accept] my present from my hand, because I have seen your face [and it was] like seeing the face of a God[ly being] [great ones]; and you have received me favorably.

11 Take, I pray thee, my blessing that is brought to thee, because God hath dealt graciously with me, and because I have enough.” And he urged him, and he took it. — and Jacob urged him, and Esau took it: being pressing on him, or importunate with him, Esau accepted of his present;

— the Targum Onkelos says

Please [Now] accept my blessing [present] as it was brought to you, for God has been gracious to me, for I have everything. He thus urged him and he took [accepted] it.

12 And he said, “Let us take our journey; and let us go, and I will go before thee.” — and Esau offers himself to be Jacob’s guide and companion, in token of a sincere reconciliation;

— the Targum Onkelos says

He [Eisov] said, Go and we will move on, and I will move on with you.

13 And he said unto him, “My lord knoweth that the children are tender, and the flocks and herds with young are with me; and if men should overdrive them one day, all the flock will die. — and Jacob said unto Esau; the children are tender; the eldest of them, Reuben, not being yet fourteen years old;

— the Targum Onkelos says

He [Yaakov] said to him, My master knows that the children are delicate, and that the sheep and cattle with me are nursing. If they are driven hard for [even] one day, all the sheep will die.

14 Let my lord, I pray thee, pass over before his servant; and I will lead on gently, according as the cattle that goeth before me and the children are able to endure, until I come unto my lord unto Seir.”

— unto Seir; this implies a purpose of visiting Esau, but not carried out probably because Esau hadn’t settled there yet, he instead returned to Hebron to his father;

— the Targum Onkelos says

Please [Now] my master, go on ahead of your servant. I will lead on gently, in my slow pace, according to the pace of the work that is before me, and according to the pace of the children, until I come to my master in Seir.

15 And Esau said, “Let me now leave with thee some of the folk who are with me.” And he said, “What need is there? Let me find grace in the sight of my lord.” — and he said, what needeth it? Jacob knew the direct way very probably; he thought himself in no danger;

— the Targum Onkelos says

Eisov said, Let me leave [now] with you some of the people that are with me. He [Yaakov] said, What for? Let me find favor in the eyes of my master.

16 So Esau returned that day on his way unto Seir. — Esau took his leave of Jacob the same day he met Jacob, and proceeded on in his journey towards Seir;

— the Targum Onkelos says

On that day Eisov returned on his way—going to Seir.

17 And Jacob journeyed to Succoth, and built him a house, and made booths for his cattle. Therefore the name of the place is called Succoth [that is, Booths].

— and built him an house, and made booths for his cattle; an house for himself and family, and booths or tents for his servants or shepherds, and for the cattle they had the care of, some for one, and some for the other;

— the Targum Onkelos says

Yaakov traveled to Sukkos and built himself a house, and for his livestock he made shelters. He therefore named the place Sukkos.

18 And Jacob came to Shalem, a city of Shechem which is in the land of Canaan, when he came from Padanaram, and pitched his tent before the city. — Shechem, where Jacob’s well is still there; where a woman of Samaria to draw water and met Jesus: John 4:6

— the Targum Onkelos says

Yaakov arrived safely at the city of Shechem, which is in the Land of Canaan, when he came from Padan Aram. He encamped before the city.

19 And he bought a parcel of a field where he had spread his tent, at the hand of the children of Hamor, Shechem’s father, for a hundred pieces of money. — a hundred pieces of money; may signify either lambs, given in way of exchange for it, or a hundred pieces of silvers;

— the Targum Onkelos says

He bought the part [possession] of the field where he had spread his tent, from the sons of Chamor, father of Shechem, for one hundred kesitahs [sheep].

20 And he erected there an altar, and called it El-elohe-Israel [that is, God, the God of Israel]. — Jacob erected there an altar; Abraham had already built an altar in this neighbourhood (Genesis 12:7), and Jacob now followed his example;

— the Targum Onkelos says

He erected an altar there and called it [worshiped upon it before] the Almighty is [the] God of Yisrael.

Genesis 34

1 And Dinah the daughter of Leah, whom she bore unto Jacob, went out to see the daughters of the land. — Dinah went out to see the daughters of the land; from her father’s house into the city, out of curiosity, to explore the daughters of the land;

— the Targum Onkelos says

Deenah went out, the daughter of Leah, whom she had borne to Yaakov, to see [visit] the local girls.

And when Shechem the son of Hamor the Hivite, prince of the country, saw her, he took her and lay with her, and defiled her. — Shechem the Hivite, took her by force, and evilly defiled her;

— the Targum Onkelos says

She was seen by Shechem, son of Chamor, the Chivite, who was the prince of the land. He took her, was with her, and mistreated her.

And his soul cleaved unto Dinah the daughter of Jacob, and he loved the damsel and spoke kindly unto the damsel.

— and his soul clave unto Dinah the daughter of Jacob; his inclination was to her; it was not a mere lustful desire that was suddenly raised, but a constant and continued affection he bore to her; professing great love to her;

— the Targum Onkelos says

He became deeply attached to [He desired] Deenah, the daughter of Yaakov, and he loved the girl. He spoke to the girl’s heart.

And Shechem spoke unto his father Hamor, saying, “Get me this damsel for a wife.” — and Shechem spake unto his father Hamor; and told him the whole affair, at least what a strong affection he had for Dinah;

— the Targum Onkelos says

Shechem spoke to his father Chamor, saying, Take this young girl for me as a wife.

And Jacob heard that he had defiled Dinah his daughter. Now his sons were with his cattle in the field, and Jacob held his peace until they had come. — Jacob held his peace; he as a father and a good man, must have been deeply distressed; baitded for time;

— the Targum Onkelos says

Yaakov heard that he had defiled his daughter, Deenah, [while] his sons were with the livestock in the fields. Yaakov remained silent until they returned.

And Hamor the father of Shechem went out unto Jacob to commune with him. — to commune with him; to talk with him about the affair of Dinah, to pacify him, and endeavour to gain his consent, that his son might marry her, and to settle the terms of the marriage;

— the Targum Onkelos says

Chamor, father of Shechem, went out to Yaakov to speak with him.

And the sons of Jacob came out of the field when they heard it; and the men were grieved and they were very wroth, because he had wrought folly in Israel by lying with Jacob’s daughter, which thing ought not to be done.

— and the men were grieved and were very wroth; they were grieved for the wickedness committed against God as well as for the injury done to their sister;

— the Targum Onkelos says

The sons of Yaakov returned from the field when they heard [what had happened]. The men grieved and were very angry, for he [Shechem] had committed an outrage against Yisrael to lie with a daughter of Yaakov. Such a thing should not be done [It is not fitting for such a think to have been done].

And Hamor communed with them, saying, “The soul of my son Shechem longeth for your daughter. I pray you give her to him for a wife; — Hamor communed with Jacob’s sons, to whom Jacob committed the business, being himself oppressed with shame and grief, and fear for his daughter;

— the Targum Onkelos says

Chamor spoke with them saying, My son, Shechem, desires your daughter. Please [Now] grant her to him for a wife.

and make ye marriages with us, and give your daughters unto us, and take our daughters unto you.

— and make ye marriages with us; there was no objection on their side, it lay on Jacob’s; Abraham’s servant was charged by him not to take a wife of the Canaanites to his son Isaac; and the same charge was given Jacob by Isaac, Genesis 24:3

— the Targum Onkelos says

Intermarry with us. Give us your daughters, and take our daughters for yourselves.

10 And ye shall dwell with us, and the land shall be before you. Dwell and trade ye therein, and get you possessions therein.” — ye shall dwell with us; Hamor proposes that Jacob’s family shall abandon their nomad life, and settle among the Hivites; and trade with them;

— the Targum Onkelos says

You will [then] live with us and the land will be open to you. Live and [do] trade in [with] it and possess it.

11 And Shechem said unto her father and unto her brethren, “Let me find grace in your eyes, and what ye shall say unto me, I will give. — and what ye shall say unto me, I will give; to her, to her parents, to her brethren and relations; let what will be fixed, shall be given; 

— the Targum Onkelos says

Shechem said to her father and her brothers, Let me find favor in your eyes and what ever you say [ask of me], I will give.

12 Ask me ever so much dowry and gift, and I will give according as ye shall say unto me; but give me the damsel for a wife.”

— and I will give according as ye shall say unto me; determine among yourselves whatever shall be the dowry and gift, and it shall be punctually observed: but give me the damsel to wife; only agree to that, and I care not what is required of me;

— the Targum Onkelos says

Increase greatly the amount I must pay for the bridal dowry and gifts. I will give whatever you say, but give me the girl for a wife.

13 And the sons of Jacob answered Shechem and Hamor his father deceitfully, and said — because he had defiled Dinah their sister”

— and the sons of Jacob answered Shechem and Hamor deceitfully; or with carnal wisdom and wicked cunning, proposing the marriage of their sister, when they never intended it should ever be;

— the Targum Onkelos says

The sons of Yaakov answered Shechem, and his father Chamor, with guile [cleverness], when they spoke; because he had defiled their sister, Deenah.

14 and they said unto them, “We cannot do this thing, to give our sister to one who is uncircumcised, for that would be a reproach unto us. — and Levi and Simeon said unto Hamor and Shechem:

— nothing is said of their teaching the people to worship the true God, but only of their insisting on their being circumcised; a cloak to cover their diabolical design;

— the Targum Onkelos says

They said to them, We cannot do such a thing—to give our sister [in marriage] to an uncircumcised man, for that is a disgrace to us.

15 But in this will we consent unto you: If ye will be as we are, that every male of you be circumcised, — as we are; that is; the sons of Jacob were all circumcised as they claimed;

— the Targum Onkelos says

This is the only way we will consent to you: if you will be like us, circumcising all your males.

16 then will we give our daughters unto you; and we will take your daughters to us, and we will dwell with you, and we will become one people. — and we will take your daughters to us; in marriage for wives: and we will dwell with you; not as sojourners but as fellow citizens;

— the Targum Onkelos says

[Then] we will give our daughters to you, and we will take your daughters for ourselves. We will live together with you, and we will become one people.

17 But if ye will not hearken unto us to be circumcised, then will we take our daughter and we will be gone.” — then will we take our daughter; by force,

— the Targum Onkelos says

But if you do not listen to [obey] us to be circumcised, we will take our daughter and go.

— as the Targum of Jonathan adds: and we will be gone: depart from this part of the country, and go elsewhere.

18 And their words pleased Hamor, and Shechem, Hamor’s son. — Hamor, and Shechem, the son of Hamor the Hivite;

— the Targum Onkelos says

Their words were agreeable in the eyes of Chamor, and in the eyes of Shechem, the son of Chamor.

19 And the young man deferred not to do the thing, because he had delight in Jacob’s daughter; and he was more honorable than all the house of his father.

— and he was more honourable than all the house of his father; for though in defiling Jacob’s daughter, yet in this he was honourable, that he sought to marry her, and to recompence the injury;

— the Targum Onkelos says

The young man did not delay doing the thing, because he desired the daughter of Yaakov. He was the most honored person in his father’s house.

20 And Hamor and Shechem his son came unto the gate of their city, and communed with the men of their city, saying, — and communed with the men of their city; upon the subject of entering into an alliance with Jacob’s family, of admitting them to be fellow citizens with them;

— the Targum Onkelos says

Chamor and his son, Shechem came to the gate of their city, and they spoke to the men of their city saying,

21 “These men are peaceable with us. Therefore let them dwell in the land and trade therein; for the land, behold, it is large enough for them. Let us take their daughters to us for wives, and let us give them our daughters.

— let us take their daughters to us for wives, and let us give them our daughters; this is not just a horror to Abraham or Isaac, but to God himself;

— alas! for how one sin leads on to another, and, like flames of fire, spread desolation in every direction! For this will put God’s direction to no effect:

“Unto thy seed have I given this land, from the river of Egypt unto the great river, the River Euphrates: the Kenites and the Kenizzites and the Kadmonites, and the Hittites and the Perizzites and the Rephaim, and the Amorites and the Canaanites and the Girgashites and the Jebusites.” Genesis 15:18-21

— the Targum Onkelos says

These men are completely at peace with us. Let them live in the land and [do] trade in [with] it. The land has ample room to be open to them. We will take their daughters for wives, and we will give them our daughters.

22 Only herein will the men consent unto us to dwell with us, to be one people: if every male among us be circumcised, as they are circumcised.

— if every male among us be circumcised, as they are circumcised; submitting to this rite, they agree to take up their residence with us, and be incorporated among us, and to God’s horror, become one people;

— the Targum Onkelos says

But only on these terms will the men consent to live with us, to become one people: every male among us must be circumcised, just as they are circumcised.

23 Shall not their cattle and their substance and every beast of theirs be ours? Only let us consent unto them, and they will dwell with us.”

— only let us consent unto them; in the affair of circumcision: and they will dwell with us; and what by trading with them, and marrying among them, all their wealth and riches will come into our hands;

— the Targum Onkelos says

Their livestock, their possessions and all their cattle, will it not be ours? Only let us consent to them, and they will live with us.

24 And unto Hamor and unto Shechem his son hearkened all who went out of the gate of his city; and every male was circumcised, all who went out of the gate of his city.

— they consented to be circumcised, in compliance with their young prince, whom they either feared or loved; to be willing to expose themselves to great pains and hazards;

— the purpose of circumcision was to keep the Israelites “unmixed” or maintained separated from all the neighbouring tribes, for Josephus (Antiquities. l. 1. c. 10. sect. 5) said:

The forementioned son was born to Abram when he was eighty-six years old: but when he was ninety-nine, God appeared to him, and promised him that he Should have a son by Sarai, and commanded that his name should be Isaac; and showed him, that from this son should spring great nations and kings, and that they should obtain all the land of Canaan by war, from Sidon to Egypt.

But he charged him, in order to keep his posterity unmixed with others, that they should be circumcised in the flesh of their foreskin, and that this should be done on the eighth day after they were born.

— the Targum Onkelos says

They listened to [obeyed] Chamor, and to his son, Shechem—all those who passed through the gate of his city. Every male was circumcised—all who passed through the gate of his city.

25 And it came to pass on the third day, when they were sore, that two of the sons of Jacob, Simeon and Levi, Dinah’s brethren, took each man his sword, and came upon the city boldly and slew all the males.

— Simeon and Levi, being Leah’s children; Dinah’s brethren; they act as sworn enemies to those to whom they were lately become sworn friends;

— the Targum Onkelos says

On the third day when they were in pain [their pain was strong upon them], two of Yaakov’s sons, Shimon and Leivi, brothers of Deenah, each took his sword. They approached the city with confidence [whose inhabitants dwell in security], and killed every male.

26 And they slew Hamor and Shechem his son with the edge of the sword, and took Dinah out of Shechem’s house, and went out.

— and took Dinah out of Shechem’s house; where she was detained from the time of her being ravished by Shechem, the son of Hamor the Hivite, against her will, as hostage, with an evil intention of forcing a marriage on her;

— what a parallel in today’s environment where the Hamas terrorists killed many Jews on October 7, 2023; and captured over two hundreds of the others as hostages, trying to force “peace” onto Israel;

— the Targum Onkelos says

They killed Chamor and his son Shechem at the point of the sword. They took Deenah from the house of Shechem and they left.

27 The sons of Jacob came upon the slain and despoiled the city, because they had defiled their sister. — although only two of Jacob’s sons were mentioned, they might be assisted by the rest; at least, no doubt, they were attended with servants, who were aiding: in accomplishing a bloody judgement;

— the Targum Onkelos says

The sons of Yaakov came upon the corpses [to strip the corpses], and they plundered the city that had defiled their sister.

28 They took their sheep and their oxen and their asses, and that which was in the city, and that which was in the field;

— the Targum Onkelos says

Their sheep, their cattle, their donkeys, whatever was in the city and whatever was in the field—they took [plundered].

29 and all their wealth, and all their little ones and their wives took they captive, and despoiled even all that was in the house. — and spoiled even all that was in the house; of Shechem or Hamor, or in any of the houses of the inhabitants; they rifled and plundered everyone, and took away whatsoever they found;

— the Targum Onkelos says

All their wealth, all their children, and their wives—they took captive, and plundered—including everything in the houses.

30 And Jacob said to Simeon and Levi, “Ye have troubled me to make me a stench among the inhabitants of the land, among the Canaanites and the Perizzites. And I being few in number, they shall gather themselves together against me and slay me; and I shall be destroyed, I and my house.”

— amongst the Canaanites and the Perizzites; and I being few in number; or men of number; he and his sons and servants, in all, making but a small number in comparison of the nations about him:

— they shall slay me: he could expect no other in human reason, and they were hindered from so doing only by the hand of the great God smiting them with terror, Genesis 35:5

— the Targum Onkelos says

Yaakov said to Shimon and Leivi, You have made trouble for me, making me obnoxious to [putting hatred between us and] the inhabitants of the land, the Canaanites and the Perizzites. [Since] I am few in number, they will gather together and attack me. I and my house [family] will be destroyed.

31 And they said, “Should he deal with our sister as with a harlot?” — should he deal with our sister as with an harlot? make a whore of her, and then keep her in his house as such?

— the Targum Onkelos says

They said, Should he make our sister [be treated] into a harlot [like one who goes outside]?

— the Targum of Jonathan says:

“Simeon and Levi answered: ‘It is not fitting that it should be said in the assemblies of Israel: Uncircumcised men defiled a virgin, and idol-worshippers polluted the daughter of Jacob.

“Rather, let it be said thus: Uncircumcised men were slain because of a virgin, and idol-worshippers because of the daughter of Jacob! Let not Shechem the son of Hamor mock us in his words, saying: “Like a straying woman, this girl went out; she has no one to avenge her.”

“Shall he treat our sister [as a harlot] if we had not done this thing?'”

Escalating from Suez to Waterloo

•April 7, 2026 • Leave a Comment

UnzReview • April, 5, 2026

When Israel and the US launched their war on Iran, they claimed it would last a few days. A few days later, they said it would last 3 to 4 weeks. As the fourth week ends, it is a good time to take stock of what has happened and the war’s scoreboard, and the political and economic implications.

Military matters are unpredictable, and everything can change quickly in battlefields, so this analysis is tentative, but there are clear changes in the facts on the ground so far that indicate the US has suffered a significant setback with important ramifications, and if the US chooses to double down, it may exacerbate it, with momentous political, economic, and military implications for the Middle East, the US, and the world at large.

A massive global economic crisis might unfold, the presence of the US in the Middle East is in serious danger, the US Empire may be in its death throes, the fiscal fate of the US hangs in the balance, and the world may finally be free of dollar slavery.

Militarily and technologically, this might go down in history as a decisive turning point in which a twentieth-century superpower was defeated by a twenty-first-century medium power, which used newer technology at ~1% of the cost.

Drones and hypersonic missiles that defeat aircraft carriers, jet fighters, tanks, and other twentieth-century relics remind us of small gun-wielding armies defeating larger armies carrying swords.

What is remarkable about this war is the disconnect between the real-world battlefield outcomes and the public understanding of what is happening.

Over the past few decades, American military dominance has been so complete, and its opponents so mismatched, that Americans seem no longer capable of even conceiving of defeat, and cannot recognize it even as it stares them down.

In America’s other recent conflicts, the range of outcomes was almost entirely determined by inter-American politics, with the opponent a passive subject.

‘Defeat’ simply referred to the other country failing to fully adopt the form of government and social customs that America sought to impose; it did not mean the failure to achieve military and strategic objectives, as American soldiers conquered Kabul and Baghdad in a matter of weeks.

But in Iran, we have so far had a remarkable American failure to achieve strategic objectives, and the option of escalating to achieve these objectives threatens dire consequences.

The best and, perhaps, only possible option left: Ground Troops.

If so, is this an escalation from Suez to Waterloo? Or is this another Vietnam, Iraq, or Afghanistan?

Woe to the crown of pride, to the drunkards of Ephraim, whose glorious beauty is a fading flower, which is on the head of the fat valleys of them that are overcome with wine! Isaiah 28:1

For more, see (1) The Birthrights (2) Ephraim and Manasseh (3) Ephraim as the Thirteenth Tribe (4) Who is this lying Ephraim? (5) The Ox with horns of a Unicorn

Iran war is ‘the end of American empire’ – Tucker Carlson

•April 6, 2026 • Leave a Comment

The US is unable to restore order in the Strait of Hormuz, casting doubt on its role as a global policeman, the conservative host has said

“We can’t open the Straits of Hormuz,” Carlson said. “But it’s not the end of the United States.”

RT World News • April 5, 2026 ~ Pravda

The Iran war has ushered in the “end of American Empire,” conservative host Tucker Carlson has argued, suggesting that US President Donald Trump’s call for allies to secure the Strait of Hormuz proved that Washington could no longer function as the world’s policeman.

Speaking on his podcast on Thursday, Carlson commented on Trump’s remarks in which the president threatened to bomb Iran into the “stone age” without providing an exact timeline for a ceasefire while urging other countries to “take the lead” in unblocking the Strait of Hormuz – a strategic chokepoint which accounts for around 20% of global oil trade.

Washington’s NATO allies, however, have been reluctant to step in following US-Israeli strikes on Iran.

Carlson argued that “the nation that forces the peace is the nation in charge,” adding that “the country that forces order on the Persian Gulf, that opens the Strait of Hormuz, is the nation that runs the world by definition.”

For decades since WWII, the nation capable of maintaining order was assumed to be the US, but the Hormuz crisis has shown it’s no longer the case, the journalist continued. “We can’t open the Straits of Hormuz,” Carlson said. “The President of the United States said that last night – someone else do it. So we’re done.”

He argued that even if the US were to completely destroy Iran as a cohesive nation, the remaining warlords would have no difficulties in disrupting the maritime route by laying mines, using cheap drones, or even just by threatening to do so, meaning that the hostilities would have to end in a diplomatic settlement with Tehran sooner or later.

”What’s happening in Iran is the end of American empire as we understand it. And that’s sad. Empire’s dying. But it’s not the end of the United States,” he added.

Carlson acknowledged that the transition would bring “a lot of suffering and sadness,” but noted that it also carried the promise of a US that could turn its attention to the Western hemisphere, also rich in resources and vital for America’s stability, without the need to occupy “countries you’ve never been to.”

Carlson, generally supportive of Trump, has been a vocal critic of US-Israeli strikes on Iran, prompting the US president to claim that the journalist “has lost his way” and is not really part of the MAGA movement.

~~~

But in Iran, we have so far had a remarkable American failure to achieve strategic objectives, and the option of escalating to achieve these objectives threatens dire consequences.

The best and, perhaps, only possible option left: Ground Troops.

If so, is this an escalation from Suez to Waterloo? Or is this another Vietnam, Iraq, or Afghanistan?

Woe to the crown of pride, to the drunkards of Ephraim, whose glorious beauty is a fading flower, which is on the head of the fat valleys of them that are overcome with wine! Isaiah 28:1

For more, see (1) The Birthrights (2) Ephraim and Manasseh (3) Ephraim as the Thirteenth Tribe (4) Who is this lying Ephraim? (5) The Ox with horns of a Unicorn

Genesis (31-32)

•April 6, 2026 • Leave a Comment

After Jacob had stolen his birthright, Esau pleaded with Isaac his father if he could still bless him.

Then Isaac his father answered and prophesied, saying, “Thy dwelling shall be away from the fatness of the earth; and away from the dew of heaven above; Genesis 27:39

“And by your sword shall you live, you will go to every place, and wander, and you will be subject to your brother. But when his descendants abandon the commandments of the Torah, then you will break his yoke from your neck.”

“And Esau harbored hatred in his heart against Jacob, his brother, because of the blessing with which his father had blessed him. And Esau said in his heart, ‘I will not do as Cain did, who killed Abel during their father’s lifetime and then their father had another son, Seth. Rather, I will wait until the days of mourning for my father have passed, and then I will kill Jacob my brother, and I will be the sole heir.’” Genesis 27:41-42 Targum (Jonathan)

This is looking at the Scriptures with a blast of fresh air, because the deeper you dig, the more you’ll find!

“The anger of the Lord shall not return, until He has executed and until He has performed the intent of His thought; in the latter days ye shall understand it perfectly.” Jeremiah 23:20

Genesis 31

1 And he heard the words of Laban’s sons, saying, “Jacob hath taken away all that was our father’s; and from that which was our father’s hath he gotten all this glory.”

— their complaining word “glory” suggests that, enriched by cattle and commerce, Jacob had now become a person of great importance in the eyes of the people of Haran;

— the Targum Onkelos says

He [Yaakov] heard the words of Lavan’s sons [who were] saying, Yaakov has taken all that belonged to our father. From that which was our father’s, he made [acquired] all this wealth [these possessions].

— as the Targum of Jonathan says, by which he got the name and glory for himsel of these riches among men: and it was so far true what they say, that it was out of their father’s flock that Jacob got all his increase;

And Jacob beheld the countenance of Laban, and behold, it was not toward him as before. — and, behold, it was not as peaceful as before;

— he said nothing to Jacob, nor charged him with robbing of him, or any false dealing with him, yet was uneasy at his growing prosperity; he put on sour looks, and an envious countenance, sad, and surly, and lowering;

— the Targum Onkelos says

Yaakov saw [the expression of] Lavan’s face [demeanor] and it was not toward him as it was before.

And the Lord said unto Jacob, “Return unto the land of thy fathers and to thy kindred, and I will be with thee.” — the Lord said unto Jacob; in answer tohsi prayer, perhaps; or seeing what difficulties and discouragements Jacob laboured under, he appeared unto him for his encouragement and instruction how to proceed;

— the Targum Onkelos says

Adonoy said to Yaakov, Return to the land of your fathers and to your birthplace, and I will be with you [My Word will be your support].

And Jacob sent and called Rachel and Leah to the field unto his flock, — and Jacob sent; having this encouragement and direction from the Lord, which seems while he was attending his flocks, he dispatched a messenger home to his wives, one of his servants or under shepherds;

— the Targum Onkelos says

Yaakov sent and called Rochel and Leah to [come to] the field, to his flock.

— the Targum of Jonathan says it was his son Naphtali, of Rachels’ maid, Bilhah, whom he sent, because he was a swift messenger;

and said unto them, “I see your father’s countenance, that it is not toward me as before; but the God of my father hath been with me. — his father-in-law’s countenance are becoming not peaceful;

— but the God of my father hath been with me; not only supported him under all his troubles; but by his good providence prospering him in his affairs, as well as he had lately appeared to him, and encouraged him to return to his own country;

— the Targum Onkelos says

He said to them, I saw [the expression of] your father’s face; it is not toward me as it was before, but the God of my father was with me [my support].

And ye know that with all my power I have served your father. — and ye know, that with all my power I have served your father; with all faithfulness and uprightness;

— with all diligence and industry; with all wisdom and prudence; and sparing no pains by day or night to take care of his flocks, and increase his substance;

— the Targum Onkelos says

You know that I served your father with all my strength.

Speckle

And your father hath deceived me, and changed my wages ten times, but God did not suffer him to hurt me. — hath changed my wages ten times; that is, oft-times, as is often the signification of the number ten;

— the Targum Onkelos says

Your father cheated me and changed my wage ten countings; but Elohim did not let him harm me.

If he said thus: ‘The speckled shall be thy wages,’ then all the animals bore speckled; and if he said thus: ‘The ringstreaked shall be thy hire,’ then all the animals bore ringstreaked.

— the ring-straked shall be thy hire; hence it appears that Laban through envy and covetousness did break his agreement made with Jacob, and altered it as he thought meet, and that Jacob patiently yielded to all such changes;

— the Targum Onkelos says

If he would say, The speckled will be your wage, then all the flock [sheep] gave birth to speckled ones. If he would say, Ringed ones will be your wage, all the flock [sheep] gave birth to ringed ones.

Thus God hath taken away the flocks of your father, and given them to me. — Laban’s flock was much lessened by those means, and more were taken away, and came to Jacob’s share;

— the Targum Onkelos says

Thus God delivered [separated] your father’s livestock, and gave it to me.

10 And it came to pass at the time that the animals conceived, that I lifted up mine eyes and saw in a dream, and behold, the rams which leaped upon the animals were ringstreaked, speckled, and grizzled.

— not that the rams in the flock were really of those colours, for they were all white, but so they were represented to Jacob in the vision, to suggest to him, that such would be produced by them;

— the Targum Onkelos says

At the time the flock [sheep] were in heat [to mate], I lifted my eyes, and in a dream I saw that the males [rams] going upon the flock [sheep] were ringed, speckled and striped.

11 And the angel of God spoke unto me in a dream, saying, ‘Jacob!’ And I said, ‘Here am I.’ — saying, Jacob; and I said, here am I; the angel called him by his name, to which he answered, and signified that he was ready to attend to whatsoever he should say to him;

— the Targum Onkelos says

An angel of Elohim said to me in a dream, Yaakov, and I said, Here I am.

12 And he said, ‘Lift up now thine eyes and see: all the rams which leap upon the animals are ringstreaked, speckled, and grizzled; for I have seen all that Laban doeth unto thee. — and the angel said, for I have seen all that Laban doeth to thee;

— the Targum Onkelos says

He said, Lift up your eyes [now] and see, all the males [rams] going up on the flock [sheep] are ringed, speckled, and striped; for I have seen all that Lavan is doing to you [is revealed before Me].

13 I am the God of Bethel, where thou anointed the pillar, and where thou vowed a vow unto Me. Now arise, get thee out from this land, and return unto the land of thy kindred.’” — I am the God of Bethel; the same Angel that appeared to Jacob in a dream, the God of Bethel; hence this ‘angel’ is the Son of God;

— the Targum Onkelos says

I am the Almighty of Elohim who appeared to you in Beis Eil, where you anointed a monument, where you made a vow to [before] Me. Now arise and leave this land, and return to the land of your birthplace.

14 And Rachel and Leah answered and said unto him, “Is there yet any portion or inheritance for us in our father’s house? — having heard his views, Rachel and Leah answered; they expressed their entire approval;

— the Targum Onkelos says

Rochel and Leah replied and said to him, Do we still have a portion and an inheritance in our father’s house?

15 Are we not counted by him strangers? For he hath sold us, and hath quite devoured also our money. — are we not confuted of him strangers? as if we had no more right to his estate than strangers? instead of a good part of his estate, which by the law of God and nature belongs to us;

— the Targum Onkelos says

Are we not considered by him as strangers? For he has sold us, and has completely consumed our money.

16 For all the riches which God hath taken from our father, that is ours and our children’s. Now then, whatsoever God hath said unto thee, do.”

— now then, whatsoever God hath said unto thee, do; this was well spoken indeed; they mean, that he should leave their father’s house, and go into the land of Canaan, as God had directed him;

— the Targum Onkelos says

All the wealth that Elohim rescued [separated] from our father belongs to us and our children. Now, whatever God has said to you, do it.

17 Then Jacob rose up, and set his sons and his wives upon camels. — then Jacob rose up; and went with them to Laban’s house, where his children were, as is plain from Rachel’s theft, Genesis 31:19

— the Targum Onkelos says

Yaakov rose and lifted his sons and his wives upon the camels.

18 And he carried away all his flocks and all his goods which he had gotten, the flocks of his getting which he had gotten in Padanaram, to go to Isaac his father in the land of Canaan.

— for to go to Isaac his father in the land of Canaan; but staying at several places by the way. No mention is made of his mother Rebekah, she perhaps being now dead;

— the Targum Onkelos says

He led away all his livestock, and all his possessions that he had acquired, which he had purchased with his own livestock that he had acquired in Padan Aram, [in order] to come to Yitzchok, his father, to the land of Canaan.

19 And Laban went to shear his sheep; and Rachel had stolen the images that were her father’s. — images; images of angels, teraphim, called Laban’s gods in Genesis 31:30, which he made use of in an idolatrous and superstitious manner;

— Rachel had a lingering attachment to those idols of her family, and secretly carried them away as relics of a home she was to visit no more; and we find that such idolatry worship continued throughout their pre-Babylonian history;

— when we read of Rachel’s stealing her father’s images, what a scene of the family of Nahor, and even Terah, his father, who left the idolatrous Chaldees; is not this family itself had been tainted or even deeply idolatrous? Until the days they were purified during the Babylonian captivity;

— the Targum Onkelos says

Lavan [meanwhile] had gone to shear his flock [sheep], and Rochel stole [hid] the idols that belonged to her father.

— the Targum of Jnathan says

And Laban had gone to shear his flock; and Rahel stole the images. For they had slain a man, a firstborn, and had cut off his head; they salted it with salt and balsams, and wrote incantations on a plate of gold, and put it under his tongue, and set it up in the wall, and it spake with them; and unto such their father bowed himself.

20 And Jacob stole away unawares to Laban the Syrian, in that he told him not that he fled. — Jacob stole away; he thought the prudence and necessity of departing secretly; otherwise, Laban might have detained him by violence or artifice if he waited;

— the Targum Onkelos says

Yaakov fooled [concealed his intentions from the heart of] Lavan, the Aramean, by not telling him that he had fled [gone].

21 So he fled with all that he had; and he rose up and passed over the river, and set his face toward the mount of Gilead. — and he rose up, and passed over the river; the river Euphrates, as the Targum of Jonathan expresses it, which lay between Mesopotamia and Canaan;

— and set his face toward Mount Gilead: this, was a mountain on the border of the land of Canaan, adjoining to Lebanon, near which was a very fruitful country, which had its name from it;

— the Targum Onkelos says

He fled [went] with all that he possessed. He set out and crossed the river [P’ras], setting out in the direction of Mount Gilod.

22 And it was told Laban on the third day that Jacob had fled. — and it was told Laban on the third day, that Jacob was fled; three days after Jacob was gone he had the report to him;

— the Targum Onkelos says

Lavan was told on the third day that Yaakov had fled [gone].

— the Targum of Jonathan adds more concerning Jacob’s blessings while living there:

But after Jakob had gone, the shepherds went to the well, but found no water; and they waited three days, if that it might (again) overflow; but it overflowed not; and then came they to Laban on the third day, and he knew that Jakob had fled; because through his righteousness it had flowed twenty years.

23 And he took his brethren with him, and pursued after him seven days’ journey; and they overtook him on the mount of Gilead. — seven days’ journey; the route chosen by Jacob was apparently the more easterly one, past Damascus to the west; the hill, which subsequently was called Mount Gilead, lay to the south of the Jabbok;

— the Targum Onkelos says

He took his brothers [kinsmen] with him, and pursued him a distance of seven days. He overtook him in Mount Gilod.

24 And God came to Laban the Syrian in a dream by night, and said unto him, “Take heed that thou speak not to Jacob either good or bad.” — God came to Laban and warn him of any altercations, or any use no harsh language with him, which may occasion a quarrel;

— God can put a bridle in the mouth of wicked men, to restrain their malice, though he do not change their hearts. Though they have no love to God’s people, they will pretend to it, and try to make a merit of necessity;

— the Targum Onkelos says

Elohim appeared [The Word came from before Elohim] to Lavan the Aramean, in a dream that night, and said to him, Guard yourself, that you do not speak to Yaakov either good or evil.

— the Targum of Jonathan adds a sword from an angel, warning “Laban the Deceiver”

And there came an angel with a word from before the Lord; and he drew the sword against Laban the Deceiver in a dream of the night, and said to him, Beware lest thou speak with Jakob from good to evil.

25 Then Laban overtook Jacob. Now Jacob had pitched his tent on the mount; and Laban with his brethren pitched on the mount of Gilead. — then Laban overtook Jacob; he was come to the mount overnight, and now in the morning he came nearer to him;

— the Targum Onkelos says

Lavan overtook Yaakov. Yaakov had set up [spread] his tents on the mountain, and Lavan and his brothers had set up [encamped] on Mount Gilod.

26 And Laban said to Jacob, “What hast thou done, that thou hast stolen away unawares to me, and carried away my daughters as captives taken with the sword? — despite being warned by God, Laban still took a hostile approach: What hast thou done?

— the Targum Onkelos says

Lavan said to Yaakov, What have you done? You fooled [hid from] me, and led my daughters away like prisoners of war.

27 Why didst thou flee away secretly, and steal away from me and didst not tell me, that I might have sent thee away with mirth and with songs, with taboret and with harp,

— thou flee away secretly, and steal away from me? but that he had no need to have used such privacy, and go away like a thief by stealth, as if he had done something he had reason to be ashamed of:

— and didst not tell me, that I might have sent thee away with mirth, and with songs, with tabret and with harp: so that he would have given him a pleasant leave to depart;

— the Targum Onkelos says

Why did you flee [go] so stealthily? You robbed [hid from] me and did not tell me. I would have sent you away, with joy and with song, with drum[s] and harp[s].

28 and hast not suffered me to kiss my sons and my daughters? Thou hast now done foolishly in so doing. — thou hast done foolishly in so doing: since, as he would have him believe that he was both a loser by this step he took;

— and exposed himself foolishly to danger, as Laban has means to do him hurt; but Jacob knew what he did, and that it was the wisest part to follow the direction of God; yet God didn’t direct Jacob to fled in stealth in the night, so to speak, or by stealing his idols in the process;

— the Targum Onkelos says

You did not let me kiss my [grand]sons and daughters. Now see how foolishly you acted.

29 It is in the power of my hand to do you hurt; but the God of your father spoke unto me yesternight, saying, ‘Take thou heed that thou speak not to Jacob either good or bad.’ — the God of your father, Isaac or Abraham, by which Laban seemed to distance himself and disowned him for his God;

— speak not to Jacob either good or bad; this, though greatly to Jacob’s honour, and against Laban’s interest, God was warning him of staying out of his business;

— the Targum Onkelos says

It is within the power of my hand to harm you, but the God of your father spoke to me last night saying, Guard yourself not to speak to Yaakov either good or evil.

30 And now, though thou wouldest be gone, because thou sorely longed after thy father’s house, yet why hast thou stolen my gods?”

— yet, wherefore, hast thou stolen my gods? what reason had he for that? if he took away himself, his wives, his children, his goods, what business had he with his gods? 

— thou stolen my gods? teraphim, small images of human figures, used as idols or objects of worship, and as talismans, for superstitious purposes;

— the Targum Onkelos says

Now you have gone for you yearned for your father’s house, but why did you steal [take] my gods?

31 And Jacob answered and said to Laban, “Because I was afraid; for I said, ‘Perhaps thou wouldest take by force thy daughters from me.’

— Jacob answered; he gives the true reason for his flight: thou wouldest take by force thy daughters from me; which of right belonged to him; for though they were Laban’s daughters, they were Jacob’s wives;

— after which, indignant at the charge of theft, he returns, in his anger, as rash an answer about the teraphim as Joseph’s brethren a generation later did about the stolen cup;

— the Targum Onkelos says

Yaakov replied and said to Lavan, Because I was afraid, for I said you might forcibly take your daughters from me.

32 With whomsoever thou findest thy gods, let him not live. Before our brethren, discern thou what is thine with me, and take it with thee.” For Jacob knew not that Rachel had stolen them. — real foolish for Jacob to say this: “thou findest thy gods, let him not live”

— for Jacob knew not that Rachel had stolen them; the images or gods; or he would have been more careful of his expression, in love and tenderness to his most beloved wife;

— the Targum Onkelos says

With whomsoever you find your gods, he shall not live. In the presence of our brethren, identify anything belonging to you that is here with me and take it back with you. Yaakov did not know that Rochel had stolen [taken] them.

— the Targum of Jonathan says

“With whomsoever thou shalt find the images of thy idols, let him die before his time. Before all our brethren take knowledge of what with me is thine, and take it. But Jakob knew not that Rahel had stolen them.”

33 And Laban went into Jacob’s tent, and into Leah’s tent, and into the two maidservants’ tents, but he found them not. Then went he out of Leah’s tent, and entered into Rachel’s tent.

— and Laban went into Jacob’s tent; into that first where he most suspected they were, being taken not out of value for them, but contempt of them;

— and into Leah’s tent; and not Leah’s tent next, whom next to Jacob he might suspect of taking them, out of veneration to them, because her tent lay next: and into the two maidservants’ tents: Bilhah and Zilpah; but he found them not; in neither of these tents:

— the Targum Onkelos says

Lavan came into Yaakov’s tent, and into Leah’s tent, and into the tents of the two handmaids [concubines], but he found nothing. He left Leah’s tent and came into Rochel’s tent.

34 Now Rachel had taken the images, and put them in the camel’s saddle and sat upon them. And Laban searched all the tent, but found them not.

— then went he out of Leah’s tent, and entered into Rachel’s tent; which he went into last of all, the least suspecting of her, but covertly more addicted to the superstition and idolatry of his family than Leah and the maidservants;

— the Targum Onkelos says

Rochel had taken the idols, and placed them in the camel’s saddle-pillow, and sat upon them. Lavan searched the whole tent and found nothing.

35 And she said to her father, “Let it not displease my lord that I cannot rise up before thee, for the custom of women is upon me.” And he searched, but found not the images.

— Rachel pleads the custom of women as an excuse for keeping her seat; either of ceremonial defilement; or she was already pregnant with Benjamin;

— but found not the images; and so left off searching; nor do we find that he searched the flock for any of his cattle there, knowing full well Jacob’s “honesty and integrity.”

— the Targum Onkelos indicates her pregnancy, saying

She said to her father, Let there not be anger in the eyes of my master that I cannot rise before you, for the way of women is upon me. He searched but did not find the idols.

36 And Jacob was wroth, and chided Laban; and Jacob answered and said to Laban, “What is my trespass? What is my sin, that thou hast so hotly pursued after me?

— Jacob was wroth; naturally he regarded the accusation about the teraphim as a mere device for searching his goods, and when nothing was found gave free vent to his indignation;

— having answered Laban’s questions to the silencing of him, and nothing of his upon search, being found with him, Jacob took heart, and was of good courage and in high spirits, and in his turn was heated also;

— what is my trespass? what is my sin? what heinous offence have I committed? what law of God or man have I broke? that thou hast so hotly pursued after me? with so much haste and swiftness, and with such a number of men, as if he came to take a thief, a robber, or a murderer;

— the Targum Onkelos says

Yaakov was angry and he argued with Lavan. Yaakov replied and said to Lavan, What is my crime? What sin did I commit that you were in such hot pursuit of me?

37 Whereas thou hast searched all my goods, what hast thou found of all thy household things? Set it here before my brethren and thy brethren, that they may judge between us both.

— set it here before my brethren and thy brethren; publicly before them all, and let it be thoroughly inquired into whose property it was, and whether lawfully taken or not;

— the Targum Onkelos says

When you searched all my goods, what did you find of all your household goods? Place it here in the presence of my brethren and your brethren, and let them decide between the two of us.

38 These twenty years have I been with thee; thy ewes and thy shegoats have not cast their young, and the rams of thy flock have I not eaten. — in the twenty years I’ve worked for you, ewes and she-goats never miscarried; neither have  I feasted on the rams from your flock;

— the Targum Onkelos says

These twenty years that I was with you, your ewes and she-goats never miscarried, and I did not eat any rams of your flocks.

39 That which was torn by beasts I brought not unto thee; I bore the loss of it. From my hand didst thou require it, whether stolen by day or stolen by night.

— that which was torn of beasts I brought not unto thee; the shepherds are strictly responsible for losses in the flock, unless they can prove these were occasioned by wild beasts;

— the Targum Onkelos says

I never brought you a mutilated animal. I will take the blame for it. You demanded compensation from my hand whether [an animal] was stolen from me by day or whether it was stolen from me by night. [You demanded compensation from me for that which was missing from the total. I guarded by day and I guarded by night.]

40 Thus I was: in the day the drought consumed me, and the frost by night, and my sleep departed from mine eyes. — all the blessings because it was through my extraordinary thoughtfulness and care about thy cattle, especially in cases of danger;

— the Targum Onkelos says

I was consumed by the burning heat by day and ice [frost came down upon me] at night. My sleep was taken from my eyes.

41 Thus have I been twenty years in thy house. I served thee fourteen years for thy two daughters, and six years for thy flocks; and thou hast changed my wages ten times.

— and six years for thy cattle, to have as many of them for his hire, as were produced from a flock of white sheep, that were speckled, spotted, or ringstraked, or brown;

— the Targum Onkelos says

These twenty years that I have been in your house, I served you fourteen years for your two daughters, and six years for your sheep, but you changed my wages ten times.

42 Unless the God of my father, the God of Abraham and the fear of Isaac, had been with me, surely thou would have sent me away now empty. God hath seen mine affliction and the labor of my hands, and rebuked thee yesternight.”

— and rebuked thee yesternight; in a dream, charging him to say neither good nor evil to Jacob, which he himself had confessed;

— the Targum Onkelos says

Had not the God of my father, the God of Avraham and the Fear of Yitzchok been with me [my support], you would have sent me away empty-handed. My misery [toil] and the labor [weariness] of my hands was seen by [revealed before] Elohim, and He reprimanded you last night.

43 And Laban answered and said unto Jacob, “These daughters are my daughters, and these children are my children, and these flocks are my flocks, and all that thou seest is mine. And what can I do this day unto these my daughters, or unto their children whom they have borne?

— though Laban does not attempt any reply to Jacob’s angry invectives, he answers affectionately; but offers a compromise;

— the Targum Onkelos says

Lavan replied and said to Yaakov, The daughters are my daughters, and the sons are my sons, and the[se] flocks are my flocks. All that you see is mine. What can I do unto these, my daughters, today, or to their children that they have born.

44 Now therefore come thou, let us make a covenant, I and thou; and let it be a witness between me and thee.” — a covenant; that all past differences and quarrels subside, and that for the future peace and good will subsist; of which a covenant made between them would be a testimony;

— the Targum Onkelos says

Now come [therefore] let us make a pact, I and you. Let Him be witness between me and you.

45 And Jacob took a stone and set it up as a pillar.

— the Targum Onkelos says

Yaakov took a boulder and raised it as a monument.

46 And Jacob said unto his brethren, “Gather stones”; and they took stones and made a heap, and they ate there upon the heap.

— Jacob set it up for a pillar, to show his readiness to agree to the motion, he immediately took a large stone that lay upon the mount, to be a standing monument of the agreement now about to be made between them;

— the Targum Onkelos says

Yaakov said to his brethren, Gather stones. They took stones and made a mound, and they ate on the mound.

47 And Laban called it Jegarsahadutha [that is, The heap of witness], but Jacob called it Galeed. — but Jacob called it Galeed; which in the Hebrew tongue signifies “an heap of witness” or an heap, the witness;

— the Targum Onkelos says

Lavan called it Yegar Sohadusa, but Yaakov called it Galeid.

48 And Laban said, “This heap is a witness between me and thee this day.” Therefore was the name of it called Galeed,

— the Targum Onkelos says

Lavan said, This mound is witness between me and you this day. He therefore called its name Galeid.

49 and Mizpah [that is, A beacon or watchtower]; for he said, “The Lord watch between me and thee when we are absent one from another. — and Mizpah; which being an Hebrew word, it looks as if the heap had also this name given it by Jacob, which signifies a “watch” or “watchtower”

— the Targum Onkelos says

And [he also called it] Mitzpah [Watchtower] because he said, [The Word of] Adonoy will watch between me and you, when we are concealed from each other[’s sight].

50 If thou shalt afflict my daughters, or if thou shalt take other wives besides my daughters, no man is with us—see, God is witness between me and thee!”

— if thou shall afflict my daughters; in body or mind, by giving them hard blows, or ill words, and by withholding from them the necessaries of life, food and raiment, and the like;

— or if thou shall take other wives besides my daughters; which also would be an affliction and vexation to them; Laban, though he had led Jacob into polygamy, and even obliged him to it, did not choose he should go further into it;

— the Targum Onkelos says

If you afflict my daughters, or marry other wives in addition to my daughters, there may be no man with us, but see, [the Word of] Elohim is witness between me and you.

51 And Laban said to Jacob, “Behold this heap and behold this pillar, which I have cast between me and thee.

— the Targum Onkelos says

Lavan said to Yaakov, Here is this mound, and here is this monument that I have cast [established] between me and you.

52 This heap is a witness, and this pillar is a witness, that I will not pass beyond this heap to thee, and that thou shalt not pass beyond this heap and this pillar unto me, for harm.

— the Targum Onkelos says

This mound is witness, and the monument is witness, that I will not cross over to you beyond this mound; and you are not to cross over to me beyond this mound and this monument for harmful purposes.

53 The God of Abraham, and the God of Nahor, the God of their father, judge between us.” And Jacob swore by the fear of his father Isaac. — the God of Abraham, and the God of Nahor, the God of their father, judge between us; and the father of these was Terah;

— so that the god of them was not the true God, and is not meant, at least not as truly worshipped; but the god or gods of Terah and Nahor worshipped while idolaters, and Laban still continued to do; but Jacob swore by the fear of his father Isaac; that is, by the true God his father Isaac feared, served, and worshipped;

— the Targum Onkelos says

The God of Avraham and the god of Nachor, the god of their fathers will judge between us. Yaakov swore by the Fear of his father, Yitzchok [He who Yitchok his father feared].

54 Then Jacob offered sacrifice upon the mount, and called his brethren to eat bread; and they ate bread, and tarried all night on the mount. — Jacob offered sacrifice; the meaning is, that Jacob slaughtered cattle, and made a feast after offering sacrifices;

— the Targum Onkelos says

Yaakov slaughtered animals on the mountain, and invited his brethren to eat bread [a meal]. They ate bread and spent the night on the mountain.

55 And early in the morning Laban rose up, and kissed his sons and his daughters and blessed them. And Laban departed, and returned unto his place. — and kissed his sons and his daughters; Jacob and his sons, who were his grandsons;

— and his daughters Rachel and Leah, with Dinah his granddaughter, as was the custom of relations and friends in those countries and times, at parting: and blessed them; wished all happiness to them;

— the Targum Onkelos says

Lavan rose early in the morning. He kissed his sons and daughters and blessed them. Lavan departed and returned to his place.

Genesis 32

1 And Jacob went on his way, and the angels of God met him. — the angels (plural) appear in warlike guise as they were seen by Jacob; but were the “messengers of Elohim,”

— the Targum Onkelos says

Yaakov went on his way, and the angels of Elohim met him.

And when Jacob saw them, he said, “This is God’s host.” And he called the name of that place Mahanaim [that is, Two hosts or camps].

— he said, this is God’s host: or army, hence he is often called the Lord of hosts; angels have this name from their number, order, strength, and military exploits they perform;

— the Targum Onkelos says

When Yaakov saw them, he said, This is Elohim’s camp. [This is a camp from before Elohim.] He named the place Machanayim.

— the Targum of Jonathan says

And Jakob said when he saw them, These are not the host of Esau who are coming to meet me, nor the host of Laban, who have returned from pursuing me; but they are the host of the holy angels who are sent from before the Lord. Therefore the name of that place he called, in the language of the sanctuary, Machanaim.

And Jacob sent messengers before him to Esau his brother unto the land of Seir, the country of Edom. — as they approached the eastern confines of Canaan, Jacob sent messengers before him to Esau;

— it was a prudent precaution to ascertain the present temper of Esau, lay near the wild district where his brother was now established; land of Seir, a highland country on the east and south of the Dead Sea;

— the Targum Onkelos says

Yaakov sent messengers before him to Eisov, his brother, to the Land of Seir, to the field of Edom.

And he commanded them, saying, “Thus shall ye speak unto my lord Esau, ‘Thy servant Jacob saith thus: I have sojourned with Laban and stayed there until now,

— speak unto my lord Esau; Jacob calls Esau his lord, and himself his servant, to indicate that he did not insist on the prerogatives of the birthright and blessing which he had obtained for himself;

— thy servant Jacob saith thus, expressing great humility and modesty; for though his father not being yet dead; and besides, was to have its accomplishment not in his own person, but in his posterity;

— the Targum Onkelos says

He commanded them saying, This is what you should say to my master, Eisov. Your servant, Yaakov says, I lived as a stranger with Lavan, and was delayed until now.

and I have oxen and asses, flocks and menservants and womenservants; and I have sent to tell my lord, that I may find grace in thy sight.’”

— and I have oxen, and asses, flocks, and menservants, and womenservants; this he would have said, lest he should think he was come to ask anything of him, and put himself and his family upon him; and lest he should treat him with contempt;

— and I have sent to tell my lord; of his coming: that I may find grace in thy sight; share in his good will, which was all he wanted, and that friendship, harmony, and brotherly love, might subsist between them, which he was very desirous of;

— the Targum Onkelos says

I acquired oxen, donkeys, sheep, servants and maidservants. I have sent [these messengers] to tell my master, to find favor in your eyes.

And the messengers returned to Jacob, saying, “We came to thy brother Esau, and also he cometh to meet thee, and four hundred men with him.” — he cometh to meet thee, and four hundred men with him; he is now weary of waiting for the days of mourning for his father, and before they come resolves to slay thee;

— the Targum Onkelos says

The messengers returned to Yaakov saying, We came to your brother, to Eisov, and he is also coming to meet you; and there are four hundred men with him.

— the Targums of Jonathan and Jerusalem call these four hundred chiefs or warriors;

Then Jacob was greatly afraid and distressed; and he divided the people who were with him, and the flocks and herds and the camels into two bands. — conscious how deeply he had offended his brother, Jacob became greatly afraid and distressed;

— and he divided the people that was with him, and the flocks, herds, and camels, into two bands: some of his servants and shepherds, with a part of the flocks and herds, in one band, and some with the rest of them, and the camels, and his wives, and his children, in the other;

— the Targum Onkelos says

Yaakov was very frightened, and distressed. He divided the people that were with him, along with the sheep, cattle and camels, into two camps.

And he said, “If Esau come to the one company and smite it, then the other company which is left shall escape.”

— and said, if Esau come to the one company, and smite it; the first, which perhaps consisted only of servants, with a part of his cattle; so that if Esau should come in an hostile manner, and fall upon that, and slay the servants, and take the cattle as a booty;

— then the other company which is left shall escape; by flight, in which most probably were he himself, his wives and children, and the camels to carry them off who would have notice by what should happen to the first band;

— the Targum Onkelos says

He said, If Eisov comes to one camp and attacks it, the remaining camp will survive.

And Jacob said, “O God of my father Abraham and God of my father Isaac, the Lord who saidst unto me, ‘Return unto thy country and to thy kindred, and I will deal well with thee’

— and in this distress Jacob does not consult the teraphim Rachel had taken from her father; nor does he call upon the hosts of angels that had just appeared to him, but to God only, the God of his fathers;

— the Lord which saidst unto me, return unto thy country, and to thy kindred; the same God had appeared to him, when in Laban’s house, and bid him return to his own country, and I will deal well with thee: bestow good things on thee;

— the Targum Onkelos says

Yaakov said, God of my father Avraham, and God of my father Yitzchok, Adonoy Who said to me, Return to your land, to your birthplace, and I will do good with you.

10 I am not worthy of the least of all the mercies and of all the truth which Thou hast shown unto Thy servant; for with my staff I passed over this Jordan, and now I have become two bands. — I am not worthy; it is a surprising plea:

— one would think he should have pleaded that what was now in danger was his own against all the world, and that he had earned it dear enough; no, he pleads, Lord, I am not worthy of it. Of the least of all thy mercies;

— the Targum Onkelos says

I am unworthy [My merits are few] because of all the kindness and of all the faithfulness [goodness] that you have done with Your servant; for I crossed over this Jordan [only] with my staff [alone], and now I have become two camps.

11 Deliver me, I pray Thee, from the hand of my brother, from the hand of Esau; for I fear him, lest he will come and smite me and the mother with the children. — for I fear him; the fear that quickens prayer is itself pleadable. It was not a robber, but a murderer that he was afraid of:

— but the mothers’, and the children’s; thou said, I will surely do thee good; God’s promises, as they are the surest guide of our prayer, and furnish us with the best petitions; so they are the firmest ground of our hopes, and furnish us with the best pleas;

— the Targum Onkelos says

Rescue me, I pray [now], from the hand of my brother, from the hand of Eisov, for I fear him, that he will come and attack me—mother and children alike.

12 And Thou saidst, ‘I will surely do thee good, and make thy seed as the sand of the sea, which cannot be numbered for multitude.’” — Jacob draws an argument for a special preservation of him and his family, he was now pleading for; and the rather he might hope to succeed;

— the Targum Onkelos says

You have said, I will do very good with you, and I will make your offspring [many] like the sands of the sea, which are too numerous to count.

13 And he lodged there that same night, and took from that which came to his hand a present for Esau his brother: — in order to pacify him, the present of Jacob consisted of five hundred fifty head of cattle, of different kinds, such as would be most prized by Esau;

— the Targum Onkelos says

He spent that night there. He took from that which comes into his hand, [for] a present to his brother, Eisov.

14 two hundred shegoats and twenty hegoats, two hundred ewes and twenty rams,

— the Targum Onkelos says

Two hundred female goats and twenty male goats, two hundred ewes and twenty rams.

15 thirty milk camels with their colts, forty cows and ten bulls, twenty sheasses and ten foals.

— the Targum Onkelos says

Thirty nursing camels and their young, forty cows and ten bulls, twenty female donkeys and ten male donkeys.

16 And he delivered them into the hand of his servants, every drove by itself, and said unto his servants, “Pass over before me, and put a space between drove and drove.” — and put a space between drove and drove; his meaning is, that they should not follow each other closely;

— but that there should be a considerable distance between them: his view in this was, partly to prolong time, Esau stopping, as he supposed he would, at each drove, and asking questions of the men; and partly that he might the better and more distinctly observe the largeness of his present;

— the Targum Onkelos says

He placed them in the hand of his servants, each herd by itself. He said to his servants, Pass on ahead of me, and keep a space between each herd.

17 And he commanded the foremost, saying, “When Esau my brother meeteth thee and asketh thee, saying, ‘Whose art thou? And whither goest thou? And whose are these before thee?’

— the Targum Onkelos says

He commanded the first one, saying, When my brother, Eisov meets you and asks you saying, To whom do you belong, and where are you going; and who is the owner of this that is before you?

18 then thou shalt say, ‘They are thy servant Jacob’s. It is a present sent unto my lord Esau; and behold also, he is behind us.’”

— the repetition of the announcement of the gift, and they are of “thy servant Jacob’s,” was calculated to appease Esau, and persuade him that Jacob was approaching him in all brotherly confidence and affection;

— and behold also he is behind us: that is, Jacob: this they were bid to tell, lest he should think that Jacob was afraid of him, and was gone another way; but that he was coming to pay a visit to him, and might expect shortly to see him, which would prepare his mind how to behave towards him.

— the Targum Onkelos says

You should [then] say, [They belong] to your servant, Yaakov. It is a present sent to my master, Eisov, and see, he is also [coming] behind us.

19 And so commanded he the second, and the third, and all who followed the droves, saying, “In this manner shall ye speak unto Esau when ye find him.

— saying, on this manner shall you speak to Esau, when you find him; that is, when they met him and perceived it was he that put questions to them;

— the Targum Onkelos says

He also commanded the second and also the third, and to all who followed after the herds, saying, In like manner must you speak to Eisov when you find [meet] him.

20 And say ye moreover, ‘Behold, thy servant Jacob is behind us.’” For he said, “I will appease him with the presents that goeth before me, and afterward I will see his face. Perhaps he will accept me.”

— I will appease him with the present that goeth before me, and afterwards I will see his face: he hoped the present would produce the desired effect; that it would turn away his wrath from him, and pacify him; 

— the Targum Onkelos says

You should also say, See, your servant Yaakov is [coming] behind us. For he said, I will appease him [quieten his anger] with the present that goes before me, and afterwards I will see his face, perhaps he will forgive me.

21 So went the presents over before him, and he himself lodged that night in the company. — Jacob sends a series of presents to Esau, then he himself lodged that night with Esau’s company;

— the Targum Onkelos says

The present passed on ahead of him, but he spent the night in the camp.

22 And he rose up that night, and took his two wives and his two womenservants and his eleven sons, and passed over the ford Jabbok.

— ford Jabbok; now the Zerka, a stream that rises among the mountains of Gilead, and running from east to west, enters the Jordan, about forty miles south of the Sea of Tiberias;

— the Targum Onkelos says

He got up that night and took his two wives, his two handmaids [concubines], and his eleven children, and crossed over the ford of the Yabbok [River].

23 And he took them and sent them over the brook, and sent over what he had. — and he took them, and sent them over the brook; his wives and children, under the care of some of his servants:

— he rose up and took, unable to sleep, Jacob waded the ford in the night time by himself; and having ascertained its safety, he returned to the north bank and sent over his family and attendants, remaining behind, to seek anew, in silent prayer, the divine blessing on the means he had set in motion;

— the Targum Onkelos says

He [then] took them and crossed them over the stream. He [also] brought over all that he possessed.

24 And Jacob was left alone, and there wrestled a man with him until the breaking of the day. — there wrestled a man with him; the eternal Word, or Son of God, who often appeared in a human shape, before he assumed the human nature;

— the Targum Onkelos says

Yaakov remained alone, and a man wrestled with him until daybreak.

— the Targum of Jonathan identifies that the man was angel Michael, but why only ten sons this time, for only Benjamin was not yet born? Seems like Reuben wasn’t counted, but why?

And Jakob remained alone beyond the Jubeka; and an Angel contended with him in the likeness of a man. And he said, Hast thou not promised to give the tenth of all that is thine? And, behold, thou hast ten sons and one daughter: nevertheless thou hast not tithed them.

Immediately he set apart the four firstborn of the four mothers, and there remained eight. And he began to number from Shimeon, and Levi came up for the tenth.

Michael answered and said, Lord of the world, this is Thy lot. And on account of these things he (Michael) remained from God at the torrent till the column of the morning was ascending.

— one possible explanation is that they cannot tithe a firstborn: they already belong to God. The Deduction: Jacob removed the four firstborns (Reuben, Dan, Gad, and Joseph). The Count: of the remaining 8 sons and 1 daughter (9 total), Jacob added the “count” from the previous generation or skipped the firstborns, and Levi became the 10th;

— the moment Levi is identified as the tenth, Michael presents him to God as the “tithe” — the tribe that would later serve in the Tabernacle and Temple. This transforms the wrestling match from a physical brawl into a formal sanctification of the Levites.

25 And when the man saw that he prevailed not against him, he touched the hollow of his thigh; and the hollow of Jacob’s thigh was out of joint as he wrestled with him. — the hollow of Jacob’s thigh was out of joint;

— the Targum Onkelos says

He [the man] saw that he could not defeat him, and he struck the socket [girth] of his hip. [The girth of] Yaakov’s hip joint was dislocated as he wrestled with him.

26 And the man said, “Let me go, for the day breaketh.” And he said, “I will not let thee go, unless thou bless me.” — let me go; the asking of permission to depart was the acknowledgment of defeat;

— the Targum Onkelos says

He [the man] said, Let me go, for the dawn is breaking. He [Yaakov] said, I will not let you go unless you bless me.

— the Targum of Jonathan says

And he said, Let me go, for the column of the morning ascendeth; and the hour cometh when the angels on high offer praise to the Lord of the world: and I am one of the angels of praise, but from the day that the world was created my time to praise hath not come until now. And he said, I will not let thee go, until thou bless me.

27 And he said unto him, “What is thy name?” And he said, “Jacob.” — What is thy name? and he replied, Jacob; that is, a supplanter, as the word signifies;

— the Targum Onkelos says

He [the man] said to him, What is your name? And he replied, Yaakov.

28 And he said, “Thy name shall be called no more Jacob, but Israel; for as a prince hast thou power with God and with men, and hast prevailed.” — Israel signifies a prince or prevailer with God; or a prince of God, that is, a great prince and conqueror;

— the Targum Onkelos says

He [the man] said, No longer will your name be spoken of as Yaakov, but as Yisrael, for you have contended with God[ly beings] [are great before God] and with men, and you have won.

29 And Jacob asked him, and said, “Tell me, I pray thee, thy name.” And he said, “Why is it that thou dost ask after my name?” And he blessed him there. — in much the same manner the angel refuses to tell Manoah his name (Judges 13:18)

— but probably in the blessing which followed there was a clear proof that Jacob’s opponent was a Divine personage, the Son of God;

— the Targum Onkelos says

Yaakov asked him, and said, Please [Now] tell me your name. He said, Why then do you ask my name? He then blessed him [Yaakov] there.

30 And Jacob called the name of the place Peniel [that is, the face of God]: “For I have seen God face to face, and my life is preserved.” — Peniel; that is, the face of God: for I have seen God face to face;

— the Targum Onkelos says

Yaakov named the place Peniel [God’s Face], For I have seen God[ly beings] [Angles of God] face to face, and my soul has survived.

31 And as he passed over Penuel the sun rose upon him, and he limped upon his thigh. — and he limped upon his thigh; he being out of joint, of which he became more sensitive when he came to walk upon it;

— the Targum Onkelos says

The sun shone for him as he passed by Penuel, and he limped due to his hip.

32 Therefore the children of Israel eat not of the sinew which shrank, which is upon the hollow of the thigh, unto this day, because he touched the hollow of Jacob’s thigh in the sinew that shrank.

— the sinew which shrank; the nerve that fastens the thigh bone in its socket: the practice of the Jews in abstaining from eating this in the flesh of animals, is not founded on the law of Moses, but is merely a traditional heritage;

— the Targum Onkelos says

Therefore, the children of Israel must not eat the displaced tendon [nerve] which is on the [girth of the] hip joint to this very day; because he struck [the girth of] Yaakov’s hip joint on the displaced tendon.

US Ground Invasion of Iran: A Trap Set Up By Israel

•April 5, 2026 • Leave a Comment

The largest US military buildup in decades, some 50,000 US troops ready for a Ground Invasion as the Iran war continues to escalate and no sign of ending.

A View from Russia: US Ground Invasion of Iran Is A Trap Set Up By Israel

Prada • March 30, 2026 ~ Antiwar

After threatening strikes on Iran’s power plants, Donald Trump backed down in order to ease oil prices. However, military escalation still has the potential to spiral out of control.

First of all the United States can forget about their gambles on Kharg and Qeshm Islands. The Iranian coastline is very heavily fortified with missiles, artillery and underground bunkers that could turn any potential operation into a high casualty even for US soldiers who would be placed well within the strike range of pre-positioned IRGC forces, who have mastered swarm tactics. Close combat will also reduce US technological advantages while the Iranians amplify their strengths in asymmetric warfare.

At least 1,000 troops and potentially even the USS Abraham Lincoln and Gerald R Ford would sit off of Iran’s coast fully exposing the invading US army to Fattah hypersonic missiles and Shahed drones. Supplying and protecting US forces would also degrade the Pentagon’s military capabilities in the Middle East because they would also have a target on their backs.

The largest US military buildup in decades, some 50,000 US troops ready for a Ground Invasion as the Iran war continues to escalate and no sign of ending

And ultimately the US would fail in its mission of reopening the Strait of Hormuz and reducing Iran’s control over maritime routes. Even if American forces were successful in capturing the islands, the strait would not reopen because the naval mines are still in place. Tehran‘s ability to choke global oil transit will be preserved.

Furthermore, if the US attempts a ground invasion, we can expect with certainty that the Iranians will retaliate exactly the way they promised in response to Trump’s threats to strike Iranian power plants. By destroying every bit of energy infrastructure that exists in the Gulf Arab monarchies and plunging the world into a decade of a depression worse than the Great Depression, COVID, the oil shock and the financial crisis combined.

Even beyond a potential operation on the oil islands, we also have to analyze Trump’s threats against Iranian nuclear facilities. Securing Iran’s uranium could require up to 4,000 troops deep inside the country plus an additional 50,000 for logistics, backup, and medical evacuations.

. . . leading to military turmoil across the region and the world over.

Deploying and sustaining such a force deep inside Iran would require major resources, while leaving troops exposed to Iranian counterattacks since the mission most certainly will not be completed quickly.

Larger deployments and Iranian counterattacks via drone and missile strikes would only place a larger strain on US air and naval defense assets. Furthermore handling at least 450 kg of highly-enriched uranium is very dangerous and creates major risks of radiation poisoning.

Trump and Netanyahu’s war of aggression is not going to end anytime soon and their hopes for regime change are now a distant memory. Meanwhile, air strikes from the IRGC, Hezbollah and Ansar Allah continue to rain down on US military bases and Israel, in a war which will only result in the collapse of Zionist entity and decline of the US empire. Economic crisis looms as oil, LNG, fertilizer, helium and sulfuric acid is backed up in the Persian Gulf threatening rampant inflation of gas and food prices, as well as a decline in chip manufacturing.

If Trump attempts a landing on Kharg or Qeshm Islands, he will be sending US troops into a meatgrinder the same way Zelensky’s Neo-Nazi thugs are kidnapping young Ukrainians and sending them to their deaths. And he will have doomed the world to a decade of depression. The Israelis and the Iranians are setting up the trap and Trump is once again taking the bait.

Iran’s response to Trump threat to destroy Kharg Island

•April 4, 2026 • Leave a Comment

Trump threatens to destroy Kharg Island, Iran’s oil export hub. Already Thousands of US paratroopers, marines, and special forces soldiers have reportedly been deployed to the Middle East as Washington considers seizing the key oil hub, which handles most of Iran’s crude exports.

The US president said he would destroy the island, which houses oil wells, power plants, and other civilian infrastructure, if a deal is not soon reached to end the war.

And during a speech, Trump has also threatened to bomb regime ‘back to Stone Ages,’ threatening to attack Tehran’s oil and energy supplies if the Strait of Hormuz is not reopened.

His address came after huge bombing raids targeted an IRGC missile base in Baharestan, Isfahan.

Earlier, Iran has named these 18 US companies, claiming they are spies for the US, to be targetted; namely: Google, Amazon, Intel, Apple, Microsoft, Cisco, HP, Meta, IBM, Dell, JP Morgan Chase, GE, Spire Solution, Boeing and Oracle, as well as electric car Tesla, analytics firm Palantir, and chip giant Nvidia.

JerusalemPost • April 4, 2026

Iran’s Islamic Revolutionary Guard Corps (IRGC) attacked Oracle’s data center in Dubai on Thursday, according to state media. Dubai’s media office, however, denied this claim later that day.

Also on Thursday, two drones targeted a US diplomatic facility near Baghdad Airport in Iraq, security sources said.

Earlier on Thursday, the IRGC attacked an Amazon cloud computing center in Bahrain, “in retaliation for attacks on Iran,” according to reports by the Iranian Students’ News Agency (ISNA) on Thursday.

Bahrain’s Interior Ministry said earlier on Wednesday that civil defense teams were ​extinguishing a fire at a company ​facility following what authorities described as an ⁠Iranian attack.

Iranian attacks across region 

A drone crashed inside Iraq’s Trebil border crossing with Jordan on Thursday, security sources said, damaging customs clearance offices.

In addition, the Islamic Republic’s semi-official Fars News Agency listed several bridges as potential military targets on Thursday, including bridges in Kuwait, Saudi Arabia, Abu Dhabi, and Jordan. 

Also on Thursday, Iran’s Mehr reported that the Islamic regime had carried out drone attacks against US fighter jets at Jordan’s Al Azraq base.

The USS Abraham Lincoln fleet with Arleigh Burke-class destroyers and Ticonderoga-type missile cruisers carry expensive anti—aircraft missiles
which are ill-equipped to tackle swarms of slow and maneuverable drones that US Forces will have to shoot down with the same extremely expensive missiles

A day after sounding conciliatory and suggesting a deal could be reached this week, Trump wrote on his Truth Social network that the United States is in “serious discussions” with “a more reasonable regime” in Tehran. But he added an ominous warning.

“If for any reason a deal is not shortly reached, which it probably will be, and if the Hormuz Strait is not immediately ‘Open for Business,’ we will conclude our lovely ‘stay’ in Iran by blowing up and completely obliterating all of their Electric Generating Plants, Oil Wells and Kharg Island (and possibly all desalinization plants!),” Trump warned.

White House Press Secretary Karoline Leavitt repeated the administration’s insistence that the US war against Iran should be over within another two weeks. Trump “has always stated four to six weeks, estimated timeline,” Leavitt told reporters. “We’re on day 30 today. So again, you do the math.” “He wants to see a deal over the next 10 days,” she added.

In response, Iran fired missiles across the Middle East on Tuesday as its capital was hit by fresh explosions, after US President Donald Trump threatened the country’s key oil export hub, power stations and desalination plants.

Iran to reopen Strait of Hormuz

•April 4, 2026 • Leave a Comment

Iran to reopen Strait of Hormuz only for ships following new laws

“Trump has finally achieved his dream of regime change,” says Ebrahim Azizi

TheTelegraph • April 3, 2026

Iran has announced that the Strait of Hormuz will reopen, but only to those who follow its new laws and not to US vessels.

Ebrahim Azizi, head of the Iranian parliament’s national security committee, addressed the US in a post on X, stating that, “the 47 years of hospitality are over forever.”

“Trump has finally achieved his dream of ‘regime change’ – but in the region’s maritime regime! The Strait of Hormuz will certainly reopen, but not for you; it will be open for those who comply with the new laws of Iran,” Azizi wrote.

It comes as US President Donald Trump suggested that he’s ready to end the war “within two or three weeks” once they are certain the regime cannot build a nuclear weapon “for years.”

Following his statement, oil prices fell more than 3% to just above $100 per barrel, but Brent crude prices remain 39% higher than at the end of February, when the war started.

Trump is continuing to claim that Iran is “begging to make a deal,” adding that whether or not it happens is “irrelevant” to America’s timetable.

However, Iran’s president, Masoud Pezeshkian, said that his country has the “necessary will” to end the war with the US and Israel, as long as certain conditions are met.

Meanwhile, attacks between Iran and Israel are ongoing, with injuries reported after a strike outside Tel Aviv, and a tanker was hit by two projectiles off the coast of Qatar.

Trump is scheduled to deliver an “address to the nation” to update on the war’s progress, possibly outlining plans to de-escalate the conflict. 

The best and, perhaps, only possible option left: Ground Troops.

Is this another Vietnam, Iraq, or Afghanistan?

Woe to the crown of pride, to the drunkards of Ephraim, whose glorious beauty is a fading flower, which is on the head of the fat valleys of them that are overcome with wine! Isaiah 28:1

For more, see (1) The Birthrights (2) Ephraim and Manasseh (3) Ephraim as the Thirteenth Tribe (4) Who is this lying Ephraim? (5) The Ox with horns of a Unicorn

Genesis (29-30)

•April 4, 2026 • Leave a Comment

~~~~

Jacob, when he first saw Rachel; but why his parents didn’t furnished him with gold and other gifts ready for a proposal?

But when Abraham’s servant went to look for a wife for Isaac, he came with ten camels, carrying gifts of “jewels of silver, and jewels of gold, and raiment,” to Rebekah; her brother and to her mother precious things, Genesis 24:10,53

Genesis 29

1 Then Jacob went on his journey, and came into the land of the people of the east. — the people of the East; and arrives at the well of Haran, which was about four degrees east of Beer-sheba;

— and the distance was about four hundred and fifty miles, and therefore it would take Jacob fifteen days to journey there;

— the Targum Onkelos says

Yaakov [then] lifted his feet and went toward the land of the people of the East.

And he looked, and behold, a well in the field, and lo, there were three flocks of sheep lying by it; for out of that well they watered the flocks; and a great stone was upon the well’s mouth.

— a well in the field; near Haran; having travelled that far, he might purposely look out for a well; as knowing these people frequently came for water for their families,

— as knowing these people frequently came for water for their families, or shepherds to water their flocks, of whom he might get intelligence concerning Laban’s family, and where they dwelt;

— the Targum Onkelos says

He looked and [saw] a well in the field; and behold there were three flocks of sheep lying beside it, for from that well the flocks are watered. There was a large stone over the mouth of the well.

And thither were all the flocks gathered; and they rolled the stone from the well’s mouth and watered the sheep, and put the stone again upon the well’s mouth in his place.

— and they rolled the stone from the well’s mouth, and watered the sheep; that is, when they watered the sheep, they used to roll away the stone from the mouth of the well in order to do it; and put a stone back upon the well’s mouth in this place; 

— the Targum Onkelos says

When all the flocks would gather, [the shepherds] would roll the stone from the well’s mouth, and water the sheep. They would [then] return the stone to its place over the mouth of the well.

And Jacob said unto them, “My brethren, from whence be ye?” And they said, “Of Haran are we.” — and they said, of Haran are we; the very place he was bound for, and was sent unto;

— the Targum Onkelos says

Yaakov said to them, My brothers, from where do you come? They said, We are from Charan.

And he said unto them, “Know ye Laban the son of Nahor?” And they said, “We know him.” — Laban the son of Nahor; Laban was really the son of Bethuel and grandson of Nahor;

— but Nahor was the founder of the family, as being the original immigrant from Ur, who came to supply Abraham’s place on his departure;

— the Targum Onkelos says

He said to them, Do you know Lavan, the son of Nachor? They said, We know him.

And he said unto them, “Is he well?” And they said, “He is well; and behold, Rachel his daughter cometh with the sheep.” — and, behold, Rachel his daughter cometh with the sheep;

— at that very instant Rachel was coming out of the city with her father’s flock of sheep, to water them at the well; an instance of great humility, diligence, and simplicity; this was very providential to Jacob;

— the Targum Onkelos says

He said to them, Is he doing well? They said, He is doing well. Behold Rochel, his daughter, is coming with the sheep.

And he said, “Lo, it is yet high day, neither is it time that the cattle should be gathered together. Water ye the sheep, and go and feed them.”

— the Targum Onkelos says

He said to them, The day is yet long, it is not yet time for the sheep to be gathered, water the sheep and go pasture them.

And they said, “We cannot until all the flocks are gathered together, and until they roll the stone from the well’s mouth. Then we water the sheep.”

— the Message Bible has this passage clearer as:

6 “Are things well with him?” Jacob continued.
“Very well,” they said. “And here is his daughter Rachel coming with the flock.”
7 Jacob said, “There’s a lot of daylight still left; it isn’t time to round up the sheep yet, is it? So why not water the flocks and go back to grazing?”
8 “We can’t,” they said. “Not until all the shepherds get here. It takes all of us to roll the stone from the well. Not until then can we water the flocks.” Genesis 29:6-8 MSG

— the Targum Onkelos says

They said, We cannot [do so] until all the flocks have gathered and [the shepherds] roll the stone from the mouth of the well. Then we can water the sheep.

And while he yet spoke with them, Rachel came with her father’s sheep, for she kept them. — for she kept them; having, no doubt, servants under her who performed the meaner and more laborious offices, and whom it was her place to oversee;

— the Targum Onkelos says

While he was still speaking with them, Rochel came with her father’s sheep, for she was a shepherdess.

— the Targum of Jonathan says

“While he was still speaking with them, Rachel came with her father’s sheep, for she was a shepherdess at that time. For a plague from the Lord had been among Laban’s sheep, and only a few of them remained; therefore, he [Laban] had dismissed his shepherds, and those that remained he placed before Rachel his daughter.”

10 And it came to pass, when Jacob saw Rachel the daughter of Laban, his mother’s brother, and the sheep of Laban, his mother’s brother, that Jacob went near and rolled the stone from the well’s mouth and watered the flock of Laban, his mother’s brother.

— Laban his mother’s brother; the threefold repetition of these words signifies the importance of this relationship;

— the Targum Onkelos repeats the threefold repetition, saying

When Yaakov saw Rochel, the daughter of Lavan, his mother’s brother, with the sheep of Lavan, his mother’s brother, he stepped near and rolled the stone from the mouth of the well. He then watered the sheep of Lavan, his mother’s brother.

11 And Jacob kissed Rachel, and lifted up his voice and wept. — Jacob kissed Rachel and wept; Jacob first made himself, useful to Rachel, and then discloses to her who he is, claims her as a cousin, and kisses her;

— the Targum Onkelos says

Yaakov kissed Rochel and cried in a loud voice.

12 And Jacob told Rachel that he was her father’s brother, and that he was Rebekah’s son; and she ran and told her father. — and Rachel ran and told her father; leaving the care of her flock with Jacob; earlier, Rebekah, in a like case, ran and told her mother;

— the Targum Onkelos says

Yaakov told Rochel that he was a relative of her father [the son of her father’s sister], that he was the son of Rivkah. She ran and told her father.

— the Targum of Jonathan says

“And Jacob told Rachel that he had come to be a relative to her father and to take one of his daughters. Rachel answered and said: ‘It is not possible for you to dwell with him, for he is a cunning man.’ Jacob said to her: ‘I am as cunning and wiser than he, and he has no power to do me harm, for the Word of the Lord is my help.’ And when she knew that he was the son of Rebekah, she ran and told her father.”

13 And it came to pass, when Laban heard the tidings of Jacob his sister’s son, that he ran to meet him, and embraced him and kissed him, and brought him to his house. And he told Laban all these things.

— and he told Laban all these things; how he was sent hither by his parents on account of the hatred of his brother Esau, because he had got the birthright and blessing from him;

— the Targum Onkelos says

When Lavan heard the news of Yaakov, his sister’s son, he ran to greet him. He embraced him and kissed him, and brought him to his house. [Yaakov] told Lavan all that had happened.

— the Targum of Jonathan says

“And it was, when Laban heard the report of the mighty deeds and the righteousness of Jacob, his sister’s son—how he had taken the birthright and the order of the blessings from the hand of his brother; and how the Lord had revealed Himself to him at Bethel; and how he had fenced in the stone; and how the well had overflowed and risen to its surface—he ran to meet him, and embraced him, and kissed him, and brought him to his house. And Jacob recounted to Laban all these things.”

— in the Masoretic Text, “all these things” is vague; the Targum Jonathan makes it clear that Jacob was open about his past; that he was a fugitive from Esau, that he had experienced divine miracles; which sets up the irony: to let Laban knows Jacob is divinely blessed, yet Laban spends the next twenty years cunningly trying to outwit him.

14 And Laban said to him, “Surely thou art my bone and my flesh.” And he abode with him the space of a month. — and Laban said to him, surely thou art my bone and my flesh; closely allied in blood, being his sister’s son;

— the Targum Onkelos says

Lavan said to him, Nevertheless, you are my bone [relative] and flesh. [Yaakov] lived with him for a month.

15 And Laban said unto Jacob, “Because thou art my brother, shouldest thou therefore serve me for nought? Tell me, what shall thy wages be?” — doubtless Laban had seen, during Jacob’s stay of a month, that his services would be very valuable; hence the offer;

— the Targum Onkelos says

Lavan said to Yaakov, Just because you are my relative, must you work for me without pay? Tell me, [what should] your wages [be]?

16 And Laban had two daughters: the name of the elder was Leah, and the name of the younger was Rachel. — and the name of the elder was Leah; which signifies labour or weariness: and the name of the younger was Rachel; before mentioned, whom Jacob met at the well;

— the Targum Onkelos says

Lavan had two daughters. The name of the older one was Leah, and the name of the younger one was Rochel.

17 Leah was tendereyed, but Rachel was beautiful and wellfavored. — “Tender eyed” is the KJ translation; other translations are weak eyes, though other versions call her eyes blue (apparently a real turn-off), or dull, or soft, or lacking sparkle;

— the Targum Onkelos says

The eyes of Leah were tender [beautiful]. Rochel was of beautiful form and of beautiful appearance.

— the Targum of Jonathan says

“And the eyes of Leah were clouded/sore from weeping (tzirnaytan di-vachya); for she was praying before the Lord that He would not designate her for the wicked Esau. But Rachel was beautiful in form and fair in appearance.”

18 And Jacob loved Rachel, and said, “I will serve thee seven years for Rachel thy younger daughter.” — Jacob, not having any gold and silver, offer to serve seven years for Rachel;

— the Targum Onkelos says

Yaakov loved Rochel. and he said, I will work for you seven years for Rochel, your younger daughter.

19 And Laban said, “It is better that I give her to thee, than that I should give her to another man. Abide with me.” — it is better that I should give her to thee, than that I should give her to another man; by which he not only intimates that he preferred him, a relation, to another man, a stranger;

— the Targum Onkelos says

Lavan said, Better that I give her to you than I should give her to another man. [Remain] living with me.

20 And Jacob served seven years for Rachel; and they seemed unto him but a few days, for the love he had for her. — they seemed unto him but a few days; Jacob was at least fifty-seven years of age, but the late marriages hitherto of the patriarchs show that they only slowly arrived at manhood;

— the Targum Onkelos says

Yaakov worked seven years for Rochel, but they seemed to him like a few days, so much did he love her.

21 And Jacob said unto Laban, “Give me my wife, for my days are fulfilled, that I may go in unto her.” — the seven years were up he agreed to serve him for his daughter; that I may go in unto her; as his lawful wife, and it was high time Jacob had her;

— the Targum Onkelos says

Yaakov said to Lavan, Give me my wife, for my term [of labor] is completed; and thus I will consummate the marriage with her.

22 And Laban gathered together all the men of the place and made a feast. — and made a feast; a marriage or marriage feast; normally lasting seven days;

— the Targum Onkelos says

Lavan gathered all the local people and he made a [wedding] feast.

— the Targum of Jonathan reveals how Laban tried to outwit Jacob

“And Laban gathered all the men of the place and made a banquet for them. And he said to them: ‘Behold, for the seven years that Jacob has been with us, the wells have not failed and our watering places have increased. And now, come, let us take counsel against him with a plan of cunning counsel so that he will remain with us.’ And they made a plan of cunning counsel against him, to bring to him Leah instead of Rachel.”

23 And it came to pass in the evening, that he took Leah his daughter and brought her to him; and he went in unto her. — and he went in unto her; or lay with her as his wife; a modest expression of the use of the bed;

— the conduct of Laban is perfectly intelligible as the outcome of his sordid avarice; but it is difficult to understand how Leah could acquiesce in a proposal so base as to wrong her sister by marrying one who neither sought nor loved her;

— the Targum Onkelos says

When it was evening, he took Leah, his daughter, and brought her to him [Yaakov]. He consummated the marriage with her.

24 And Laban gave unto his daughter Leah, Zilpah his maid for a handmaid. — instead of Rachel, Laban took his elder daughter Leah into the bride-chamber, and Jacob went in unto her, without discovering in the dark;

— the Targum Onkelos says

Lavan gave Zilpah, his servant to her, to Leah, his daughter as a handmaid.

— the Targum of Jonathan says, “and Laban gave her Zilpah his daughter, whom his concubine bore unto him:” hence some Jewish authorities say that the daughters of a man by his concubines are called maids.

25 And it came to pass that in the morning, behold, it was Leah; and he said to Laban, “What is this thou hast done unto me? Did not I serve with thee for Rachel? Why then hast thou beguiled me?”

— wherefore then hast thou beguiled me? by giving Leah instead of her: though Laban is not to be justified in this action;

— yet it appears in Providence a righteous retaliation of Jacob; he beguiled his own father, pretending he was his brother Esau; and now his father-in-law beguiles him, giving him blear eyed Leah instead of beautiful Rachel;

— the Targum Onkelos says

When it was morning, behold it was Leah! He [Yaakov] said to Lavan, What have you done to me? Did I not work with you for Rochel? Why did you deceive me?

26 And Laban said, “It must not be so done in our country, to give the younger before the firstborn. — it is still the custom not to give the younger in marriage before the older, unless the latter be deformed or in some way defective;

— the Targum Onkelos says

Lavan said, It is not done so in our place, to give the younger [daughter in marriage] before the firstborn.

27 Fulfill her week, and we will give thee this other also, for which service thou shalt serve with me yet seven other years.” — fulfil her week; not Rachel’s week,

— or a week of years of servitude for her, but Leah’s week, or the week of seven days of feasting for her marriage; for a marriage feast used to be kept seven days;

— the Targum Onkelos says

Complete the [marriage] week for this one. We will then give you the other also—in return for the work that you will do with me for another seven years.

28 And Jacob did so, and fulfilled her week; and he gave him Rachel his daughter for a wife also. — and he gave him Rachel his daughter to wife also; not after seven years’ service, but after the seven days of feasting for Leah;

— the Targum Onkelos says

Yaakov did so, and he completed the [marriage] week for this one [Leah]. He [Lavan] then gave Rochel, his daughter to him as a wife.

29 And Laban gave to Rachel his daughter Bilhah his handmaid to be her maid. — also giving Bilhah her handmaid unto him; and this the Targum of Jonathan is said to be a daughter of Laban by a concubine also;

— the Targum Onkelos says

To his daughter, Rochel, Lavan gave his servant Bilhah, to be her handmaid.

30 And he went in also unto Rachel, and he loved also Rachel more than Leah, and served with him yet seven other years. — and served with him, yet seven other years; that is, Jacob served so many years with Laban after he had married his two daughters, and fulfilled the weeks of feasting for each of them;

— the Targum Onkelos says

He [Yaakov] also consummated his marriage with Rochel. He loved Rochel more than Leah, and he worked with [Lavan] additionally, another seven years.

31 And when the Lord saw that Leah was hated, he opened her womb; but Rachel was barren. — Leah was hated; for plainly Leah was not the object of love at all; it was her fruitfulness which gave her value in her husband’s eyes, and when this ceased, Jacob utterly neglected her (Genesis 30:15);

— the Targum Onkelos says

Adonoy saw that Leah was the hated one, and He opened her womb [allowed her to conceive]. Rochel remained barren.

32 And Leah conceived and bore a son, and she called his name Reuben [that is, See a son]; for she said, “Surely the Lord hath looked upon my affliction. Now therefore my husband will love me.” — Reuben ~ France;

— the Targum Onkelos says

Leah conceived and gave birth to a son. She named him Reuvein, as she said, Adonoy has seen my affliction [was revealed before Adonoy]; for now my husband will love me.

33 And she conceived again and bore a son, and said, “Because the Lord hath heard that I was hated, He hath therefore given me this son also.” And she called his name Simeon [that is, Hearing]. — Germany?

— the Targum Onkelos says

She conceived again and gave birth to a son. She said, Since Adonoy [it was] heard [before Adonoy] that I am the hated one, He also gave me this one, and she named him Shimon.

34 And she conceived again and bore a son, and said, “Now this time will my husband be joined unto me, because I have borne him three sons.” Therefore was his name called Levi [that is, Joined]. —  Judah and Levi ~ Israel;

— the Targum Onkelos says

She conceived again and gave birth to a son. She said, This time my husband will become attached to me, for I have born him three sons. He therefore named him Leivi.

35 And she conceived again and bore a son; and she said, “Now will I praise the Lord.” Therefore she called his name Judah [that is, Praise], and ceased bearing.

— the Targum Onkelos says

She conceived again and gave birth to a son. She said, This time I will [give] praise [before] Adonoy. She therefore named him Yehudah. She then stopped giving birth.

— Judah; which signifies “praise” the Targum of Jonathan adds this as a reason, “because from this my son shall come forth kings, and from him shall come forth David the king, who shall praise the Lord,” and a son in whose line, and from whose tribe, the Messiah was to spring.

Chart of Jacob’s Twelve Sons

Genesis 30

1 And when Rachel saw that she bore Jacob no children, Rachel envied her sister, and said unto Jacob, “Give me children, or else I die.” — Give me children, or else I die’this is the stress proverb that a childless person is as good as dead;

— the Targum Onkelos says

Rochel saw that she was not bearing children to Yaakov. Rochel became jealous of her sister, and she said to Yaakov, Give me children; if not I am [considered] dead.

And Jacob’s anger was kindled against Rachel; and he said, “Am I in God’s stead, who hath withheld from thee the fruit of the womb?” — Am I in God’s stead? that is, do you take me to be God, for it is God’s prerogative to give children;

— the Targum Onkelos says

Yaakov became very angry with Rochel, and he said, Am I in God’s place? [Are you asking me? Is it not from before God that you should ask?] [It is He] who has withheld from you the fruit of the womb.

And she said, “Behold my maid Bilhah. Go in unto her, and she shall bear upon my knees, that I may also have children by her.” — behold my maid Bilhah; in desperation, she would rather have children by reputation than none at all; children that she can call her own, though they be not so;

— the Targum Onkelos says

She said, Here is my handmaid, Bilhah, consummate a marriage with her. Let her give birth upon my knees [and I will rear them], and I too will have a son [be built up] through her.

And she gave him Bilhah her handmaid for a wife; and Jacob went in unto her. — and Jacob went in unto her; consenting to what Rachel his wife proposed to him:

— having concubines, as well as more wives than one, were not thought criminal in those times, and were suffered of God, and in this case for the multiplication of Jacob’s seed;

— the Targum Onkelos says

She gave him Bilhah, her handmaid, as a wife and Yaakov consummated the marriage with her.

And Bilhah conceived and bore Jacob a son.

— the Targum Onkelos says

Bilhah conceived and bore Yaakov a son.

And Rachel said, “God hath judged me, and hath also heard my voice and hath given me a son.” Therefore she called his name Dan [that is, Judging]. — Dan means judging; signifies judgment; Dan ~ Ireland, Denmark;

— the Targum Onkelos says

Rochel said, Elohim has judged me. He has also heard my voice [accepted my prayer], and has given me a son. She therefore named him Don.

And Bilhah, Rachel’s maid, conceived again and bore Jacob a second son.

— the Targum Onkelos says

She conceived again, and Bilhah, Rochel’s handmaid, bore a second son to Yaakov.

And Rachel said, “With great wrestlings have I wrestled with my sister, and I have prevailed.” And she called his name Naphtali [that is, My wrestling]. — Naphtali ~ Sweden;

— the Targum Onkelos says

Rochel said, With Elohim’s bonds, I have been joined to my sister, and I have also prevailed [Elohim accepted my request, when I pleaded in my prayer, I desired that I would have offspring like my sister, it was also given to me]. She [therefore] called him Naftali.

When Leah saw that she had ceased bearing, she took Zilpah her maid and gave her to Jacob for a wife;

— the Targum Onkelos says

Leah realized that she was no longer bearing children. She [therefore] took Zilpah, her handmaid, and gave her to Yaakov as a wife.

10 and Zilpah, Leah’s maid, bore Jacob a son.

— the Targum Onkelos says

Zilpah, Leah’s handmaid, bore Yaakov a son.

11 And Leah said, “A troop cometh.” And she called his name Gad [that is, A troop or company]. — Gad ~ Switzerland;

— the Targum Onkelos says

Leah said, Unexpected success has come, and she named him Gad.

12 And Zilpah, Leah’s maid, bore Jacob a second son.

— the Targum Onkelos says

Zilpah, Leah’s handmaid bore a second son to Yaakov.

13 And Leah said, “Happy am I, for the daughters will call me blessed.” And she called his name Asher [that is, Happy]. — Asher ~ Belgium;

— the Targum Onkelos says

Leah said, It is in my good fortune that daughters [women] will consider me fortunate. [Praise is mine, because women will praise me from now.] She named him Asher.

14 And Reuben went in the days of wheat harvest and found mandrakes in the field, and brought them unto his mother Leah. Then Rachel said to Leah, “Give me, I pray thee, of thy son’s mandrakes.” — mandrakes; arose from the popular belief that it was a specific against barrenness;

— Rachel, therefore, who still hankered after children of her own, was anxious to obtain some of the fruit, and Leah consents only upon the proffered condition that Jacob shall spend the night in her tent;

— the Targum Onkelos says

Reuvein went in the days of the wheat harvest, and found jasmine flowers in the field. He brought them to Leah, his mother. Rochel said to Leah, Please [Now] give me some of your son’s jasmine flowers.

15 But she said unto her, “Is it a small matter that thou hast taken my husband? And wouldest thou take away my son’s mandrakes also?” And Rachel said, “Therefore he shall lie with thee tonight, for thy son’s mandrakes.”

— and Rachel said, therefore he shall lie with thee tonight for thy son’s mandrakes; which showed no great affection to her husband, and a slight of his company, to be willing to part with it for such a trifle;

— and it seems by this as if they took their turns to lie with Jacob, and this night being Rachel’s turn, she agrees to give it to Leah for the sake of the mandrakes;

— the Targum Onkelos says

She [Leah] said to her, Isn’t it enough that you took my husband? Would you also take my son’s jasmine flowers? Rochel said, Therefore, he shall be with you tonight in exchange for your son’s jasmine flowers.

16 And Jacob came out of the field in the evening, and Leah went out to meet him and said, “Thou must come in unto me, for surely I have hired thee with my son’s mandrakes.” And he lay with her that night.

— the Targum Onkelos says

Yaakov came from the field in the evening, and Leah went out to meet him. She said, You will come to me, for I have hired you with my son’s jasmine flowers, and he was with her at night.

17 And God hearkened unto Leah, and she conceived and bore Jacob the fifth son.

— the Targum Onkelos says

Elohim perceived [accepted] Leah’s [wish] [prayer]. She conceived and bore [her] fifth son to Yaakov.

18 And Leah said, “God hath given me my hire, because I have given my maiden to my husband.” And she called his name Issachar [that is, A hire]. —  Issachar ~ Finland;

— the Targum Onkelos says

Leah said, Elohim has given me my reward because I gave my handmaid to my husband. She named him Yissachar.

19 And Leah conceived again and bore Jacob the sixth son.

— the Targum Onkelos says

Leah conceived again and bore [her] sixth son to Yaakov.

20 And Leah said, “God hath endued me with a good dowry. Now will my husband dwell with me, because I have borne him six sons.” And she called his name Zebulun [that is, Dwelling]. —  Zebulun ~ Holland;

— the Targum Onkelos says

Leah said, Elohim has given [me] a goodly portion. Now my husband will make his [main] home with me, for I have borne him six sons. She named him Zevulun.

21 And afterwards she bore a daughter, and called her name Dinah [that is, Judgment].

— and here from the Message Bible:

14 One day during the wheat harvest Reuben found some mandrakes in the field and brought them home to his mother Leah. Rachel asked Leah, “Could I please have some of your son’s mandrakes?”

15 Leah said, “Wasn’t it enough that you got my husband away from me? And now you also want my son’s mandrakes?”

Rachel said, “All right. I’ll let him sleep with you tonight in exchange for your son’s mandrakes.”

16-21 When Jacob came home that evening from the fields, Leah was there to meet him: “Sleep with me tonight; I’ve bartered my son’s mandrakes for a night with you.” So he slept with her that night.

God listened to Leah; she became pregnant and gave Jacob a fifth son. She said, “God rewarded me for giving my maid to my husband.” She named him Issachar (Bartered).

Leah became pregnant yet again and gave Jacob a sixth son, saying, “God has given me a great gift. This time my husband will honor me with gifts—I’ve given him six sons!”

She named him Zebulun (Honor). Last of all she had a daughter and named her Dinah. Genesis 30:14-16 MSG

— the Targum Onkelos says

Afterwards she gave birth to a daughter, and named her Deenah.

22 And God remembered Rachel, and God hearkened to her and opened her womb. — God remembered Rachel; her long barrenness had probably humbled and disciplined her; and cured of her former petulance, she trusts no longer to mandrakes or “love-apples” but looks to God for the great blessing of children;

— the Targum Onkelos says

Elohim remembered Rochel [The remembrance of Rochel came before Elohim, and Elohim perceived her plight] [accepted her prayer] and opened her womb [allowed her to conceive].

— the Targum Jerusalem says

“Four keys are delivered into the hand of the Lord of all the world, and He has not delivered them to angel or seraph: The Key of Rain, the Key of Sustenance, the Key of the Graves (Resurrection), and the Key of the Barren Woman.

  • The Key of Rain: As the explicit scripture says: ‘The Lord will open for you His good treasury [the heavens, to give rain]’ (Deut. 28:12).
  • The Key of Sustenance: As the explicit scripture says: ‘You open Your hand [and satisfy the desire of every living thing]’ (Psalm 145:16).
  • The Key of the Graves: As the explicit scripture says: ‘When I open your graves [O My people]’ (Ezekiel 37:13).
  • The Key of the Barren Woman: As the explicit scripture says: ‘And God remembered Rachel…’ (Gen. 30:22).

And the Word (Memra) of the Lord in His good mercies remembered Rachel; and the Word of the Lord heard the voice of her prayer, and He said by His Word to give her children.”

23 And she conceived and bore a son, and said, “God hath taken away my reproach.” — and she conceived and bare a son; through the goodness of God unto her, and for which she was greatly thankful;

— the Targum Onkelos says

She conceived and gave birth to a son. She said, Elohim has removed my shame.

24 And she called his name Joseph [that is, Adding], and said, “The Lord shall add to me another son.” — the name appears to be, that they were influenced by the promises of God to Abraham; whose posterity were promised the richest blessings: Manasseh ~ UK; Ephraim ~ US;

— the Targum Onkelos says

She named him Yoseif, saying, May Adonoy add to me another son.

The Twelve Sons of Jacob that became the Twelve Tribes of Israel

25 And it came to pass, when Rachel had borne Joseph, that Jacob said unto Laban, “Send me away, that I may go unto mine own place and to my country.

— that Jacob said unto Laban, send me away; give me leave to depart thy house: he had a right to demand his liberty, and to insist upon it, since the time of his servitude was up; but he chose to have leave;

— that I may go unto mine own place, to Beersheba, where his father and mother lived, and whom, no doubt, he longed to see; and to the land of Canaan, in which that place was, which was his native country and was given him by promise, and was to be the inheritance of his seed;

— the Targum Onkelos says

When Rochel had given birth to Yoseif, Yaakov said to Lavan, Send me on my way, and I will go to my own place and to my homeland.

— the Targum of Jonathan reveals how the posterity of Joseph, not Judah, were to be a yoke (Genesis 27:40) and a flame unto the house of Esau, saying

“And it was, when Rachel had given birth to Joseph, that Jacob said through the Holy Spirit that the House of Joseph is destined to be like a flame to consume the House of Esau. He said: ‘From now on, I am not afraid of Esau and his legions.’ And he said to Laban: ‘Send me away, that I may go to my own place and to my own land.'”

The Spanish Armada, with 130 ships and 30,000 men on board, set sail from Spain in July 1588, intending to overthrow the Protestant Queen Elizabeth I and restore Catholic rule over England; but, with a devastating Divine Wind, were destroyed by the British Navy under Commander Sir Francis Drake

26 Give me my wives and my children for whom I have served thee, and let me go; for thou knowest my service which I have done thee.” — give me my wives; his two wives, Leah and Rachel, and the two maids, Bilhah and Zilpah, which he had given him for wives also;

— Jacob desires leave not only to have them, but to take them away with him;

— the Targum Onkelos says

Give me [permission to take] my wives and my children, for whom I worked for you, and I will go; for you know my work that I did for you.

27 And Laban said unto him, “I pray thee, if I have found favor in thine eyes, tarry; for I have learned by experience that the Lord hath blessed me for thy sake.”

— that the Lord hath blessed me: Laban, the good things he had, from the Lord, as the author and giver; that it was for Jacob’s sake that he was thus blessed;

— the Targum Onkelos says

Lavan said to him, If [now] I have found favor in your eyes, I have divined [determined] that Adonoy has blessed me because of you.

28 And he said, “Appoint me thy wages, and I will give it.” — and he went on, “So name your wages. I’ll pay you.”

— the Targum Onkelos says

He said, Set your wage for me, and I will give it.

29 And he said unto him, “Thou knowest how I have served thee and how thy flocks have been with me. — and Jacob said to Laban: thou knowest that I have served diligently and faithfully, without any salary, excepting for his wives; had no wages for his service all this time;

— the Targum Onkelos says

He [Yaakov] said to him, You know how I worked for you, and how your livestock were with me.

30 For it was little which thou had before I came, and it is now increased unto a multitude; and the Lord hath blessed thee since my coming. And now, when shall I provide for mine own house also?” — for it was little before I came; perhaps just a single flock, since Rachel, his youngest daughter, had the care of it;

— and it is now increased unto a multitude; or “broke forth,” spread itself over the fields and plains, hills and mountains adjacent, so that they were covered with his sheep, these bringing forth thousands and ten thousands;

— the Targum Onkelos says

For the little you had before I came here has increased and has become a multitude. Adonoy has blessed you with my coming [for my sake]. Now when will I also do something for my own house?

31 And he said, “What shall I give thee?” And Jacob said, “Thou shalt not give me anything. If thou wilt do this thing for me, I will again feed and keep thy flock: — I will again feed and keep thy flock; it seems by this that Jacob had relinquished the care of the flock, upon the time of his servitude being out;

— but, upon the following condition, proposes to return to it, lead it out to the pastures, and feed it on them, and keep it night and day, as he had used to do;

— the Targum Onkelos says

He [Lavan] said, What shall I give you? Yaakov said, Do not give me anything—if you do this thing for me. I will continue to tend your flock and guard it.

32 I will pass through all thy flock today, removing from thence all the speckled and spotted animals, and all the brown animals among the sheep, and the spotted and speckled among the goats; and of such shall be my hire.

— sheep are generally white, the goats black, and spotted or speckled ones comparatively few and rare;

— the Targum Onkelos says

I will go through all your flocks this day. I will remove from them every lamb that is speckled, or spotted, and every dark one among the sheep, and every goat that is spotted and speckled. That [kind] will be my wage.

33 So shall my righteousness answer for me in time to come, when it shall come for my hire before thy face: every one that is not speckled and spotted among the goats, and brown among the sheep, that shall be counted stolen with me.”

— Jacob proposed to remove all existing ones of that description from the flock, and to be content with what might appear at the next lambing time. The proposal seemed so much in favor of Laban, that he at once agreed to it;

— the Targum Onkelos says

My righteousness shall testify for me in the future when it comes before you regarding my wage. Any goat which is not speckled or spotted, and any sheep that is [not] dark, is stolen [if it is] in my possession.

34 And Laban said, “Behold, I would it might be according to thy word.” — and everyone that is not speckled and spotted amongst the goats, and brown among the sheep, that shall be accounted stolen with me;

— if any such were found among those that Jacob should hereafter call his flock, as were without specks and spots, or were not brown, he was content they should be reckoned as stolen;

— the Targum Onkelos says

Lavan said, Agreed, may it be as you say.

35 And he removed that day the hegoats that were ringstreaked and spotted, and all the shegoats that were speckled and spotted, and every one that had some white in it, and all the brown among the sheep, and gave them into the hand of his sons.

— and all the she goats that were speckled and spotted; so that there might be neither male nor female of those mixed colours; this he did to prevent any generation of them:;

— the Targum Onkelos says

That day he [Lavan] removed the he-goats that were ringed and spotted, and all the she-goats that were speckled and spotted, everyone that had white in it, and all the dark ones among the sheep; and he gave them to his sons.

— and everyone that had some white in it; any white spot in it, as the Targum of Jonathan; that is, everyone of the brown or black colour, that had any white in it: and all the brown among the sheep: that were entirely so: and, gave them into the hands of his sons; the sons of Laban, who were now grown up and fit for such service.

36 And he set three days’ journey between himself and Jacob; and Jacob fed the rest of Laban’s flocks. — he set three days’ journey betwixt himself and Jacob; this means that Laban required that there should be an interval of between thirty and forty miles between himself, that is, his flocks, and those of Jacob;

— the Targum Onkelos says

He placed a three days journey between himself and Yaakov. Yaakov tended Lavan’s remaining flocks.

37 And Jacob took rods of green poplar and of the hazel and chestnut tree, and peeled white strips in them and made the white appear which was in the rods. — and pilled white strakes in them; took off the bark of them in some places, and left it on in others, which made white strakes;

— the Targum Onkelos says

Yaakov took rods of poplar that were fresh, hazel and chestnut [trees], and peeled white stripes in them by uncovering the white which is in the rods.

38 And he set the rods which he had peeled before the flocks in the gutters, in the watering troughs when the flocks came to drink, that they should conceive when they came to drink.

— in the gutters in the watering troughs, when the flocks came to drink; that is, in places of water, where troughs or vessels were made, into which the water ran convenient for the cattle to drink out of; and here he placed his party coloured rods right over against the flocks;

— the Targum Onkelos says

He stuck [inserted] the rods that he had peeled into the ducts of the [place of the] watering troughs [the place] where the flock [ewes] came to drink, facing the flock [rams]; that they should become heated when they came to drink.

39 And the flocks conceived before the rods, and brought forth animals ringstreaked, speckled and spotted. — brought forth cattle ringstraked, speckled, and spotted; such as Jacob was to have for his hire;

— the Targum Onkelos says

The flock [sheep] became heated [and mated] before the rods, and the flock [sheep] gave birth to ringed, speckled and spotted [offspring].

40 And Jacob separated the lambs, and set the faces of the flocks toward the ringstreaked and all the brown in the flock of Laban; and he put his own flocks by themselves, and put them not with Laban’s flocks. — Jacob did separate the lambs, such as were ring-straked and brown from the white;

— and he put his own flocks by themselves, and put them not unto Laban’s cattle; partly that they might not be mixed together, but kept distinct; and so his flocks be lessened;

— the Targum Onkelos says

Yaakov separated the lambs. He set the faces [at the head] of the flock [sheep] toward [all] the ringed ones and all the dark ones; [he did so] with Lavan’s flocks. He formed separate flocks of his own, and did not set [mix] them with Lavan’s flocks.

41 And it came to pass, whensoever the stronger animals conceived, that Jacob laid the rods before the eyes of the animals in the gutters, that they might conceive among the rods.

— and it came to pass, whensoever the stronger cattle did conceive; whose limbs were well compact, and were strong and healthy: that Jacob laid the rods before the eyes of the cattle in the gutters;

— the Targum Onkelos says

When the early-bearing flock [sheep] were heated [to mate], Yaakov placed the rods before the flock’s [sheep’s] eyes at the ducts, so they would be in heat among the rods.

42 But when the animals were feeble, he put them not in; so the feebler were Laban’s, and the stronger Jacob’s. — so the feebler were Laban’s, and the stronger Jacob’s; not only his flocks became more numerous than Laban’s, but were a better quality;

— the Targum Onkelos says

But when the flock [sheep] were late-bearing, he did not place [the rods before them]. Thus the late-bearing ones were Lavan’s, and the early-bearing ones became the possession of Yaakov.

43 And the man increased exceedingly and had large flocks, and maidservants and menservants, and camels and asses. — and the man increased exceedingly; Jacob grew very rich:

— and here from the Message Bible:

37-42 But Jacob got fresh branches from poplar, almond, and plane trees and peeled the bark, leaving white stripes on them. He stuck the peeled branches in front of the watering troughs where the flocks came to drink.

When the flocks were in heat, they came to drink and mated in front of the streaked branches. Then they gave birth to young that were streaked or spotted or speckled. Jacob placed the ewes before the dark-colored animals of Laban. That way he got distinctive flocks for himself which he didn’t mix with Laban’s flocks.

And when the sturdier animals were mating, Jacob placed branches at the troughs in view of the animals so that they mated in front of the branches. But he wouldn’t set up the branches before the feebler animals. That way the feeble animals went to Laban and the sturdy ones to Jacob.

43 The man got richer and richer, acquiring huge flocks, lots and lots of servants, not to mention camels and donkeys. Genesis 30:37-43 MSG

— the Targum Onkelos says

The man became tremendously prosperous. He had multipying flocks, female slaves and male slaves, camels and donkeys.

US Preparing Ground Troops and Intensified Bombing

•April 3, 2026 • Leave a Comment

US Preparing Major Escalation Against Iran That Could Include 50,000 Ground Troops and Intensified Bombing

Antiwar.com • March 30, 2026 ~ CNN

The Pentagon is developing options for a potential major escalation against Iran that could involve ground troops and an intensified bombing campaign, Axios reported on Thursday.

US officials and other sources speaking to Axios reporter Barak Ravid, a former IDF intelligence officer, described the potential escalation as a “final blow” that would give Trump more leverage and room to “declare victory,” though all indications are that Iran is ready to face ground forces and that any such operation would prolong the war.

Ravid’s sources said the potential options for a “final blow” include:

  • Invading or blockading Kharg Island, Iran’s main oil export hub.
  • Invading Larak, an island that helps Iran solidify its control of the Strait of Hormuz. The strategic outpost hosts Iranian bunkers, attack craft that can blow up cargo ships, and radars that monitor movements in the strait.
  • Seizing the strategic island of Abu Musa and two smaller islands, which lie near the western entrance to the strait and are controlled by Iran but also claimed by the UAE.
  • Blocking or seizing ships that are exporting Iranian oil on the eastern side of the Hormuz Strait.

Another operation being considered is sending troops deep inside Iran to secure Tehran’s stockpile of uranium enriched at 60%, though it’s believed to be buried under the rubble following the June 2025 airstrikes against Iran’s nuclear facilities, so it’s unclear if a team of US special operators would be able to access the material.

The report said that President Trump hasn’t made a decision, but that a major escalation was likely if negotiations made no progress, and there’s no sign that real diplomacy is underway despite Trump’s claims.

Iranian officials have rejected a 15-point proposal that the US passed through mediators and have set their own conditions to end the war.

White House Press Secretary Karoline Leavitt threatened on Wednesday that President Trump was ready to “unleash hell” on Iran.

About 5,000 of US Marines and several thousand US Army Airborne soldiers appear to be on their way to the Middle East as the Pentagon prepares for ground attacks, operations that are fraught with risk and will likely result in major US casualties since any ground force would face significant and sustained Iranian missile and drone attacks.

The Wall Street Journal reported later on Thursday that Trump is considering sending additional 10,000 ground troops.

In the meantime, US-Israeli strikes continue to pound Iran, and the Iranian military continues to launch successful attacks on Israel and US bases across the region. According to a report from The New York Times, the majority of US bases in the Middle East are now basically uninhabitable due to the Iranian strikes.

Is this another way into Vietnam, Iraq, or Afghanistan?

Woe to the crown of pride, to the drunkards of Ephraim, whose glorious beauty is a fading flower, which is on the head of the fat valleys of them that are overcome with wine! Isaiah 28:1

For more, see (1) The Birthrights (2) Ephraim and Manasseh (3) Ephraim as the Thirteenth Tribe (4) Who is this lying Ephraim? (5) The Ox with horns of a Unicorn

Trump threatens to destroy Kharg Island

•April 2, 2026 • Leave a Comment

Trump threatens to destroy Kharg Island, Iran’s oil export hub. Already Thousands of US paratroopers, marines, and special forces soldiers have reportedly been deployed to the Middle East as Washington considers seizing the key oil hub, which handles most of Iran’s crude exports.

The US president said he would destroy the island, which houses oil wells, power plants, and other civilian infrastructure, if a deal is not soon reached to end the war.

In response Iran has targetted 18 US “spy companies,” namely: Google, Amazon, Intel, Apple, Microsoft, Cisco, HP, Meta, IBM, Dell, JP Morgan Chase, GE, Spire Solution, Boeing and Oracle, as well as electric car Tesla, analytics firm Palantir, and chip giant Nvidia.

Joel Huan • April 1, 2026

US President Donald Trump threatened on Monday, March 30, to destroy Iran’s oil export hub of Kharg Island, oil wells, power plants and other civilian infrastructure if it does not soon agree to a deal to end the war.

The USS Abraham Lincoln fleet with Arleigh Burke-class destroyers and Ticonderoga-type missile cruisers carry expensive anti—aircraft missiles
which are ill-equipped to tackle swarms of slow and maneuverable drones that US Forces will have to shoot down with the same extremely expensive missiles

A day after sounding conciliatory and suggesting a deal could be reached this week, Trump wrote on his Truth Social network that the United States is in “serious discussions” with “a more reasonable regime” in Tehran. But he added an ominous warning.

“If for any reason a deal is not shortly reached, which it probably will be, and if the Hormuz Strait is not immediately ‘Open for Business,’ we will conclude our lovely ‘stay’ in Iran by blowing up and completely obliterating all of their Electric Generating Plants, Oil Wells and Kharg Island (and possibly all desalinization plants!),” Trump warned.

White House Press Secretary Karoline Leavitt repeated the administration’s insistence that the US war against Iran should be over within another two weeks. Trump “has always stated four to six weeks, estimated timeline,” Leavitt told reporters. “We’re on day 30 today. So again, you do the math.” “He wants to see a deal over the next 10 days,” she added.

In response, Iran fired missiles across the Middle East on Tuesday as its capital was hit by fresh explosions, after US President Donald Trump threatened the country’s key oil export hub, power stations and desalination plants.

Following the strike on the desalination plant in Qeshm Island, Bahrain said that an Iranian drone struck one of its desalination plants. On Sunday, a desalination plant came under attack in Kuwait. For its part, Iran denied it was responsible and claimed it was some sort of “false flag” operation.

Refusing to back down, an Iranian parliamentary committee voted to impose tolls on vessels in the strait, the passageway through which one-fifth of global oil passes, and completely ban ships from the United States and Israel.

Iran has also vowed to start striking what it called 18 US “spy companies,” namely: Google, Amazon, Intel, Apple, Microsoft, Cisco, HP, Meta, IBM, Dell, JP Morgan Chase, GE, Spire Solution, Boeing and Oracle, as well as electric car Tesla, analytics firm Palantir, and chip giant Nvidia.

It described these American firms, which also include ExxonMobil, Chevron, Halliburton, Lockheed Martin and BlackRock, as “legitimate targets” in a threat made on Tuesday.

And these include two of Amazon’s data centres in the UAE, and another data centre in Bahrain. They specifically warned employees to evacuate offices and residents to move away within a one-kilometer radius.

Iran’s Islamic Revolutionary Guards Corps (IRGC) said in a statement: “These companies should expect the ‌destruction of their respective ⁠units in exchange for ⁠each terror act in Iran, starting from 8 PM ‌Tehran time on Wednesday, April ⁠1st.”

Various media have reported since last week that the threat posed by Iranian missiles and drones to US bases has led many American troops to relocate to hotels and office spaces throughout the region.

Genesis (27-28)

•April 2, 2026 • Leave a Comment

After Jacob had stolen his birthright, Esau pleaded with Isaac his father if he could still bless him.

Then Isaac his father answered and prophesied, saying, “Thy dwelling shall be away from the fatness of the earth; and away from the dew of heaven above; Genesis 27:39

“And by your sword shall you live, you will go to every place, and wander, and you will be subject to your brother. But when his descendants abandon the commandments of the Torah, then you will break his yoke from your neck.”

“And Esau harbored hatred in his heart against Jacob, his brother, because of the blessing with which his father had blessed him. And Esau said in his heart, ‘I will not do as Cain did, who killed Abel during their father’s lifetime and then their father had another son, Seth. Rather, I will wait until the days of mourning for my father have passed, and then I will kill Jacob my brother, and I will be the sole heir.’” Genesis 27:41-42 Targum (Jonathan)

This is looking at the Scriptures with a blast of fresh air, because the deeper you dig, the more you’ll find!

“The anger of the Lord shall not return, until He has executed and until He has performed the intent of His thought; in the latter days ye shall understand it perfectly.” Jeremiah 23:20

Genesis 27

1 And it came to pass that when Isaac was old, and his eyes were dim so that he could not see, he called Esau his eldest son and said unto him, “My son.” And he said unto him, “Behold, here am I.”

— Isaac was old; now 137 years of age, but he lived even to be 180 (Genesis 35:28);

— the Targum Onkelos says

And when Yitzchok grew old his eyesight faded and he could not see. He called Eisov, his elder son, and said to him, My son. [Eisov] said to him, Here I am.

— the Targum of Jonathan says

And it was when Isaac had grown old and his eyes were too dim to see—for when his father bound him, he had gazed upon the Throne of Glory, and from that time his eyes began to grow dim—and he called Esau his elder son on the fourteenth of Nisan, and said to him: “My son, behold, this night the celestial beings praise the Lord of the world, and the treasuries of dew are opened within it.” And he said to him, “Here I am.”

And he said, “Behold now, I am old; I know not the day of my death. — I know not the day of my death; how soon I may die; a declaration which every man may make, and which every man ought well to consider, and lay to heart;

— the Targum Onkelos says

[Yitzchok] said, Behold, if you please [now], I am old. I do not know the day of my death.

Now therefore take, I pray thee, thy weapons, thy quiver and thy bow, and go out to the field and take me some venison. — thy quiver and thy bow; the former is the vessel or instrument, in which arrows were put and carried, from its being hung at the girdle;

— the Targum Onkelos says

Now [therefore] please [now] take your equipment, your sword and your bow, and go out to the field and trap [deer] for me.

And make me savory meat, such as I love, and bring it to me, that I may eat, that my soul may bless thee before I die.” — savory meat dishes are known for their rich, tasty, full-bodied flavors that are not sweet;

— that my soul may bless thee; we gather from the solemn blessing given to his sons by Jacob (Genesis 49) that this was a prophetic act, by which Isaac, under the influence of the Spirit, and in expectation of death, decided to which son should the birthright belong;

— the Targum Onkelos says

Make it into a tasty dish for me, the way I like it, and bring it to me that I may eat, so that my soul will bless you before I die.

And Rebekah heard when Isaac spoke to Esau his son. And Esau went to the field to hunt for venison, and to bring it. — Rebekah heard; she was present when Isaac gave the order, and she wished to know his determination to give the blessing to his favourite son;

— the Targum Onkelos says

Rivkah had [over] heard what Yitzchok said to his son, Eisov. Eisov went out to the field to trap [deer] to bring it [home.]

And Rebekah spoke unto Jacob her son, saying, “Behold, I heard thy father speak unto Esau thy brother, saying, — Rebekah spoke unto Jacob; she was contriving to procure the blessing for Jacob, which was designed for Esau;

— the Targum Onkelos says

Rivkah said to her son Yaakov, saying, Behold, I heard your father speaking to your brother Eisov, saying,

‘Bring me venison, and make me savory meat, that I may eat and bless thee before the Lord before my death.’

— before the Lord; solemnly, as in God’s presence, in his name, and by his authority which I shall heartily pray for thee. So he signifies that this was more than an ordinary blessing which he now intended to give him;

— the Targum Onkelos says

Bring back [deer] for me and make it into a tasty dish for me and I will eat. I will then bless you in the presence of Adonoy before I die.

Now therefore, my son, obey my voice according to that which I command thee. — obey my voice; Jacob was Rebekah’s favourite; she was prepared to deceive Isaac, in order that Jacob may obtain the coveted blessing;

— the Targum Onkelos says

Now my son, listen to [accept] me, concerning that which I command you.

Go now to the flock, and fetch me from thence two good kids of the goats, and I will make them savory meat for thy father, such as he loveth; — such as he loveth; such two good kids of the goats would pass with him for venison:

— by seasoning, the natural taste might be altered so as not to be distinguished, as we find it was; and such as have the best skill in venison may be imposed upon and deceived by more ways than one, as well as Isaac was;

— the Targum Onkelos says

Go [now], please, to the sheep and take for me from there two choice young goats, and I will make [from] them a tasty dish for your father as he likes.

10 and thou shalt bring it to thy father, that he may eat and that he may bless thee before his death.” — and thou shall bring it to thy father; for venison; and as if he was Esau that brought it: that he may eat, and that he may bless thee before his death;

— the Targum Onkelos says

You will [then] bring it to your father to eat, in order that he will bless you before he dies.

11 And Jacob said to Rebekah his mother, “Behold, Esau my brother is a hairy man, and I am a smooth man. — and I am a smooth man: without hair, excepting in those parts where it is common for all men to have it;

— the Targum Onkelos says

Yaakov said to Rivkah, his mother, Behold, Eisov, my brother is a hairy person and I am a smooth-skinned person.

12 My father perhaps will feel me, and I shall seem to him as a deceiver; and I shall bring a curse upon myself and not a blessing.”

— and I shall bring a curse upon me, and not a blessing; and he might justly fear fooling a blind; that should he be found out, so provoke his father, that instead of blessing, he would curse him, Deuteronomy 27:18

— the Targum Onkelos says

Suppose my father touches me. I will be in his eyes as an impostor [a mocker]. I will bring upon myself a curse [curses]—not a blessing [blessings].

13 And his mother said unto him, “Upon me be thy curse, my son; only obey my voice, and go, fetch me them.” — upon me be thy curse, my son; that is, if thy father should curse thee, which I am well assured he will not, let the curse, be what it will, fall upon me;

— the Targum Onkelos says

His mother said to him, Your curse shall be upon me [It was said regarding me in a prophecy that curses will not come upon you], my son; but listen to [accept] me. Go bring them to me.

14 And he went, and fetched and brought them to his mother; and his mother made savory meat, such as his father loved.

— and Rebekah made savoury meat, such as his father loved; by picking out proper pieces, and seasoning them well, it was as grateful to him as if it had really been venison, such as he loved;

— the Targum Onkelos says

He went, took [them], and brought [them] to his mother. His mother make a tasty dish as his father liked.

15 And Rebekah took goodly raiment of her eldest son Esau, which were with her in the house, and put them upon Jacob her younger son;

— goodly raiment from Esau; evidently the clothing would be something special, sacerdotal garments or such as was peculiar to Esau: which were with her in the house; 

— for ordinary raiment, however handsome, would not have been kept in the mother’s tent, but in that of Esau or of one of his wives;

— and put them upon Jacob her younger son; that be might be took for Esau, should Isaac examine him and feel his garments, or smell them;

— the Targum Onkelos says

Rivkah took the garments of Eisov, her elder son, [the garments] that were precious [to him] [the clean ones] that were in her keeping in the house, and put them on Yaakov, her younger son.

— the Targum of Jonathan says the garment was Adam’s and with Rebekah that day

And Rivekah took the pleasant vestments of Esau her elder son which had formerly been Adam’s; but which that day Esau had not worn, but they remained with her in the house, and (with them) she dressed Jakob her younger son.

16 and she put the skins of the kids of the goats upon his hands and upon the smooth of his neck. — and she put the skins of the kids of the goats upon his hands; upon both his hands, and the whole of them that was bare, that he might appear to be like Esau;

— the Targum Onkelos says

The skins of the young goats she placed on his hands and the smooth part of his neck.

17 And she gave the savory meat and the bread, which she had prepared, into the hand of her son Jacob. — and she gave the savoury meat; seasoned and dressed as might be taken for venison: and the bread which she had prepared: into the hand of her son Jacob;

— the Targum Onkelos says

She placed the tasty dish and the bread which she had made, in the hand of Yaakov, her son.

18 And he came unto his father, and said, “My father.” And he said, “Here am I. Who art thou, my son?” — arise, sit and eat; it is debatable that Isaac was too bedridden, for Jacob bids him arise and seat himself;

— the Targum Onkelos says

He came to his father and said, My father. [Yitzchok] said, Here I am. Who are you my son?

19 And Jacob said unto his father, “I am Esau thy firstborn; I have done according as thou badest me. Arise, I pray thee, sit and eat of my venison, that thy soul may bless me.”

— and Jacob lied unto his father, the first; I am Esau thy firstborn; had he only said that he was his firstborn, he might have been excused from lying, because he had bought the birthright of Esau;

— how could he say, I have done as thou badest me, when he had received no command from his father: this was Jacob’s second lie; and, arise, I pray thee, sit and eat of my venison: a third lie, when he knew it came not from the field, but from the fold;

— that thy soul may bless me; as this was the thing in view, and it was the blessing of the Abrahamic covenant he craved. The disguise, which may have upset the whole plot, succeeded in misleading Isaac; and while giving his paternal blessing, the old man was roused into a state of high satisfaction and delight;

— the Targum Onkelos says

Yaakov said to his father, It is I, Eisov your firstborn. I have done as you told me. Rise, if you please [now], sit up [recline] and eat of my trapping so that your soul will bless me.

20 And Isaac said unto his son, “How is it that thou hast found it so quickly, my son?” And he said, “Because the Lord thy God brought it to me.”

— because the Lord thy God brought it to me; Jacob does not keep up his acting well here, for Isaac could not see anything providential in his success in hunting; hence may have helped to arouse Isaac’s suspicions, who immediately proceeds to examine him;

— the Targum Onkelos says

Yitzchok said to his son, How is it that you found it so quickly my son? He [Yaakov] said, Because Adonoy, your God, brought it about for me.

21 And Isaac said unto Jacob, “Come near, I pray thee, that I may feel thee, my son, whether thou be my very son Esau or not.” — Come near that I may feel thee;

— besides the answer, in a style very different from Esau’s way of thinking, Isaac was surprised at the short delay in bringing the savoury meat;

— the Targum Onkelos says

Yitzchok said to Yaakov, Come close, if you please [now], and let me touch you, my son. Are you my son Eisov or not?

22 And Jacob went near unto Isaac his father; and he felt him and said, “The voice is Jacob’s voice, but the hands are the hands of Esau.” — but the hands are the hands of Esau; are like them, being hairy as they;

— the Targum Onkelos says

Yaakov came close to Yitzchok, his father, and he [Yitzchok] touched him. He said, The voice is the voice of Yaakov, but the hands are the hands of Eisov.

or, as the Targum of Jonathan says, “the feeling of the hands is as the feeling of the hands of Esau;” they feel like them;

23 And he discerned him not, because his hands were hairy, as his brother Esau’s hands; so he blessed him. — and he discerned him not; as he could not see,

— and, though he had his hearing, and thought the voice was like Jacob’s, he might perhaps imagine there might be an alteration in Esau’s voice, coming in haste and weary from the fields; hence he thought it safe to trust to that;

— the Targum Onkelos says

He [Yitzchok] did not recognize him because his hands were like those of Eisov, his brother—they were hairy—and [thus] he blessed him.

24 And he said, “Art thou my very son Esau?” And he said, “I am.” — and he said, I am; in order to excuse Jacob from lying, that he does not say, “I am Esau” since it is an answer to Isaac’s question, with a design to deceive him; and he intended that he should understand him as he did, that he was really Esau;

— the Targum Onkelos says

He said, Are you indeed my son, Eisov? [Yaakov] said, [Behold] I am.

25 And he said, “Bring it near to me, and I will eat of my son’s venison, that my soul may bless thee.” And he brought it near to him, and he ate; and he brought him wine, and he drank. — and he brought him wine, and he drank; and so was comfortably refreshed, and in a good temper and disposition of mind to confer the blessing;

— the Targum Onkelos says

He said, Bring it close to [before] me and I will eat from my son’s trappings, so that my soul will bless you. He brought it close to him and he ate. He [then] brought him wine and he drank.

— the Targum of Jonathan indicates all these are ordained from the foundation of the world: and now Isaac does not seem to have grasped the full meaning of the prophecy, “The older shall serve the younger:”

And he said, Draw near, and I will eat of my son’s venison, that my soul may bless thee. And he approached him, and he ate; and he had no wine; but an angel prepared it for him, from the wine which had been kept in its grapes from the days of the beginning of the world; and he gave it into Jakob’s hand, and Jakob brought it to his father, and he drank.

— or for a more modern version:

“And he said, ‘Bring it to me, and I will eat of my son’s game, so that my soul may bless you.’ So he brought it to him, and he ate; and there was no wine with him. And an angel was sent to him, and brought wine that had been stored in its grapes since the days of the creation of the world, and he placed it in Jacob’s hand. Jacob brought it to his father, and he drank.”

26 And his father Isaac said unto him, “Come near now, and kiss me, my son.” — Come near now, and kiss me, my son: this was the solemn preparation for the giving of the blessing;

— Isaac’s suspicions had now quite passed away; he had eaten and drunk, and the time had now come for the decision his son was to inherit the promise;

— the Targum Onkelos says

His father Yitzchok said to him, Come close to me [now] and kiss me, my son.

27 And he came near, and kissed him; and he smelled the smell of his raiment, and blessed him and said, “See, the smell of my son is as the smell of a field which the Lord hath blessed.

— now Isaac had eaten the venison, and drank of the wine; and the smell of my son is as the smell of a field which the Lord hath blessed; and gave him the spiritual power to impart the “blessing of Abraham” to the son;

— the Targum Onkelos says

He came close and kissed him. He [Yitzchok] smelled the fragrance of his garments, and he blessed him. He said, See, my son’s fragrance is like the fragrance of a field blessed by Adonoy.

— the Targum of Jonathan says

“And he drew near and kissed him; and he smelled the fragrance of his garments and blessed him, and said: ‘See, the fragrance of my son is like the fragrance of the incense of spices which is destined to be offered on the Mountain of the House of the Sanctuary [the Temple Mount], which is called the Field that the Lord has blessed, and where He has desired to cause His Shekhinah to dwell.'”

28 Therefore God give thee of the dew of heaven, and the fatness of the earth, and plenty of corn and wine. — God give thee of the dew and rain of heaven; or he was blessed of God, and the his posterity should inherit the land of milk and honey;

— and the fatness of the earth, and plenty of corn and wine; the word and ordinances, which God has given to his Jacob and Israel in all ages, as he has not given to other people;

— the Targum Onkelos says

And may God give you of the dew of heaven, and of the fatness [riches] [goodness] of the land, and abundance of grain and wine.

29 Let people serve thee, and nations bow down to thee; be lord over thy brethren, and let thy mother’s sons bow down to thee. Cursed be every one that curseth thee, and blessed be he that blesseth thee!” — let people serve thee; let peoples (‘am·mîm) serve thee;

— up to this point the blessing had been general, but now Isaac bestows the birthright, carrying with it widespread dominion, precedence over all other members of the family, and special blessedness;

— the Targum Onkelos says

Peoples will serve you and nations bow to you [kingdoms will be subservient to you]. Be master over your brothers, and your mother’s sons will bow to you. Those who curse you are [will be] cursed, and those who bless you are [will be] blessed.

— let thy mother’s son bow down to thee; one case of how and when this was fulfilled, on Genesis 25:23 refering to Esau, Jacob’s brother, serving the younger; and his mother’s sons;

— the Targum of Jonathan says “all the sons of Esau, and kingdoms bend before thee, all the sons of Keturah;”

Let peoples be subject to thee, all the sons of Esau, and kingdoms bend before thee, all the sons of Keturah; a chief and a ruler be thou over thy brethren, and let the sons of thy mother salute thee. Let them who curse thee, my son, be accursed as Bileam bar Beor; and them who bless thee be blessed as Mosheh the prophet, the scribe of Israel.

— the Targum of Jerusalem interprets “thy mother’s sons” inclusive of the sons of Laban, his mother’s brother, the Arabians and Syrians; and “all the sons of Ishmael:” which will be more fully accomplished when the kingdoms of this world shall become the kingdoms of our Lord; when the Messiah, the King of the whole earth, arrives;

Let peoples serve before thee, all the sons of Esau: all kings be subject to thee, all the sons of Ishmael: be thou a chief and a ruler over the sons of Keturah: all the sons of Laban the brother of thy mother shall come before thee and salute thee. Whoso curseth thee, Jakob, my son, shall be accursed as Bileam ben Beor; and whoso blesseth thee shall be blessed as Mosheh the prophet and scribe of Israel.

30 And it came to pass, as soon as Isaac had made an end of blessing Jacob, and Jacob was yet scarcely gone out from the presence of Isaac his father, that Esau his brother came in from his hunting.

— and it came to pass, as soon as Isaac had made an end of blessing Jacob; that Esau came in from his hunting;

— the Targum Onkelos says

It was when Yitzchok had finished blessing Yaakov, and Yaakov had just left the presence of Yitzchok, his father, that Eisov came back from his trapping.

31 And he also had made savory meat, and brought it unto his father and said unto his father, “Let my father arise and eat of his son’s venison, that thy soul may bless me.”

— Esau, returned just as Jacob was leaving Isaac’s presence; he, also made from venison, there would still be some considerable delay efore the captured game was made into savoury meat;

— the Targum Onkelos says

He too made a tasty dish and brought it to his father. He said to his father, Let my father rise and eat of his son’s trapping, that your soul may bless me.

— the Targum of Jonathan reveals how God could have interfered should Rebekah had trusted in the Lord and let him run his will, saying

And the Word of the Lord had impeded him from taking clean venison; but he had found a certain dog, and killed him, and made food of him, and brought to his father, and said to his father, Arise, my father, and eat of my venison, that thy soul may bless me.

32 And Isaac his father said unto him, “Who art thou?” And he said, “I am thy son, thy firstborn, Esau.” — who art thou? hearing another voice more like Esau’s than what he had heard before surprised him, and therefore in haste puts this question;

— and he said, I am thy son, thy firstborn Esau; all which was true in a sense; he was his son, and he was Esau, and he was his firstborn by nature, but not by right, for he had already sold his birthright;

— the Targum Onkelos says

Yitzchok, his father, said to him, Who are you? He said, I am your son, your firstborn, Eisov.

33 And Isaac trembled exceedingly and said, “Who? Where is he that hath taken venison and brought it me, and I have eaten of all before thou camest, and have blessed him? Yea, and he shall be blessed.”

— Isaac trembled exceedingly; or “trembled with a great trembling;” he was amazed, shocked, astonished; shell-shocked and astonished to consider God’s overruling providences;

— I have blessed him, and he shall be blessed; he might have recalled it; but now, at last, he is sensible he was in an error when he designed it for his firstborn, Esau;

— the Targum Onkelos says

Yitzchok was seized with a powerful trembling [Yitzchok was astonished with great astonishment]; and said, Who, then, is he who trapped [deer] and brought it to me. I ate all of it before you came, and I blessed him. He shall be blessed.

— the Targum of Jonathan says

And Izhak was moved with great agitation when he heard the voice of Esau, and the smell of his food rose in his nostrils as the smell of the burning of Gehennam; and he said, Who is he who hath got venison, and come to me, and I have eaten of all which he brought me before thou camest, and I have blessed him, and he shall, too, be blessed?

34 And when Esau heard the words of his father, he cried with a great and exceeding bitter cry, and said unto his father, “Bless me, even me also, O my father!”

— he cried with a great and exceeding bitter cry, not for repentance of his former sin, in despising his birthright, but for grief at his great loss therein, because God would not suffer him to be perjured in keeping that birthright blessing which he had sold and sworn away;

— Bless me, even me also, O my father, that is, thou art my father no less than his; I claim a share in thy blessing; one at least equal to what thou hast given Jacob, if not a greater, as being the firstborn;

— but Esau despised his birthright, as if quenching the spirit, and consciously selling his birthright off for a bowl of soup. For a close parallel, see Offending the Holy Spirit, the unpardonable sin; once it is sold, it couldn’t be redeemed;

— the Targum Onkelos says

When Eisov heard his father’s words, he wailed a most loud and bitter cry, and he said to his father, Bless me too, my father.

35 And he said, “Thy brother came with subtlety, and hath taken away thy blessing.” — thy brother came with subtilty, as if it was wisely and prudently managed; but the word signifies fraud and deceit;

— the Targum Onkelos says

[Yitzchok] said, Your brother came with cunning [wisdom] and he took [received] your blessing.

36 And he said, “Is not he rightly named Jacob [that is, A supplanter]? For he hath supplanted me these two times: he took away my birthright, and behold, now he hath taken away my blessing.” And he said, “Hast thou not reserved a blessing for me?”

— and Esau said: for he hath supplanted me these two times; to supplant another is to put his foot under the heel of another; he took away my birthright; which is not true, for Jacob did not take it away from him either by force or fraud;

— for Esau had despised and made light of his birthright, and even sold it for a bowl of pottage; for by now he should convinced that it was the design of Providence that the spiritual blessing should fall on the line of Jacob;

— the Targum Onkelos says

[Eisov] said, Is he not rightly called Yaakov? [He is rightly called Yaakov] He has deceived me twice; he took my birthright, and now he has taken [received] my blessing. He said, Have you not saved a blessing for me?

37 And Isaac answered and said unto Esau, “Behold, I have made him thy lord, and all his brethren have I given to him for servants; and with corn and wine have I sustained him. And what shall I do now unto thee, my son?”

— behold, I have made him thy lord; the lord of his posterity, who would be subdued and become tributary to his seed; and all his brethren have I given to him for servants;

— the Edomites, who sprung from his brother Esau, who, according to this prophetic blessing, became servants to David, who was a son of Jacob’s; but that is only a microcosm of a latter-day Monroe Doctrine; for more see, “Who are the children of Esau?”

— and what shall I do now unto thee, my son? what are the leftovers for you, my sons? what can be bestowed upon thee? there is nothing left; dominion over others, even over all nations, yea, over thyself and thy posterity, and plenty of all good things, are given already to Jacob; what is there to be done for thee, or thou canst expect?

— the Targum Onkelos says

Yitzchok replied and said to Eisov. Behold, I have made him your master, and all his brothers I have given him as slaves. I have sustained him with grain and wine. Where? [Here.] What can I do for you, my son?

38 And Esau said unto his father, “Hast thou but one blessing, my father? Bless me, even me also, O my father!” And Esau lifted up his voice and wept. — has thou but one blessing? only one son could inherit the birthright?

— bless me, even me also, O my father: one that is equal to what has been given my brother: and even lower earthly blessings would avail little if Esau’s descendants were to be subject to the dominion of his other brother’s posterity;

— with Esau must now be contented with his lot; he lifted up his voice and wept; in order to move the affections of his father, and to prevail upon him to reverse the blessing he had bestowed on Jacob, and give it to him;

— but he could not bring his father to change his mind, and revoke the blessing, and give it him, despite all his crying and tears. For a close parallel, see Offending the Holy Spirit, the unpardonable sin; once it is lost, nothing could be redeemed;

— the Targum Onkelos says

Eisov said to his father, Do you have only one blessing, my father? Bless me too, my father, and Eisov raised his voice and wept.

39 And Isaac his father answered and said unto him, “Behold, thy dwelling shall be from the fatness of the earth, and of the dew of heaven from above. — for the blessing was a prophecy, and that not merely in the case of the posterity of Esau, but in that of Jacob also;

— since Isaac said (Genesis 27:37) he had given the posterity of Jacob the blessing of the super-abundance of corn and wine, he could not possibly promise Esau also fat fields and the dew of heaven; thus his “blessing” is actually away from it;

— the Targum Onkelos says

Yitzchok, his father replied and said to him, Behold the fatness [richness] [goodness] of the earth shall be your dwelling, and of the dew of heaven from above.

40 And by thy sword shalt thou live, and shalt serve thy brother; and it shall come to pass when thou shalt have the dominion, that thou shalt break his yoke from off thy neck.”

— by thy sword or weapon shalt thou live; by violence and rapine, in an unquiet and military posture, troubling others, and forced to defend thyself;

— and it shall come to pass, when thou shalt have the dominion; not over the Israelites, the posterity of Jacob, which the Edomites, Esau’s posterity, never had; but when they should get a greater degree of strength, power, authority, and dominion in the world; “that thou shalt break his yoke from off thy neck;”

— the Targum Onkelos says

You shall live by your sword, and you shall serve your brother. When you have cause to be grieved [When his sons will transgress the words of the Torah], you will throw off his yoke from your neck.

— the Targum of Jerusalem reveals the circumstances how Esau would break his yoke from his brother, Jacob

“And by your weapons of war you shall live, and before your brother you shall be subjected. And it shall be that when the sons of Jacob labor in the Torah and observe the commandments, they shall place the yoke of subjection upon your neck. But when the sons of Jacob prevent themselves from laboring in the Torah and do not observe the commandments, behold, then you shall break the yoke of their subjection from off your neck.”

— the Targum of Jonathan says

“And upon your sword you shall rely, going everywhere and subduing; and to your brother you shall be subjected. And it shall be: if you are wicked and cause his sons to descend from observing the commandments of the Torah, then you shall break the yoke of his subjection from off your neck.”

41 And Esau hated Jacob because of the blessing wherewith his father blessed him. And Esau said in his heart, “The days of mourning for my father are at hand. Then will I slay my brother Jacob.”

— the days of mourning for my father are at hand; Esau evidently expected that his father’s death was near, and such also was Isaac’s own expectation (Genesis 27:2); but he recovered, and lived forty-four years after this;

— perhaps on this account another translation has been suggested, namely, “Days of mourning for my father are at hand: then I will slay Jacob” in fact, there ais a bidding for time; in fact millennia, when ther posterity of Jacob had gone astray with the laws of God;

— the Targum Onkelos says

Eisov hated Yaakov because of the blessing with which his father blessed him, and Eisov said in his heart, The mourning days for my father are approaching. I will then kill my brother, Yaakov.

— the Targum Jonathan reveals Esau’s delayed intent of killing his brother Jacob; in fact it is a latter-day prophecy for the house for Esau against the house of Jacob:

“And upon thy sword shalt thou depend, entering at every place: yet thou shalt be supple and credulous, and be in subjection to thy brother [Jacob]; but it will be that when his sons [the modern children of Israel] become evil, and fall from keeping the commandments of the law, thou shalt break his yoke of servitude from off thy neck….and then will I kill Jakob my brother, and will be found the killer and the heir”  Genesis 27:40-41 Jonathan (abridged)

— or, for a more modern translation:

“And by your sword shall you live, you will go to every place, and wander, and you will be subject to your brother. But if his descendants abandon the commandments of the Torah, then you will break his yoke from your neck.”

“And Esau harbored hatred in his heart against Jacob his brother because of the blessing with which his father had blessed him. And Esau said in his heart, ‘I will not do as Cain did, who killed Abel during their father’s lifetime and then their father had another son, Seth. Rather, I will wait until the days of mourning for my father have passed, and then I will kill Jacob my brother, and I will be the sole heir'” (unabridged).

— a bit more on what this phase means “and will be found the killer and the heir;” that is, by delaying and waiting for Jacob’s killing, Esau hopes he would both be the killer and the only heir. Hence Esau harboured thoughts he would not do that immediately; but waits until they forget God’s law, until today’s hardcore “liberal democracies” that championed LGBTqia’s rights and wokeism;

— instead, he would delay the killing of Jacob until the death of Isaac, for if Isaac is dead, he had no chance of fathering another son; so that when Jacob is killed after Isaac is dead, Esau will become the only son, hence the sole heir.

42 And these words of Esau her elder son were told to Rebekah; and she sent and called Jacob her younger son, and said unto him, “Behold, thy brother Esau doth comfort himself concerning thee, purposing to kill thee.

— Rebekah hearing this, advises Jacob to flee to Laban her brother, and await the abatement of his brother’s anger; said unto him, behold, thy brother Esau, as touching thee, doth comfort himself;

— purposing to kill thee; he has laid a scheme for it, and comforts himself with this thought, that he shall be able to accomplish it, and so be the heir of the promise, and get the blessing; 

— the Targum Onkelos says

Rivkah was informed about the words of Eisov, her older son, and she sent [a messenger] to call Yaakov, her younger son, and she said to him. Behold, your brother Eisov is consoled through you [lying in wait for you], [for he intends] to kill you.

— the Targum Jonathan reveals the work of the Holy Spirit

And the words of Esau her elder son, who thought in his heart to kill Jakob, were shown by the Holy Spirit to Rivekah, and she sent, and called Jakob her younger son, and said to him, Behold, Esau thy brother lieth in wait for thee, and plotteth against thee to kill thee.

43 Now therefore my son, obey my voice; and arise, flee thou to Laban my brother in Haran, — obey my voice; and arise, flee thou to Laban my brother, to Haran; where Laban her brother, dwelt;

— the Targum Onkelos says

Now my son listen to [accept] me. Get up and flee to Lavan, my brother, to Charan.

44 and tarry with him a few days until thy brother’s fury turn away — tarry with him one or two years; but instead of so short a time Jacob stayed there twenty years,

— and perhaps Rebekah never saw him anymore, being dead before he returned; after this account, no more mention is made of her;

— the Targum Onkelos says

Remain with him a short time until your brother’s fury has subsided.

45 until thy brother’s anger turn away from thee, and he forget that which thou hast done to him. Then I will send and fetch thee from thence. Why should I be deprived also of you both in one day?”

— and he forget that which thou hast done to him; in getting the blessing from him; being convinced that Jacob had done him no injury, and that he had no just cause of being angry with him, it being the will of God that he should have the blessing;

— the Targum Onkelos says

Until your brother’s rage toward you has subsided, and he has forgotten what you did to him. I will then send [for you] and bring you [back] from there. Why should I lose both of you on one day?

— the Targum Jonathan says

“Until your brother’s anger rests from you and he forgets what you have done to him; then I will send and bring you from there. Why should I be bereaved of both of you in one day? For [if] you are killed and he is banished—just as Eve was bereaved of Abel whom Cain killed, and both of them were banished from the presence of Adam and Eve for all the days of the lives of Adam and Eve.”

46 And Rebekah said to Isaac, “I am weary of my life because of the daughters of Heth. If Jacob take a wife of the daughters of Heth, such as these who are of the daughters of the land, what good shall my life do me?”

— if Jacob take a wife of the daughters of Heth; as Esau has done; this was not the thing she was afraid of; but if we use guile once, we shall be very ready to use it again;

— the Targum Onkelos says

Rivkah said to Yitzchok, I am disgusted with my life because of the daughters of Cheis. If Yaakov marries a woman of the daughters of Cheis, like these, from the daughters of the land, what is life [worth] to me.

Genesis 28

1 And Isaac called Jacob and blessed him, and charged him and said unto him, “Thou shalt not take a wife of the daughters of Canaan. — Isaac blessed Jacob; that is, purposely and designedly and in faith now confirmed that blessing to him, which before he had given him unknowingly;

— the Targum Onkelos says

Yitzchok called Yaakov and blessed him. He commanded him and said to him, Do not marry a woman of the daughters of Canaan.

Arise, go to Padanaram to the house of Bethuel thy mother’s father, and take thee a wife from thence of the daughters of Laban thy mother’s brother. — to the house of Bethuel thy mother’s father; who though now dead in all probability, yet the house and family went by his name;

— and take thee a wife from thence of the daughters of Laban thy mother’s brother: who had daughters unmarried, of which no doubt Isaac and Rebekah had knowledge, a correspondence being kept up between the two families, though at a great distance;

— the Targum Onkelos says

Set out and go to Padan Aram, to the house of Besueil, your mother’s father, and marry one of the daughters of Lavan, your mother’s brother.

And God Almighty bless thee, and make thee fruitful, and multiply thee, that thou mayest be a multitude of people; — Isaac called Jacob and blessed him; he entered fully into Rebekah’s feelings, and the burden of his parting counsel to his son was to avoid a marriage alliance with any but the Mesopotamian branch of the family;

— a multitude of people; a congregation of peoples; which may unite all into one body and make one nation, as the twelve tribes descending from Jacob did; or even into numerous nations as one, like NATO or EU today;

— the Targum Onkelos says

May the Almighty, Shaddai, bless you, make you fruitful and multiply you. May you become an assembly of peoples [tribes].

— the Targum Jonathan says

“And may God Almighty bless you with many possessions, and make you fruitful and multiply you into thirteen tribes; and may you be worthy of the Assembly of the members of the Sanhedrin, whose number is seventy, corresponding to the number of the nations.”

and give thee the blessing of Abraham to thee and to thy seed with thee, that thou mayest inherit the land wherein thou art a stranger, which God gave unto Abraham.”

— and give thee the blessing of Abraham, to thee, and to thy seed with thee; which was promised to Abraham, and was entailed upon Isaac and his seed, and now upon Jacob and his seed;

— that thou mayest inherit the land wherein thou art a stranger, which God gave to Abraham; the land between the two great rivers; which was given to Abraham by promise, but not in possession;

— the Targum Onkelos says

May He give you the blessing of Avraham, to you and to your descendants with you, that you may inherit the land of your dwelling which God gave to Avraham.

And Isaac sent away Jacob; and he went to Padanaram unto Laban, son of Bethuel the Syrian, the brother of Rebekah, Jacob’s and Esau’s mother. — and Isaac sent away Jacob; Rebekah only counseled, Isaac commanded: and Jacob went to Padan-aram unto Laban, son of Bethel the Syrian;

— the Targum Onkelos says

Yitzchok sent Yaakov on his way, and he went to Paddan Aram, to Lavan, son of Besueil the Aramean, the brother of Rivkah, mother of Yaakov and Eisov.

When Esau saw that Isaac had blessed Jacob, and sent him away to Padanaram to take him a wife from thence, and that as he blessed him he gave him a charge, saying, “Thou shalt not take a wife of the daughters of Canaan,”

— the Targum Onkelos says

Eisov saw that Yitzchok blessed Yaakov, and sent him to Paddan Aram, to find a wife there; and as he blessed him, he commanded him saying, Do not take a wife from the daughters of Canaan.

and that Jacob obeyed his father and his mother and had gone to Padanaram,

— the Targum Onkelos says

And Yaakov listened to [accepted] his father and mother, and went to Paddan Aram.

and Esau seeing that the daughters of Canaan pleased not Isaac his father — and Esau seeing that the daughters of Canaan pleased not Isaac his father; who he perceived was displeased with the daughters of Canaan, or that they were “evil in his eyes”

— the Targum Onkelos says

Eisov [thus] realized that the daughters of Canaan were evil in the eyes of Yitzchok, his father.

then went Esau unto Ishmael, and added unto the wives which he had Mahalath the daughter of Ishmael, Abraham’s son, the sister of Nebajoth, to be his wife. — and though Esau did not marry a “wife of the daughters of Canaan,” he married into a family which God had rejected; and took as a third wife Mahalath, a daughter of Ishmael;

— the Targum Onkelos says

Eisov [then] went to Yishmael, and took Mochalas, the daughter of Yishmael, the son of Avraham and sister of Nevayos, in addition to his other wives, for a wife.

10 And Jacob went out from Beersheba, and went toward Haran. — Jacob’s dream and vow; setting out on the way to Haran, he was overtaken by night, and slept in the field;

— the Targum Onkelos says

Yaakov left Beer Sheva and went toward Charan.

— the Targum Jonathan says

“Five miracles were performed for Jacob at the time he went out from Beer-sheba:

  • The first miracle: The hours of the day were shortened and the sun set before its time, because the Word [of the Lord] desired to speak with him.
  • The second miracle: The four stones that he had placed for his pillow, he found in the morning to have become a single stone.
  • The third miracle: The stone which all the flocks used to gather to roll from the mouth of the well, he rolled it away with one of his arms.
  • The fourth miracle: The well overflowed and the waters rose to its surface, and it continued to overflow all the days that he was in Haran.
  • The fifth miracle: The earth shrunk before him [Kefitzat HaDerech], and on the very day that he set out, he arrived at Haran.”

— the Targum Jerusalem says

“Five miracles were performed for our father Jacob at the time he went out from Beer-sheba to go to Haran:

  1. The first miracle: The hours of the day were shortened for him, and the sun set for him not at its usual time, because the Word [of the Lord] desired to speak with him.
  2. The second miracle: As soon as our father Jacob lifted his feet from Beer-sheba, the earth shrunk before him and he found himself sitting in Haran.
  3. The third miracle: Regarding the stones that our father Jacob took in the evening and placed beneath the foundation of his head—when he arose in the morning, he found them all to be a single stone; and that is the stone he set as a pillar and poured oil upon its top.
  4. The fourth miracle: Whereas all the shepherds used to gather around the stone to roll it from the mouth of the well and were unable to do so, when our father Jacob came, he lifted it with one of his hands and watered the sheep of Laban, his mother’s brother.
  5. The fifth miracle: As soon as our father Jacob lifted the stone from the mouth of the well, the well overflowed and continued to overflow for twenty years, all the days that our father Jacob dwelt in Haran.

These are the five miracles performed for our father Jacob at the time he went out from Beer-sheba to go to Haran.”

11 And he alighted upon a certain place, and tarried there all night, because the sun was set; and he took of the stones of that place and put them for his pillows, and lay down in that place to sleep.

— he lighted upon the place; Jacob’s Dream at Bethel as it lay twelve miles north of Jerusalem, in the mountains of Ephraim, Jacob had already been at least four days on the route;

— the Targum Onkelos says

He reached the place and spent the night there because the sun had set. He took some of the stones of that place, and arranged them around his head, and lay down [to sleep] in that place.

12 And he dreamed, and behold, a ladder was set up on the earth, and the top of it reached to heaven; and behold, the angels of God were ascending and descending on it. — behold a ladder set up on the earth; this might represent the providence of God,

— by which there is a constant correspondence kept up between heaven and earth; the counsels of heaven are executed on earth, and the affairs of this earth are all known in heaven;

— angels are employed as ministering spirits to serve all the designs of Providence, and the wisdom of God is at the upper end of the ladder, directing all the motions of second causes to his glory;

— the Targum Onkelos says

He dreamed, and behold a ladder was set up on [planted in] the earth and the top of it reached toward heaven; and behold angels of Elohim were ascending and descending on it.

— the Targum of Jonathan has futher insight as this:

“And he dreamed, and behold, a ladder was set upon the earth, and its top reached to the heavens.

And behold, the two angels who went to Sodom were driven from their places because they had revealed the secrets of the Lord of the world, and they were wandering until the time when Jacob left his father’s house. They accompanied him in kindness until Bethel.

And on that day, they ascended to the heavens and said, ‘Come and see Jacob, the righteous, whose image is engraved upon the throne of glory, which you have longed to see.’ Thus, the other holy angels of the Lord descended to look upon him.”

Rashi explains: ascending and descending: Ascending first and afterwards descending. The angels who escorted him in the [Holy] Land do not go outside the Land, and they ascended to heaven, and the angels of outside the Holy Land descended to escort him.[From Gen. Rabbah 68:12]

13 And behold, the Lord stood above it and said, “I am the Lord God of Abraham thy father and the God of Isaac: The land whereon thou liest, to thee will I give it, and to thy seed. — and behold, the Lord stood above it; ordering, directing, and overruling all things in Providence,

— for the glory of his name and the good of his people; the land whereon thou liest, to thee will I give it, and to thy seed; meaning not that small pittance of land only on which his body then lay, and which it covered;

— but all the land of which it was a part, not just the land of Canaan; but even the whole land between the two great rivers, the Nile and the Euphrates;

— the Targum Onkelos says

And behold [the Glory of] Adonoy stood over him, and said, I am Adonoy, God of Avraham, your father, and God of Yitzchok. The land upon which you are lying, I will give to you and to your descendants.

14 And thy seed shall be as the dust of the earth, and thou shalt spread abroad to the west and to the east, and to the north and to the south; and in thee and in thy seed shall all the families of the earth be blessed.

— and thou shalt spread abroad to the west; or “the sea” beyond the Mediterranean sea, which was west of the land of Canaan: and to the east, and to the north, and to the south;

— that is, scattered across the whole world; the meaning is, that his posterity should be numerous, and break out and spread themselves like a flood of water, and reach to the utmost bounds of the land in all directions;

— the Targum Onkelos says

Your descendants shall be [many] as the dust of the earth. You shall spread [be strong] to the west, to the east, to the north and to the south. Through [Because of] you shall be blessed all the families of the earth, and through [because of] your descendants.

15 And behold, I am with thee, and will keep thee in all places whither thou goest, and will bring thee again into this land; for I will not leave thee, until I have done that which I have spoken to thee of.”

— and will bring thee again into this land; with details in Ezekiel 37 – Return of the Whole House of Israel;

— the Targum Onkelos says

Behold, I am with you [My Word is your support], and I will guard you wherever [every place] you go, and I will bring you back to this land. I will not forsake you until I have done that which I have spoken for you.

16 And Jacob awaked out of his sleep, and he said, “Surely the Lord is in this place, and I knew it not.” — surely the Lord is in this place; I knew it not; Jacob did not think or expect to meet God in such a place, and Jacob called the place Bethel;

— the Targum Onkelos says

Yaakov awoke from his sleep, and said, In truth, [the Glory of] Adonoy is [dwells] in this place, and I did not know it [would not have known it].

17 And he was afraid and said, “How fearsome is this place! This is none other than the house of God, and this is the gate of heaven.” — and Jacob was afraid; not with a servile but filial fear; not with a fear of the wrath and displeasure of God, but with a fear of his Providence and goodness;

— the Targum Onkelos says

He was afraid and said, How awesome is this place! This is none other than the house of Elohim [not a regular place but a place where it is the will of Elohim to receive prayers], and this is the gate of heaven.

18 And Jacob rose up early in the morning, and took the stone that he had put for his pillows, and set it up for a pillar and poured oil upon the top of it.

— and poured it upon the top of the stone, as a token of his consecration thereof to this use to be a memorial of God’s favour to him. Oil was used in sacrifices, and in the consecration of persons and places;

— the Targum Onkelos says

Yaakov rose early in the morning and took the stone that he had placed at his head; and he set it as a monument, and poured oil on its top.

19 And he called the name of that place Bethel [that is, The house of God]; but the name of that city was called Luz at the first.

— and he called the name of that place Bethel; the house of God, which he took this place; it was later selected by Jeroboam as one of the high places at which he set up the golden calves;

— the Targum Onkelos says

He named that place Beis Eil, but Luz was the original name of the city.

20 And Jacob vowed a vow, saying, “If God will be with me and will keep me in this way that I go, and will give me bread to eat and raiment to put on, — Jacob made a solemn vow on this occasion; it involves in its obligation, however, only one party, and is the spontaneous act of that party;

— the Targum Onkelos says

Yaakov made a vow, saying, If [the Word of] Elohim will be with me [my support], and guards me on this path that I am going, and gives me bread to eat and clothing to wear;

21 so that I come again to my father’s house in peace, then shall the Lord be my God. — so that I come again to my father’s house in peace; in safety from Esau, and all other enemies, as God promised him he should: then the Lord shall be my God; 

— the Targum Onkelos says

And if I return in peace to my father’s house, and [the Word of] Adonoy will be my God;

22 And this stone which I have set for a pillar shall be God’s house; and of all that Thou shalt give me I will surely give a tenth unto Thee.”

— and this stone, which I have set for a pillar, it shall be in God’s house; building an altar on it with some others, and sacrificing to God on it; and wherever God is worshipped, that place is his house, be it what or where it will; and Jacob did as he promised to do;

The Stone of Jacob: it shall be set as a pillar in God’s house: that is, in the Temple in Jerusalem,
not desecrated under a chair in a palace in either London nor Edinburgh

— and of all that thou shalt give me, I will surely give the tenth unto thee; for the support of his worship; for the maintenance of such that were employed in it; for the provision of sacrifice, and for the relief of the poor, or for any use or service in which God might be glorified;

— the Targum Onkelos says

[Then] this stone which I have set [as] a monument will become a House of God [place where I will worship upon it before God], and of all that You give, I will surely give a tenth to [before] You.

US Naval Power close to Obsolete

•April 1, 2026 • Leave a Comment
THE US NAVY CAN NO LONGER ENGAGE IN NAVAL WAFARE

Prada • March 31, 2026

After the conflicts with Iran and Yemen, there is no way that the United States will ever go to war with China over Taiwan. The era of naval dominance has come to an end and has been replaced by drone warfare.

Missiles are often very expensive and can be intercepted whereas drones are far cheaper and can maneuver air and naval defenses a lot more easily. This of course means that US Naval Assets in the Middle East are in danger.

Iranian Shaheds are armed with modern anti-jamming chips from Russia

The Strait of Hormuz and the Red Sea were not held down by Iranian or Yemeni missiles but by drones like the Samad-3 and Shahed-136. The Iranian Shaheds are now armed with anti-jamming chips from Russia.

Even in the case of the largely land-based NATO proxy war in Ukraine, the Russians have held down the Donbass and largely degraded the capabilities of Ukrainian forces through the use of Geran drones.

They have rendered attack helicopters obsolete, forced relocations and even hovered over Kiev for long periods of time without detection, which further exposes Ukraine’s grossly weak and inadequate air defenses.

If the Iranians and Yemenis can do this damage to the United States all in just a matter of four weeks, the Chinese most certainly could do more and the Russians already have.

Genesis (25-26)

•March 31, 2026 • Leave a Comment

After Jacob had stolen his birthright, Esau pleaded with Isaac his father if he could still bless him.

Then Isaac his father answered and prophesied, saying, “Thy dwelling shall be away from the fatness of the earth; and away from the dew of heaven above; Genesis 27:39

“And by your sword shall you live, you will go to every place, and wander, and you will be subject to your brother. But when his descendants abandon the commandments of the Torah, then you will break his yoke from your neck.”

“And Esau harbored hatred in his heart against Jacob, his brother, because of the blessing with which his father had blessed him. And Esau said in his heart, ‘I will not do as Cain did, who killed Abel during their father’s lifetime and then their father had another son, Seth. Rather, I will wait until the days of mourning for my father have passed, and then I will kill Jacob my brother, and I will be the sole heir.'” Genesis 27:41-42 Targum (Jonathan)

This is looking at the Scriptures with a blast of fresh air, because the deeper you dig, the more you’ll find!

“The anger of the Lord shall not return, until He has executed and until He has performed the intent of His thought; in the latter days ye shall understand it perfectly.” Jeremiah 23:20

Genesis 25

1 Then again Abraham took a wife, and her name was Keturah. — and her name was Keturah; who she was, or of what family, is not said. Abraham was 137 years of age at Sarah’s death, and lived to be 175;

— it is quite possible that, left solitary by Isaac’s marriage, he took Keturah to wife, and had by her six sons; yet Keturah is called Abraham’s concubine, or secondary wife (1Ch 1:32)

— the Targum Onkelos says

Avraham again took a wife. Her name was Keturah.

— the Targum Jerusalem says

She is Hagar, who had been tied to him from the beginning.

— the Targum of Jonathan says that Keturah was Hagar

“And Abraham added and took a wife, and her name was Keturah; she is Hagar, who had been bound to him from the beginning.”

— Targum Pseudo-Jonathan (along with Rashi and Midrash Genesis Rabbah 61:4) explicitly identifies Keturah as Hagar; which could explain why she was still called Abraham’s concubine, 1Ch 1:32. The logic is that after Sarah died and Isaac was married, Abraham returned to his original concubine.

And she bore him Zimran and Jokshan and Medan, and Midian and Ishbak and Shuah. — Midian is the one son of Keturah who had a great future before him, for his race became famous traders (Genesis 37:28); Jethro, the father-in-law of Moses, belonged to them (Exodus 2:15-16)

— the Targum Onkelos says

She bore him Zimran, Yokshon, Medan, Midian, Yishbok, and Shuach.

And Jokshan begot Sheba and Dedan. And the sons of Dedan were Asshurim and Letushim and Leummim. — Asshurim, and Letushim, and Leummim; these are certainly not the names of men, but of the three tribes;

— the Targum Onkelos says

Yokshon fathered Shevah and Dedan. The sons of Dedan were Ashurim [those who dwell in camps], Letushim [those who dwell in tents] and Leumim [those who dwell on islands].

And the sons of Midian: Ephah and Epher, and Hanoch and Abidah and Eldaah. All these were the children of Keturah. — they to be sons of Abraham by Keturah, when they were his actually grandchildren;

— the Targum Onkelos says

The sons of Midian were Eiphah, Eipher, Chanoch, Avidah and Eldoah. All these were children of Keturah.

And Abraham gave all that he had unto Isaac. — And Abraham gave all that he had to Isaac; as he was bound to do, not only in justice to Sarah his first wife, but also to Rebekah, who married Isaac upon this assurance;

— the Targum Onkelos says

Avraham gave all that he possessed to Yitzchok.

But unto the sons of the concubines whom Abraham had, Abraham gave gifts; and while he yet lived he sent them away from Isaac his son, eastward unto the east country.

— but unto the sons of the concubines; that is, of Hagar and Keturah; migrated to “the east country,” that is, Arabia and Southern Mesopotamia;

— the Targum Onkelos says

To the sons of the concubines that Avraham had, Avraham gave gifts. He sent them away from Yitzchok, his son, while he [Avraham] was still alive. [He sent them] eastward to the Land of the East.

And these are the days of the years of Abraham’s life which he lived, a hundred threescore and fifteen years.

— Abraham’s years were a hundred and seventy-five; he survived Sarah thirty-eight years, and Isaac’s marriage thirty-five, and Jacob and Esau must how be fifteen years of age at this time;

— the Targum Onkelos says

These are the days of the years of Avraham which he lived, one hundred years, seventy years and five years.

Then Abraham gave up the ghost and died in a good old age, an old man and full of years, and was gathered to his people.

—‘full of years’ in the original it is only, “and full” and does not seem to be a mere synonym for longevity; but appreciating all the good and unpleasantness of life, much like Job and David also had;

— the Targum Onkelos says

Avraham expired and died in a good old age, old and satisfied [and in the fullness of days], and he was gathered to his people.

And his sons Isaac and Ishmael buried him in the cave of Machpelah, in the field of Ephron the son of Zohar the Hittite, which is before Mamre,

— none of the six sons of Keturah were present; and had no particular blessing bestored upon them; perhaps they were apparently already sent far away into the far end of Arabia, while Ishmael was nearer at Paran;

— the Targum Onkelos says


His sons Yitzchok and Yishmael buried him in the Machpeilah cave, in the field of Ephron, son of Tzochar, the Chitite, which faces Mamrei.

10 the field which Abraham purchased from the sons of Heth. There was Abraham buried, and Sarah his wife. — there was Abraham buried, and Sarah his wife; Sarah had been buried there thirty eight years before, which was the reason why his sons buried, him there;

— the Targum Onkelos says

[This was] the field that Avraham purchased from the sons of Cheis. Avraham and his wife, Sarah, were buried there.

11 And it came to pass after the death of Abraham, that God blessed his son Isaac; and Isaac dwelt by the well Lahairoi. — God blessed Isaac; for the blessing of Abraham did not die with him, but was perpetuated to his posterity, and especially to the children of the promise;

— the Targum Onkelos says

After Avraham died, Elohim blessed his son Yitzchok. Yitzchok lived near Be’er Lachai Ro’i [the well at which a living angel appeared].

— the Targum of Jonatham adds some complexities, saying:

And because Abraham had not designed to bless Ishmael, therefore he blessed not Isaac; for had he blessed Izhak and not Ishmael, it would have kept them in enmity.

But, after the death of Abraham, the Lord blessed Isaac; and Isaac dwelt near the well at which was revealed the glory of the Living and Eternal One, who seeth and is not seen.

— the Targum fills the silence by explaining Abraham’s dilemma. Abraham loved both sons; he knew the primary blessing belonged to Isaac, but he feared that a public formal blessing of Isaac would incite Ishmael’s enmity, a grudge or hatred. To maintain peace in the family while he was alive, Abraham refrained from blessing either.

12 Now these are the generations of Ishmael, Abraham’s son, whom Hagar the Egyptian, Sarah’s handmaid, bore unto Abraham. — Ishmael had twelve sons, whose families became distinct tribes; they populated a very large country that lay between Egypt and Assyria, called Arabia;

— the Targum Onkelos says

These are the descendants of Yishmael son of Avraham, whom Hagar, the Egyptian, Sarah’s slave, bore to Avraham.

13 And these are the names of the sons of Ishmael, by their names, according to their generations: the firstborn of Ishmael, Nebajoth; and Kedar and Adbeel and Mibsam,

— the firstborn of Ishmael, Nebajoth: mentioned in Isaiah 60:7; and from whence a people of the Arabs are called Nabathaeans, and their country Nabathaea; they inhabit the town and capital at Petra;

— the Targum Onkelos says

These are the names of Yishmael’s sons, by their names according to their birth. Nevayos was Yishmael’s first born, [he also had] Keidar, Adbeil and Mivsom,

14 and Mishma and Dumah and Massa,

— the Targum Onkelos says

Mishma, Dumah and Masa,

15 Hadar and Tema, Jetur, Naphish, and Kedemah.

— the Targum Onkelos says

Chadad, Teima, Yetur, Nofish and Keidmah.

16 These are the sons of Ishmael, and these are their names, by their towns and by their castles, twelve princes according to their nations. — twelve princes according to their nations; these were princes, or heads of tribes, and there were twelve of them;

— the Targum Onkelos says

These are the sons of Yishmael, and these are their names in their open villages and in their fortified strongholds, twelve princes in their nations.

17 And these are the years of the life of Ishmael, a hundred and thirty and seven years; and he gave up the ghost and died, and was gathered unto his people. — then Ishmael also died at the age of a hundred and thirty-seven; in the presence of all his brethren;

— the Targum Onkelos says

These are the years of Yishmael’s life, one hundred years, thirty years and seven years. He expired and died and was gathered to his people.

18 And they dwelt from Havilah unto Shur, that is before Egypt as thou goest toward Assyria; and he died in the presence of all his brethren. — and he died; they being present when he died, or in peace with them, in all prosperity along with them;

— the Targum Onkelos says

They lived from Chavilah to Shur [Chagar], which borders on Egypt, going towards Asshur. He lived in the presence of all his brethren.

19 And these are the generations of Isaac, Abraham’s son. Abraham begot Isaac.

— the Targum Onkelos says

And these are the descendants of Yitzchok son of Avraham. Avraham was the father of Yitzchok.

— the Targum of Jonatham says

“And these are the generations of Isaac, the son of Abraham: And because the features (Ikunin) of Isaac were similar to the features of Abraham, the people said, ‘Truly, Abraham fathered Isaac.'”

20 And Isaac was forty years old when he took Rebekah for a wife, the daughter of Bethuel the Syrian of Padanaram, the sister of Laban the Syrian.

— the daughter of Bethuel the Syrian, they were originally Chaldees, being descended from Nahor the brother of Abraham, who both were of Ur of the Chaldees; so Jacob is called a Syrian;

— the Targum Onkelos says

Yitzchok was forty years old when he took Rivkah, the daughter of Besueil, the Aramite, of Padan Aram, sister of Lavan, the Aramite, for a wife.

21 And Isaac entreated the Lord for his wife, because she was barren; and the Lord was entreated by him, and Rebekah his wife conceived. — and Isaac entreated the Lord for his wife; though God had promised to multiply his family, he prayed for it;

— the Targum Onkelos says

Yitzchok prayed to [before] Adonoy across from [opposite] his wife, for she was barren. Adonoy granted his prayer and his wife, Rivkah, conceived.

— the Targum of Jonathan says, that, after twenty years, Isaac took her and went with her to Mount Moriah, to the place where he was bound, and prayed that she might conceive; putting the Lord in mind of the promise he there made of the multiplication of Abraham’s seed; and Rebekah conceived; two sons at once;

22 And the children struggled together within her; and she said, “If it be so, why am I thus?” And she went to inquire of the Lord.

— the Targum Onkelos says

The children clashed [pressed] inside her, and [when this happened] she said, If this is so, why did I desire this? She [then] went to inquire of [to ask for instruction from before] Adonoy.

— say the Targums of Jonathan and Jerusalem; and she went to inquire of the Lord; to the school of Shem the great;

23 And the Lord said unto her, “Two nations are in thy womb, and two manner of people shall be separated from thy body; and the one people shall be stronger than the other people, and the elder shall serve the younger.”

— the Targum Onkelos says

Adonoy said to her, Two nations are in your womb, and two Kingdoms will separate from within you. One government will be mightier than the other, but the greater one will serve the smaller one.

— the Targums of Jonathan says

“And the children struggled within her, and it was like men fighting. And she said, ‘If this is the pain of pregnancy, why do I desire children?’ So she went to the study hall of Shem the Great to seek mercy from before the Lord.”

“And the Lord said to her, ‘Two nations are in your womb, and two kingdoms will separate from your belly. One kingdom will be stronger than the other, and the elder will serve the younger if the descendants of the younger keep the commandments of the Torah.'” Genesis 25:22-23 Jonathan

— important to note that “the elder will [only] serve the younger if the descendants of the younger keep the commandments of the Law.”

24 And when her days to be delivered were fulfilled, behold, there were twins in her womb.

— the Targum Onkelos says

When her days of pregnancy were completed, behold, there were twins in her womb.

— and when her days to be delivered were fulfilled; the nine months were up from the time of her conception; or, as the Targum of Jonathan, when the two hundred and seventy days she went with child were completed;

25 And the first came out red, all over like a hairy garment; and they called his name Esau. — red, like a hairy garment; with red hair all over his body, whence he had his name, Esau, made, reared already;

— the Targum Onkelos says

The first one came out with a reddish complexion, covered completely with what was like a hairy robe, and they named him Eisov.

— the Targum of Jonathan says Esau was born as if he was already a grown man

and the first came forth wholly red, as a garment of hair: and they called his name Esau, because he was born altogether complete, with the hair of the head, and the beard, and teeth, and grinders;

26 And after that came his brother out, and his hand took hold of Esau’s heel; and his name was called Jacob. And Isaac was threescore years old when she bore them.

— and his name was called Jacob; by his parents; because he took his brother by the heel, which his name has the signification of, and Esau has respect to in Genesis 27:36,

— the Targum Onkelos says

After that his brother came out, his hand grasping the heel of Eisov, and he [Yitzchok] named him Yaakov. Yitzchok was sixty years old when she [Rivkah] gave birth to them.

27 And the boys grew. And Esau was a cunning hunter, a man of the field; and Jacob was a plain man, dwelling in tents.

— Esau a cunning hunter and equally had a tent for his abode, but Jacob stayed at home, and busied about the flocks and cattle; hence he was the mother’s darling, while Isaac preferred his more enterprising son;

— the Targum Onkelos says

The lads grew up. Eisov became a skilled trapper [an idle man], a man of the field [a man going out to the field]. Yaakov was a wholesome man, living in tents [serving in the house of study].

28 And Isaac loved Esau, because he ate of his venison; but Rebekah loved Jacob. — because he did eat of his venison, literally, because the venison—that is, the produce of Esau’s hunting—was in his mouth; in our phrase, was to his taste—was what he liked;

— but Rebekah loved Jacob upon better grounds, both because of his more pious and meek temper, and because of the oracle and promise of God;

— the Targum Onkelos says

Yitzchok loved Eisov because he ate of his trappings, but Rivkah loved Yaakov.

29 And Jacob boiled pottage; and Esau came from the field, and he was faint. — and Esau came from the field, and be was faint: for want of food, and weary with hunting, and perhaps more so, having toiled and got nothing;

— the Targum Onkelos says

Yaakov was simmering a pottage when Eisov came in from the field, exhausted.

— the Targum of Jonathan says

“And on that day that Abraham died, Jacob cooked a dish of lentils and went to comfort his father [Isaac]. And Esau came from the field, and he was exhausted; for on that day he had committed five transgressions: he worshipped a foreign worship [idolatry], he shed innocent blood [murder], he went in unto a betrothed maiden [adultery], he denied the life of the World to Come, and he despised the birthright.”

30 And Esau said to Jacob, “Feed me, I pray thee, with that same red pottage, for I am faint”; therefore was his name called Edom. — therefore was his name called Edom; besides from his red hair, but more from this red pottage; for Edom signifies red;

— the Targum Onkelos says

Eisov said to Yaakov, Please [Now] give me a swallow of this red [pottage], for I am exhausted. He was therefore named Edom [Red].

31 And Jacob said, “Sell me this day thy birthright.” — and Jacob said, sell me this day thy birthright; which had many privileges annexed to it; a double portion of inheritance; some say the exercise of priesthood, but that is questioned; the parental blessing;

— the Targum Onkelos says

Yaakov said, As of this day [Like this day], sell your birthright to me.

32 And Esau said, “Behold, I am at the point of dying. And what profit shall this birthright be to me?” — Esau said, I am at the point to die; that is, I am running daily risk of my life; and of what use will the birthright be to me;

— the Targum Onkelos says

Eisov said, Here I am going to die, what [good] is this birthright to me.

33 And Jacob said, “Swear to me this day.” And he swore unto him, and he sold his birthright unto Jacob. — and he swear unto him; that he would abide by the bargain, and never give him any trouble on that account; God himself being appealed to as a witness of it;

— the Targum Onkelos says

Yaakov said, Swear to me as of this day [like this day]. He swore to him, and sold his birthright to Yaakov.

34 Then Jacob gave Esau bread and pottage of lentils; and he ate and drank, and rose up and went his way. Thus Esau despised his birthright. — thus Esau despised his birthright; he used no means to get the bargain revoked, made no appeal to his father about it;

— the Targum Onkelos says

Yaakov then gave Eisov bread and a pottage of lentils. He [Eisov] ate and drank, got up and left. [Thus] Eisov scorned the birthright.

— the Targum of Jonathan says

“And Jacob gave to Esau bread and a cooked dish of lentils; and he ate and drank, and rose up and went. And Esau despised the birthright and [his] portion in the World to Come.”

Genesis 26

1 And there was a famine in the land, besides the first famine that was in the days of Abraham. And Isaac went unto Abimelech king of the Philistines, unto Gerar.

— it is probable that Abraham was now dead; in that case, Esau and Jacob would be at least fifteen years of age when the following event occurred;

— the Targum Onkelos says

There was a famine in the land, aside from the first famine that was in the days of Avraham. Yitzchok went to Avimelech, king of the Philistines, in Gerar.

And the Lord appeared unto him, and said, “Go not down into Egypt; dwell in the land which I shall tell thee of. — and the Lord appeared unto Isaac, Go not down into Egypt; it being a very fruitful place, washed by the Nile;

— the Targum Onkelos says

Adonoy appeared [became revealed] to him and said, Do not go down to Egypt. Settle in the land that I will make known to you.

— and Jonathan says it was in the heart of Isaac to go down into Egypt.

Sojourn in this land, and I will be with thee and will bless thee. For unto thee and unto thy seed I will give all these countries, and I will perform the oath which I swore unto Abraham thy father.

— and I will be with thee, and I will bless thee, Isaac; with a supply of all the necessaries of life; for unto thee, and to thy seed, will I give these countries; inhabited at that time by the Philistines, Canaanites, and the several tribes of them;

— the Targum Onkelos says

Stay temporarily in this land and I will be with you and bless you [My Word will be your support and I will bless you], for to you and your descendants I will give all these lands. I will [thus] keep the oath that I swore to Avraham, your father.

And I will make thy seed to multiply as the stars of heaven, and will give unto thy seed all these countries; and in thy seed shall all the nations of the earth be blessed,

— for I will make thy seed to multiply; a renewal to Isaac of all God’s promises made to Abraham; in thy seed shall all the nations of the earth be blessed;

— perhaps Abraham might suppose God spoke of his immediate seed, namely, of Isaac; but when the promise was renewed to him in the very same words, it became evident that the seed which was to be this universal blessing was still to come;

— the Targum Onkelos says

I will make your descendants [as numerous] as the stars of the heavens, and I will give your descendants all these lands. Through [Because of] your descendants shall be blessed all the nations of the world.

because Abraham obeyed My voice, and kept My charge, My commandments, My statutes, and My laws.” — my voice, my charge, my commandments: this variety of expression seems to be designed to show the universality and exactness of Abraham’s obedience, that he readily complied with every intimation of the divine will;

— the Targum Onkelos says

[All this is] because Avraham listened to [accepted] My voice [Word], and minded My mandate [the mandate of My Word], My commandments, My decrees and My teachings.

And Isaac dwelt in Gerar. — Gerar was probably a trading town between Syria and Egypt, and therefore Isaac’s needs during the famine are here supplied;

— the Targum Onkelos says

Yitzchok [thus] settled in Gerar.

And the men of the place asked him concerning his wife. And he said, “She is my sister”; for he feared to say, “She is my wife,” lest, said he, “the men of the place should kill me for Rebekah, because she was fair to look upon.”

— we now find Isaac imitating his father’s example with even less reason for his unjustifiable conduct;

— the Targum Onkelos says

The local men asked about his wife, and he said, She is my sister. He was afraid to say, [she is] my wife, lest the local men kill me for Rivkah, for she is so good looking.

And it came to pass, when he had been there a long time, that Abimelech king of the Philistines looked out a window and saw, and behold, Isaac was frolicking with Rebekah his wife. — Abimelek observes Isaac sporting with Rebekah as only husband and wife should;

— constrains him to confess that she is his wife, charges him with the impropriety of his conduct, and commands his people to refrain from harming either of them on pain of death;

— the Targum Onkelos says

Once, after [Yitzchok] had been there a long while, Avimelech, king of the Philistines, looked at the window, and he saw, and behold, Yitzchok was amusing himself with Rivkah, his wife.

And Abimelech called Isaac and said, “Behold, of a surety she is thy wife; and how saidst thou, ‘She is my sister’?” And Isaac said unto him, “Because I said, ‘Lest I die for her.’”

— lest I die for her; for her sake, that another might have and enjoy her; it was fear of losing his life that led him to take such a step, and give out that she was his sister, like his father, Abraham;

— the Targum Onkelos says

Avimelech called Yitzchok and he said, But she is your wife. How could you have said, She is my sister? Yitzchok said to him, Because I said, I might die because of her.

10 And Abimelech said, “What is this thou hast done unto us? One of the people might lightly have lain with thy wife, and thou shouldest have brought guiltiness upon us.”

— the Targum Onkelos says

Avimelech said, What have you done to us? One of the people [The unique one among the people] could have easily slept with your wife, and you would have brought guilt upon us.

11 And Abimelech charged all his people, saying, “He that toucheth this man or his wife shall surely be put to death.” — whoever shall go near to injure this man or his wife, shall verily be put to death.

— the Targum Onkelos says

Avimelech [then] commanded all his people, saying, Whoever touches [injures] this man or his wife, shall die.

12 Then Isaac sowed in that land, and received in the same year a hundredfold; and the Lord blessed him. — an hundredfold, that is, a hundred times as much as he sowed; the same degree of increase is repeated in Matthew 13:8;

— the Targum Onkelos says

Yitzchok planted in that land, and in that year he reaped a hundred fold [more than that which they estimated], for Adonoy had blessed him.

13 And the man waxed great, and went forward, and grew until he became very great. — Isaac became increasingly great and strong, until he was very powerful and his wealth very great;

— the Targum Onkelos says

The man prospered. He continued to prosper [and increase] until he became very great.

14 For he had possession of flocks and possession of herds, and great store of servants; and the Philistines envied him. — so that the Philistines envied Isaac, which makes men grieve at the good of others;

— the Targum Onkelos says

He owned flocks of sheep, herds of cattle, and many slaves, and the Philistines were jealous of him.

15 For all the wells which his father’s servants had dug in the days of Abraham his father, the Philistines had stopped them and filled them with earth. — and the Philistines endeavoured to do him injury by stopping up and filling with rubbish all the wells that had been dug in his father’s time;

— the Targum Onkelos says

All the wells that his father’s servants had dug in the days of his father, Avraham—the Philistines plugged them, and filled them with earth.

16 And Abimelech said unto Isaac, “Go from us, for thou art much mightier than we.” — and even Abimelech requested Isaac to depart, because he was afraid of his power; his family being greatly increased, his servants numerous;

— the Targum Onkelos says

Avimelech said to Yitzchok, Go away from us. You have become much more powerful than us.

17 And Isaac departed from thence, and pitched his tent in the Valley of Gerar and dwelt there. — Isaac’s retreats from Gerar and its suburbs, and takes up his abode in the valley, or wady of Gerar;

— the Targum Onkelos says

Yitzchok went away from there. He camped in the valley of Gerar and settled there.

18 And Isaac dug again the wells of water which they had dug in the days of Abraham his father, for the Philistines had stopped them after the death of Abraham; and he called their names after the names by which his father had called them.

— and Isaac digged those rather than new ones, partly to keep up his father’s memory, and partly because he had most right to them, and others less cause of quarrel with him about them;

— the Targum Onkelos says

Yitzchok returned and excavated the wells of water which were dug in the days of his father, Avraham, and were plugged by the Philistines after Avraham’s death. He gave them the same names that his father had given them.

19 And Isaac’s servants dug in the valley, and found there a well of springing water. — and found there a well of springing water; or “living water” which flows continually;

— the Targum Onkelos says

Yitzchok’s servants dug in the valley and found there a well of spring [flowing] water.

20 And the herdsmen of Gerar strove with Isaac’s herdsmen, saying, “The water is ours.” And he called the name of the well Esek [that is, Contention], because they strove with him. — and Isaac called the name of the well Esek: which signifies “contention” because they strove with him;

— the Targum Onkelos says

The shepherds of Gerar argued with the shepherds of Yitzchok, saying, the water is ours. He named the well Eisek [Quarrel], because they had quarreled with him.

21 And they dug another well, and strove for that also; and he called the name of it Sitnah [that is, Hatred]. — signifies “hatred” it being out of hatred and malice to him that they gave him so much trouble;

— the Targum Onkelos says

They dug another well and they also argued about it. He named the well Sitnah [Obstruction].

22 And he removed from thence, and dug another well, and for that they strove not; and he called the name of it Rehoboth [that is, Room]. And he said, “For now the Lord hath made room for us, and we shall be fruitful in the land.”

— and we shall be fruitful in the land; his flocks and his herds increase, having good pasturage and watering for them, and so he and his family be in prosperous circumstances;

— the Targum Onkelos says

He moved away from there and he dug another well, and there was no argument over it. He named it Rechovos [Wide Spaces], and said, For now Adonoy has made room for us, and we shall be fruitful in the land.

23 And he went up from thence to Beersheba. — and Isaac went south from thence to Beer-sheba;

— this was a very serious act on Isaac’s part as he leaves the solitudes where he had found a refuge from the enmity of the Philistines, and returns to a place scarcely five leagues distant from their city;

— the Targum Onkelos says

From there he went to Beer Sheva.

24 And the Lord appeared unto him the same night and said, “I am the God of Abraham thy father. Fear not, for I am with thee, and will bless thee, and multiply thy seed for My servant Abraham’s sake.” — Isaac is again and again reminded of the relation in which his father stood to God;

— fear not; any future famine, nor want of any good things, nor any enemies, the Philistines his neighbours, who had driven him from their country, and had harassed him from place to place;

— and multiply thy seed, for my servant Abraham’s sake; who was a faithful, diligent, servant of his; whose service was, not forgotten by him;

— the Targum Onkelos says

Adonoy appeared [became revealed] to him that night and said, I am the God of your father, Avraham. Do not fear for I am with you [My Word is your support]. I will bless you and make your descendants numerous, because of My servant, Avraham.

25 And he built an altar there, and called upon the name of the Lord, and pitched his tent there; and there Isaac’s servants dug a well.

— and he builded an altar there; at Beersheba, where his father Abraham had planted a grove before, and very probably had built an altar also, though it might not be now standing, Genesis 21:33,

— and there Isaac’s servants digged a well; in order to find water for the family, and for the flocks and herds; and called upon the name of the Lord; and gave him thanks for all his mercies to him; especially during the time of famine; 

— the Targum Onkelos says

He [Yitzchok] built an altar there, and proclaimed [prayed in] the Name of Adonoy. He set up his tent there, and Yitzchok’s servants dug a well there.

26 Then Abimelech went to him from Gerar with Ahuzzath one of his friends and Phichol the chief captain of his army.

— then Abimelech went to Isaac; as there was a lapse of ninety years between the visit of Abraham and of Isaac, the Abimelech and Phichol spoken of must have been different persons’ official titles;

— then Abimelech went to him from Gerar, after Isaac was settled at Beersheba, and was still increasing in his family and substance;

— the Targum Onkelos says

Avimelech came to Yitzchok from Gerar along with a group of friends and Pichol, his general.

27 And Isaac said unto them, “Why come ye to me, seeing ye hate me and have sent me away from you?” — wherefore come ye to me? Isaac’s return had brought matters to a crisis, and the king must now decide whether there was to be peace or war;

— the Targum Onkelos says

Yitzchok said to them, Why have you come to me? You hate me and drove me away from you.

28 And they said, “We saw certainly that the Lord was with thee; and we said, ‘Let there be now an oath between us, even between us and thee, and let us make a covenant with thee,

— Let there be now an oath; the word literally signifies a curse; each side uttered an imprecation, with the prayer that it might fall upon himself if he broke the terms of the covenant;

— the Targum Onkelos says

They said, We have indeed seen that Adonoy is with you [the Word of Adonoy is your support], and we said, Let there now be an oath between us, [Let the oath that was between our fathers now be established] between ourselves and you, and let us make a covenant with you;

29 that thou wilt do us no hurt, as we have not touched thee, and as we have done unto thee nothing but good, and have sent thee away in peace. Thou art now the blessed of the Lord.’”

— as we have not touched thee; not done the least injury to him, to his person, family, and substance, but suffered him to go away with nothing but good; by royal authority;

— the Targum Onkelos says

that you will do us no harm, just as we did not touch [injure] you. We did nothing but good to you, and sent you away in peace. You are now the blessed one of Adonoy.

30 And he made them a feast, and they ate and drank. — and they did eat and drink; freely and in a friendly manner; for both having spoken their minds, they agreed to bury all former things oblivion, and live in peace and friendship;

— the Targum Onkelos says

He [Yitzchok] made a feast for them, and they ate and drank.

31 And they rose up early in the morning and swore one to another; and Isaac sent them away, and they departed from him in peace. — and Isaac sent them away, and they departed from him in peace; he took his leave of them in a friendly manner to mutual satisfaction;

— the Targum Onkelos says

They got up early in the morning, and they each swore to the other. Yitzchok sent them away and they left in peace.

32 And it came to pass the same day, that Isaac’s servants came and told him concerning the well which they had dug, and said unto him, “We have found water.”

— not only had dug a well, but they had found plenty of water, and that which was good; or otherwise it would not have been worth while to have troubled Isaac;

— the Targum Onkelos says

On that day Yitzchok’s servants came and told him about the well they had dug; and they said to him, We have found water.

33 And he called it Shebah [that is, An oath]; therefore the name of the city is Beersheba [that is, The well of the oath] unto this day. — the well of the oath: it had been so called by Abraham an hundred years ago or more; but now upon this occasion it was renewed and confirmed;

— the Targum Onkelos says

He named it Shiva. Therefore the city is called Beer Sheva until this very day.

34 And Esau was forty years old when he took for a wife Judith the daughter of Beeri the Hittite, and Basemath the daughter of Elon the Hittite,

— Esau, by thus inter marrying with idolaters he violated the great principle laid down by Abraham (Genesis 24:3), forfeited thereby his birthright, and, as such marriages were beyond righteousness;

— the Targum Onkelos says

Eisov was forty years old and he married Yehudis, the daughter of Be’eri, the Chittite and Bosmas, the daughter of Eylon the Chittite.

35 who were a grief of mind unto Isaac and to Rebekah. — which were a grief of mind unto Isaac, and to Rebekah; although Esau partially repented, and took as a third wife a daughter of Ishmael (Genesis 28:9)

— the Targum Onkelos says

They were rebellious of spirit to [They were rebels and aggravators against the words of] Yitzchok and Rivkah.

Iran to turn Strait of Hormuz into toll booth

•March 30, 2026 • Leave a Comment

Iran is considering turning the Strait of Hormuz into the world’s most expensive toll booth, charging vessels an immense sum for safe passage.

MENE, MENE, TEKEL, UPHARSIN

Supreme Leader Mojtaba Khamenei is pushing for ways to monetise its control of the narrow body of water, through which 20 per cent of the world’s oil passes.

Iranian news outlet Daily Javan said charging vessels for safe passage would “compensate Iran’s losses in the war.”

To pay for the damage Iran has suffered in the war, the article wrote oil tankers could be taxed $US50 a barrel – a 50 per cent markup.

Such a move would send oil prices surging worldwide, but ships from Israel and the US would not be allowed in through strait at all.

This would not be a major concern for the US, which produces much of its own oil. It would be a blow to Israel’s refined petroleum supplies, however.

Already Iran is reportedly charging shipping companies about US$2 million in order to let their vessels through the strait unscathed.

“The Strait of Waterloo?!”

Iran’s parliament is now considering legislation to codify taxes for safe passage into law.

“Collecting US$2 million as transit fees from some vessels crossing the strait reflects Iran’s strength,” top politician Alaeddin Boroujerdi said.

President Masoud Pezeshkian’s rhetoric implied many vessels were free to travel through.

“The Strait of Hormuz is open to all except those who violate our soil,” he said.

“We firmly confront delirious threats on the battlefield.”

Already four vessels from India have been able to go through the strait. It is not known whether they paid Iran in order to do so.

At its narrowest, the Strait of Hormuz is just 34km wide.

Is this another Vietnam, Iraq, or Afghanistan?

Woe to the crown of pride, to the drunkards of Ephraim, whose glorious beauty is a fading flower, which is on the head of the fat valleys of them that are overcome with wine! Isaiah 28:1

For more, see (1) The Birthrights (2) Ephraim and Manasseh (3) Ephraim as the Thirteenth Tribe (4) Who is this lying Ephraim? (5) The Ox with horns of a Unicorn

Genesis (23-24)

•March 29, 2026 • Leave a Comment

~~~~

~~

Genesis 23

1 And Sarah was a hundred and seven and twenty years old; these were the years of the life of Sarah. — Sarah was an hundred and seven and twenty years old; Sarah is the only woman whose age at her death is mentioned in the Bible, an honour doubtless given her as the ancestress of the Hebrew heritage;

— the Targum Onkelos says

The lifetime of Sarah consisted of one hundred years, twenty years and seven years. [These were] the years of Sarah’s life.

— the Targum of Jonathan says

And the days of the life of Sarah were an hundred and twenty and seven years, the years of the life of Sarah.

And Sarah died in Kirjatharba (the same is Hebron) in the land of Canaan; and Abraham came to mourn for Sarah and to weep for her.

— Abraham came to mourn; at this period Abraham was in quiet possession of several homes, and apparently was himself at Beersheba when Sarah died at Hebron, where probably he had left Isaac in charge of his mother and the cattle;

— the Targum Onkelos says

Sarah died in Kiryas Arba, which is Chevron, in the land of Canaan. Avraham came to eulogize Sarah and to weep for her.

— the Targum of Jonathan says,

“And Sarah died in Kiryath Arba, which is Hebron. And Abraham came from the mountain of worship, and found that she was dead; and he sat to mourn for Sarah, and to weep for her.”

And Abraham stood up from before his dead, and spoke unto the sons of Heth, saying, — the sons of Heth; now it appears that it was associates of the Hittites, a race who, while the Israelites sojourned in Egypt, became so powerful as to contend for empire with the Egyptians themselves;

— the Targum Onkelos says

Avraham rose from the presence of his dead, and spoke to the sons of Cheis saying,

“I am a stranger and a sojourner with you. Give me a possession for a burying place with you, that I may bury my dead out of my sight.”

— sell me a possession of a buryingplace with you; not that he desired it as a free gift, but that he might be allowed to make a purchase of a piece of ground to bury his dead;

— the Targum Onkelos says

I am a foreigner and a resident among you. Grant me the possession of a grave site with you, so that I may bury my dead from my presence.

And the children of Heth answered Abraham, saying unto him, — the children of Heth, so called from Heth the son of Canaan, Genesis 10:15, “And Canaan begot Sidon his firstborn, and Heth;”

— the Targum Onkelos says

The sons of Cheis replied to Avraham saying to him,

“Hear us, my lord: Thou art a mighty prince among us; in the choicest of our sepulchers bury thy dead. None of us shall withhold from thee his sepulcher, that thou mayest bury thy dead.”

— in the choice of our sepulchres; the meeting between Abraham and the Hittites is marked by the utmost courtesy on both sides;

— the Targum Onkelos says

Hear [Accept] us my [our] master, you are a prince of God [you are respected before God] in our midst. Bury your dead in the choicest of our grave sites. No man among us will deny his grave site from you to bury your dead.

And Abraham stood up and bowed himself to the people of the land, even to the children of Heth. — Abraham bowed himself; thus returning them thanks for their kind offer, with all proper decency and respect;

— the Targum Onkelos says

Avraham rose and bowed to the people of the land, the sons of Cheis.

And he communed with them, saying, “If it be in your mind that I should bury my dead out of my sight, hear me, and entreat for me Ephron the son of Zohar, — hear me, and entreat for me to Ephron the son of Zohar; a principal man among the Hittites, who had a field and a cave in it;

— the Targum Onkelos says

Avraham spoke to them, saying, If it is really your will [the will of your soul] that I bury my dead from my presence, listen to [accept] me and intercede for me with Ephron, son of Tzochar.

that he may give me the cave of Machpelah which he hath, which is in the end of his field. For as much money as it is worth he shall give it to me as a possession for a burying place amongst you.”

— the Targum Onkelos says

Let him give me the Machpeilah [double] cave, which belongs to him, which is at the end of his field. Let him give [sell] it to me for its full value, as a grave site among you.

— the Message Bible has these few verses as:

Then Abraham got up, bowed respectfully to the people of the land, the Hittites, and said, “If you’re serious about helping me give my wife a proper burial, intercede for me with Ephron son of Zohar.

“Ask him to sell me the cave of Machpelah that he owns, the one at the end of his land. Ask him to sell it to me at its full price for a burial plot, with you as witnesses.” Genesis 23:87-9 MSG

— the cave of Machpelah; was a double cave as the Targum of Jonathan confirms it, “the double cave” consisting probably of an outer and an inner compartment;

10 And Ephron dwelt among the children of Heth; and Ephron the Hittite answered Abraham in the audience of the children of Heth, even of all who went in at the gate of his city, saying,

— the transaction now comes to be between Abraham and Ephron; the sons of Heth were seated in council, and Ephron among them;

— the Targum Onkelos says

Ephron lived in the midst of the sons of Cheis, Ephron the Chitite replied to Avraham in the ears [audience] of [before] the sons of Cheis, for all who came to the city gate, saying,

11 “Nay, my lord, hear me: The field give I thee; and the cave that is therein, I give it to thee. In the presence of the sons of my people give I it to thee; bury thy dead.” — the field give I thee; not only the cave had been mentioned, but for its quiet possession the land around it as well;

— the Targum Onkelos says

No, my master, hear [accept] me: I have given you the field, and the cave that is in it, I have [also] given to you. Before the eyes of the sons of my people I have given it to you. Bury your dead.

12 And Abraham bowed himself down before the people of the land. — and Abraham bowed down himself before the people of the land; showing hereby great respect, and giving much honour both to them and Ephron; 

— the Targum Onkelos says

Avraham bowed to the people of the land.

13 And he spoke unto Ephron in the audience of the people of the land, saying, “But if thou wilt give it, I pray thee, hear me. I will give thee money for the field. Take it from me, and I will bury my dead there.”

— I will give thee money; Abraham was rich in silver and gold, and therefore thought it unjust to take advantage of Ephron’s generosity;

— the Targum Onkelos says

He spoke to Ephron in the ears [audience] of [before] the people of the land saying, If you will only listen to me. [If you will do a kindness for me, accept me.] I have given the money for the [value of the] field. Take it from me and I will bury my dead there.

14 And Ephron answered Abraham, saying unto him,

— the Targum Onkelos says

Ephron replied to Avraham, saying to him,

15 “My lord, hearken unto me: The land is worth four hundred shekels of silver. What is that between me and thee? Bury therefore thy dead.”

— the Message Bible has these few verses as:

Abraham bowed respectfully before the assembled council and answered Ephron: “Please allow me—I want to pay the price of the land; take my money so that I can go ahead and bury my wife.”

Then Ephron answered Abraham, “If you insist, master. What’s four hundred silver shekels between us? Now go ahead and bury your wife.” Genesis 23:12-15

— the Targum Onkelos says

My master, hear [accept] me. A land [worth] four hundred silver shekel—what is that between me and you? Bury your dead.

16 And Abraham hearkened unto Ephron; and Abraham weighed the silver for Ephron which he had named in the audience of the sons of Heth: four hundred shekels of silver, current money with the merchant. — Abraham weighed; current money with the merchant; shekel literally means weight, and money was not coined until long afterwards;

— the Targum Onkelos says

Avraham listened to [accepted] Ephron, and Avraham weighed out for Ephron the silver that he spoke of in the hearing of [before] the sons of Cheis, four hundred silver shekel, negotiable currency [which are accepted by merchants in every city].

17 And the field of Ephron which was in Machpelah, which was before Mamre, the field and the cave which was therein, and all the trees that were in the field that were in all the borders round about, were secured

— the Targum Onkelos says

The field of Ephron was established [as Avraham’s possession], [the field] which was in Machpeilah, facing Mamrei; [this included] the field, the cave that was in it, and all the trees that were in the field that were in the entire circumference of its boundaries.

18 unto Abraham as a possession in the presence of the children of Heth, before all who went in at the gate of his city.

— the Targum Onkelos says

This became Avraham’s [possession] through a purchase before the eyes of the sons of Cheis, all who had come to the gate of his city.

19 And after this, Abraham buried Sarah his wife in the cave of the field of Machpelah, before Mamre (the same is Hebron) in the land of Canaan.

— the Targum Onkelos says

After that Avraham buried his wife Sarah in the cave of the Machpeilah field, which faces Mamrei, which is Chevron, in the land of Canaan.

20 And the field and the cave that is therein were secured unto Abraham as a possession for a burying place by the sons of Heth.

— that’s how Ephron’s field next to Mamre—the field, its cave, and all the trees within its borders—became Abraham’s property; with the town council of Hittites witnessing the transaction;

— the Message Bible has these few verses as:

Abraham then proceeded to bury his wife Sarah in the cave in the field of Machpelah that is next to Mamre, present-day Hebron, in the land of Canaan. The field and its cave went from the Hittites into Abraham’s possession as a burial plot. Genesis 23:17-20

— the Targum Onkelos says

The field and its cave was established as Avraham’s possession as a gravesite, by the sons of Cheis.

Genesis 24

1 And Abraham was old and well stricken in age; and the Lord had blessed Abraham in all things.

— Abraham, who was a centenarian at Isaac’s birth, would now be nearly 140; as he lived to be 175 (Genesis 25:7), he survived Isaac’s marriage thirty-five years, and lived to see Esau and Jacob nearly grown up;

— the Targum Onkelos says

Avraham was old, advanced in days [years], and Adonoy had blessed Avraham in all things.

And Abraham said unto his eldest servant of his house, who ruled over all that he had, “Put, I pray thee, thy hand under my thigh;

— the Targum Onkelos says

Avraham said to his servant, the senior [servant] of his household, who was in charge of all that he owned, Place your hand under my thigh.

— the Targum of Jonathan named him, Eliezer, his servant, the senior of his house, put thy hand under my thigh; as Jacob requires that Joseph should swear to him in the same manner (Genesis 47:29), this form of oath was evidently regarded as a very solemn one;

and I will make thee swear by the Lord, the God of heaven and the God of the earth, that thou shalt not take a wife for my son from the daughters of the Canaanites, among whom I dwell.

— that thou wilt not take a wife unto my son of the daughters of the Canaanites; these being not only idolaters, and very wicked people, the seed of the accursed Canaan; 

— the Targum Onkelos says

I will have you swear by [the Word of] Adonoy, God of heaven and God of earth, that you will not take a wife for my son from the daughters of the Canaanites, among whom I live.

But thou shalt go unto my country and to my kindred, and take a wife for my son Isaac.” — my kindred, the family of Nahor, concerning the increase whereof he had received information, Genesis 22:20, which he justly preferred before the wicked Canaanites;

— the Targum Onkelos says

Instead, to my [native] land, to my birthplace, shall you go, and take a wife for my son, for Yitzchok,

And the servant said unto him, “Perhaps the woman will not be willing to follow me unto this land. Must I bring thy son again unto the land from whence thou camest?”

— must I needs bring thy son again unto the land from whence thou camest? that is, must I agree with the woman on these terms, and promise that Isaac shall come and dwell with her in Mesopotamia?

— the Targum Onkelos says

The servant said to him, Perhaps the woman will not want to come back with me to this land? Shall I bring your son back to the land from where you came?

And Abraham said unto him, “Beware thou that thou bring not my son thither again. — it was dangerous for Isaac to go, where, though there was some knowledge of the true God, yet there was much idolatry there, lest he should be corrupted, and degenerate from the true religion;

— the Targum Onkelos says

Avraham said to him, Take care, not to bring my son back there.

The Lord God of heaven, who took me from my father’s house and from the land of my kindred, and who spoke unto me and who swore unto me, saying, ‘Unto thy seed will I give this land,’ He shall send His angel before thee, and thou shalt take a wife for my son from thence.

— saying, unto thy seed will I give this land; the land of Canaan; and therefore his son, in whom his seed was to be called, must not be removed from hence, and settled in another country;

— the Targum Onkelos says

Adonoy, God of heaven, Who took me from my father’s house, and from the land of my birth, Who spoke to me, and Who swore to me, saying, To your descendants I will give this land—He will send His angel before you, and you shall take a wife for my son from there.

And if the woman will not be willing to follow thee, then thou shalt be clear from this my oath; only bring not my son thither again.”

— then thou shalt be clear from this my oath; the sense is, when he had done all he could to get the consent of the damsel to go with him and marry his master’s son; and after all she could not be prevailed upon to come with him, then he was free from his oath;

— the Targum Onkelos says

If the woman does not want to come back with you, you are absolved from this oath to me. But do not bring my son back there.

And the servant put his hand under the thigh of Abraham his master, and swore to him concerning that matter.

— and the servant, Eliezer, put his hand under the thigh of Abraham his master; or being satisfied of the nature and extent of his oath, and thoroughly understanding how he was to act upon it;

— the Targum Onkelos says

The servant placed his hand under the thigh of Avraham, his master, and swore to him regarding this matter.

10 And the servant took ten camels from the camels of his master and departed, for all the goods of his master were in his hand. And he arose and went to Mesopotamia, unto the city of Nahor.

— the servant took ten camels to the city of Nahor; this was Harran (Genesis 27:43); the city of Nahor; this was the brother of Abraham;

— the Targum Onkelos says

The servant took ten camels from his master’s camels and departed, and all the property of his master was in his hand. He rose and went to Aram Naharayim [which is next to the river P’ras]; to the city of Nachor.

— the Targum of Jonathan reveals he took with him goodly treasures, saying

And the servant took ten camels from the camels of his lord, and went: for all the goodly treasures of his lord were in his hand; and he arose and went unto Aram, which was by the Pherat, to the city of Nachor.

11 And he made his camels to kneel down outside the city by a well of water at the time of the evening, even the time that women go out to draw water. — Eliezer made his camels to kneel down; probably to unload them; kneeling, however, is the posture in which they take their rest;

— the Targum Onkelos says

He made the camels kneel [rest] outside the city, beside a well of water, in the evening, at the time the women go out to draw water.

12 And he said, “O Lord God of my master Abraham, I pray Thee, send me good speed this day, and show kindness unto my master Abraham. — as a circumcised member of Abraham’s household, the servant also prays to Yehovah, Abraham’s God;

— the Targum Onkelos says

He said, Adonoy, God of my master, Avraham, be present before me today, and act kindly [do goodness] with my master, Avraham.

13 Behold, I stand here by the well of water, and the daughters of the men of the city come out to draw water.

— Eliezer stand here by the well of water, wishing, hoping that something would turn out that would direct and instruct what further to do, and that would lead on to the business he came about;

— and during the evening, the daughters of the men of the city came out to draw water; which was the usual custom in those days;

— the Targum Onkelos says

Behold, here I stand by this well of water, and the daughters of the townsmen are coming out to draw water.

14 And let it come to pass, that the damsel to whom I shall say, ‘Let down thy pitcher, I pray thee, that I may drink,’ and she shall say, ‘Drink, and I will give thy camels drink also’

— let the same be she whom Thou hast appointed for Thy servant Isaac; and thereby shall I know that Thou hast shown kindness unto my master.”

— the Message Bible says:

The servant took ten of his master’s camels and, loaded with gifts from his master, traveled to Aram Naharaim and the city of Nahor. Outside the city, he made the camels kneel at a well.

It was evening, the time when the women came to draw water. He prayed, “O God, God of my master Abraham, make things go smoothly this day; treat my master Abraham well!

As I stand here by the spring while the young women of the town come out to get water, let the girl to whom I say, ‘Lower your jug and give me a drink,’ and who answers, ‘Drink, and let me also water your camels’

—let her be the woman you have picked out for your servant Isaac. Then I’ll know that you’re working graciously behind the scenes for my master.” Genesis 24:10-14 MSG

— the Targum Onkelos says

Let it be that the girl to whom I say, Please [Now], tip over your pitcher that I may drink and she will say Drink, and I will also give your camels to drink, will be the one whom You have determined for your servant, Yitzchok. With her I will know that You have dealt kindly [with goodness] with my master.

15 And it came to pass, before he had done speaking, that behold, Rebekah came out, who was born to Bethuel son of Milcah, the wife of Nahor, Abraham’s brother, with her pitcher upon her shoulder. — the response was immediate and direct. “He had not yet done speaking,” when the answer came;

— the Targum Onkelos says

He had not yet finished speaking, and behold Rivkah came out. She had been born to Besu’eil, the son of Milkah, the wife of Nachor, Avraham’s brother. Her pitcher was on her shoulder.

16 And the damsel was very fair to look upon, a virgin, neither had any man known her; and she went down to the well and filled her pitcher and came up. — neither had any man known her; not only was reckoned a virgin, but was really one, pure and incorrupt;

— the Targum Onkelos says

The girl was very good looking—a virgin—no man had known her. She went down to the well, filled her pitcher, and came up.

17 And the servant ran to meet her and said, “Let me, I pray thee, drink a little water from thy pitcher.” — and said, let me, I pray thee, drink a little water of thy pitcher; or taste a little of it, or suffer me to swallow a little of it;

— the Targum Onkelos says

The servant ran toward her and said, Please [Now] let me sip a little water from your pitcher.

18 And she said, “Drink, my lord”; and she hastened and let down her pitcher upon her hand, and gave him drink. — and she said, drink, my lord, signifying at once that he was welcome to drink what he would, giving him a very respectable title;

— the Targum Onkelos says

She said, Drink, my master, and she quickly lowered her pitcher to her hand, and let him drink.

19 And when she had done giving him drink, she said, “I will draw water for thy camels also, until they have done drinking.” — she said, I will draw water for thy camels also; she proposed to go back to the well, and did, and fill her pitcher, and repeat it as often as was necessary, until the camels had enough;

— the Targum Onkelos says

When she had finished giving him to drink, she said, I will also draw water for your camels, until they will have finished drinking [had enough to drink].

20 And she hastened and emptied her pitcher into the trough, and ran again unto the well to draw water, and drew for all his camels. — and ran again to the well to draw water; and which must be repeated several times to have enough for all the camels;

— the Targum Onkelos says

She quickly emptied her pitcher into the trough and she ran to the well again to draw water. and she drew water for all his camels.

21 And the man, wondering at her, held his peace to learn whether the Lord had made his journey prosperous or not. — the servant, Eliezer, was astonished at the exactness and quickness with which his prayer was being answered;

— the Targum Onkelos says

The man, wondering at her, remained silent, waiting to determine [The man waited and observed silently to determine] whether Adonoy had made his mission successful, or not.

22 And it came to pass, as the camels were done drinking, that the man took a golden earring of half a shekel weight, and two bracelets for her hands of ten shekels weight of gold, — earring; really nose-ring; for in Genesis 24:47 the man places it on her nose, wrongly translated face in our version;

— the Targum Onkelos says

When the camels had finished drinking [had enough to drink], the man took a gold nose ring, weighing half a shekel, and two bracelets for her arms, weighing ten gold shekel.

— the Targum of Jonathan transforms these jewelry items into prophetic symbols of Israel’s future; teaches that the marriage between Isaac and Rebecca was not a mere physical union: it was a Covenant

“And it was, when the camels had finished drinking, that the man took a golden ring, a drachma was its weight, corresponding to the drachma for the head (the half-shekel) which her children would give for the work of the Tabernacle; and two bracelets he placed upon her hands, the weight of which was ten selas of gold, their total weight corresponding to the two Tablets upon which were written the Ten Commandments.”

23 and said, “Whose daughter art thou? Tell me, I pray thee, is there room in thy father’s house for us to lodge in?” — whose daughter art thou? the reason of this question is, because by her answer to it he would know whether she was of the family related to Abraham;

— the Targum Onkelos says

He said to her, Whose daughter are you? Please [Now] tell me. Is there [a fitting] place in your father’s house for us to spend the night.

24 And she said unto him, “I am the daughter of Bethuel the son of Milcah, whom she bore unto Nahor.” — which she bare unto Nahor; Abraham’s brother; so that her father was Nahor’s son, not by his concubine Reumah, but by his lawful wife Milcah;

— the Targum Onkelos says

She said to him, I am the daughter of Besueil, the son of Milkah, whom she bore to Nachor.

25 She said moreover unto him, “We have both straw and provender enough, and room to lodge in.” — we have both straw and provender enough; for the camels, straw for their litter, and provender for their food, as hay, barley;

— and room to lodge in; for him and his men; this she could venture to say, and invite him to come and take up his quarters in her father’s house;

— the Targum Onkelos says

She said to him, We have plenty of straw and fodder, and also a [fitting] place to spend the night.

26 And the man bowed down his head, and worshiped the Lord. — Eliezer bowed his head and worshipped; the bowing of the head and of the body are here combined to indicate the aged servant’s deep thankfulness and respect for the guidance of the Lord;

— the Targum Onkelos says

The man bowed [his head] and prostrated himself to [before] Adonoy.

27 And he said, “Blessed be the Lord God of my master Abraham, who hath not left destitute my master from His mercy and His truth. I, being on the way, the Lord led me to the house of my master’s brethren.”

— blessed be the Lord God of my master; here again this servant shows a noble example in returning thanks to God, as soon as he finds that his errand is likely to succeed;

— the Targum Onkelos says

He said, Blessed is Adonoy, God of my master, Avraham, Who has not abandoned His kindness [goodness] and truth [in dealing] with my master. I am still on the [straight] road and Adonoy has led me to the house of my master’s brethren.

28 And the damsel ran and told those of her mother’s house these things. — and the damsel ran; having invited him to come and lodge at her father’s house, that he might not be brought in abruptly, she ran before to acquaint the family of what had passed;

— the Targum Onkelos says

The girl ran and told her mother’s household of these these happenings.

29 And Rebekah had a brother, and his name was Laban; and Laban ran out unto the man by the well. — her brother Laban had responsed to her account, hurried out to the stranger at the well, but her father Bethuel absent; perhaps being old, or sick in bed (but alive, verse 50), thus not involved;

— the Targum Onkelos says

Rivkah had a brother whose name was Lavan, and Lavan ran outside to the man [standing] at the well.

30 And it came to pass, when he saw the earring, and bracelets upon his sister’s hands, and when he heard the words of Rebekah his sister, saying, “Thus spoke the man unto me,” that he came unto the man; and behold, he stood by the camels at the well.

— the Targum Onkelos says

When he had seen the nose ring and the bracelets on the hands of his sister, and heard the words of his sister, Rivkah saying, this is what the man spoke to me, that he [then] came to the man, who was still standing beside the camels at the well.

31 And he said, “Come in, thou blessed of the Lord. Why standest thou outside? For I have prepared the house, and room for the camels.” — being hospitable, Laban ready himself with his sister to find the man, and invite him, as a matter of course, to his father’s house;

— the Targum Onkelos says

He [Lavan] said, Come, you who are blessed of Adonoy, why are you standing outside? I have emptied the house and [prepared] a [fitting] place for the camels.

32 And the man came into the house; and he ungirded his camels, and gave straw and provender to the camels, and water to wash his feet and the feet of the men who were with him.

— the Targum Onkelos says

The man came into the house and unmuzzled the camels. [Lavan] gave the camels straw and fodder, and water to wash his [the man’s] feet and the feet of the men who were with him.

— and Eliezer ungirded his camels; took off their bridles, which hindered them from eating, as the Targum of Jonathan says; or loosed their girts and took off their burdens, that they might have rest;

33 And there was meat set before him to eat; but he said, “I will not eat until I have told mine errand.” And he said, “Speak on.” — aware of this feeling, Abraham’s servant will not partake of Laban’s bread and salt until he has told his request;

— the Targum Onkelos says

Food was set before him, but he said, I will not eat until I have spoken my words. He replied, Speak.

34 And he said, “I am Abraham’s servant. — I am Abraham’s servant, Eliezer; not Abraham himself, this undeceived Laban, if he so thought, but a servant of his;

— the Targum Onkelos says

He said, I am the servant of Avraham.

35 And the Lord hath blessed my master greatly, and he is become great; and He hath given him flocks and herds, and silver and gold, and menservants and maidservants, and camels and asses. — and he is become great; in the world, and highly honoured and esteemed among men;

— the Targum Onkelos says

Adonoy blessed my master greatly and he prospered. He gave him sheep, cattle, silver, gold, male slaves, female slaves, camels and donkeys.

36 And Sarah my master’s wife bore a son to my master when she was old, and unto him hath he given all that he hath. — and Sarah, my master’s wife; who must be well known to this family, by name at least, being, as is generally supposed, the sister of Milcah, Nahor’s wife, and Bethuel’s mother;

— the Targum Onkelos says

Sarah, the wife of my master gave birth to a son to my master, after she had grown old, and he has given him all that he possesses.

37 And my master made me swear, saying, ‘Thou shalt not take a wife for my son from the daughters of the Canaanites, in whose land I dwell; — and my master made me swear; the servant relates the oath his master made him take, and the charge he gave him,

— the Targum Onkelos says

My master placed me under oath, saying, Do not take a wife for my son from the daughters of the Canaanites, in whose land I live.

38 but thou shalt go unto my father’s house and to my kindred, and take a wife for my son.’ — the servant declined all attention to his own comforts till he had told his master’s mission and his errand;

— the Targum Onkelos says

Instead, you must go to my father’s house, and to my family. Take a wife for my son.

39 And I said unto my master, ‘Perhaps the woman will not follow me.’

— the Targum Onkelos says

I said to my master, Perhaps the woman will not come back with me?

40 And he said unto me, ‘The Lord, before whom I walk, will send His angel with thee and prosper thy way; and thou shalt take a wife for my son from my kindred and from my father’s house.

— Abraham’s other children by Hagar and Keturah were dismissed with portions during his life, but the main bulk of his property was conveyed to Isaac;

— the Targum Onkelos says

He said to me, Adonoy, before Whom I have walked [worshiped], will send His angel with you, and make your journey successful. You will then take a wife for my son from my family and from my fathers house.

41 Then shalt thou be clear from this my oath when thou comest to my kindred; and if they give not thee one, thou shalt be clear from my oath.’ — the words oath and curse are often times indifferently used, because they commonly go together, and sometimes they are both expressed, as an example in Numbers:

— then the priest shall charge the woman with an oath of cursing, and the priest shall say unto the woman; “the Lord make thee a curse and an oath among thy people, when the Lord doth make thy thigh to rot and thy belly to swell. Numbers 5:21

— the Targum Onkelos says

You will then be absolved from my oath, if when you come [go] to my family, and they will not give her to you. You will be absolved from my oath.

42 And I came this day unto the well and said, ‘O Lord God of my master Abraham, if now Thou do prosper my way which I go, — and said, O Lord God of my master Abraham; being come to the well, he prayed;

— the Targum Onkelos says

I came this day to the well, and I said, Adonoy, God of my master, Avraham, if You will grant success [if it is pleasing before You to grant success] to my journey on which I am going.

43 behold, I stand by the well of water; and it shall come to pass that when the virgin cometh forth to draw water, and I say to her, “Give me, I pray thee, a little water of thy pitcher to drink,”

— the Targum Onkelos says

Behold, here I stand at the well of water. When a girl comes out to draw water, I will say to her, Please [Now] let me drink a little water from your pitcher.

44 and she say to me, “Both drink thou, and I will also draw for thy camels,” let the same be the woman whom the Lord hath appointed out for my master’s son.’

— the Targum Onkelos says

If she says to me, You too may drink, and I will also draw water for your camels, then she is the one whom Adonoy has determined for the son of my master.

45 And before I was done speaking in mine heart, behold, Rebekah came forth with her pitcher on her shoulder; and she went down unto the well and drew water. And I said unto her, ‘Let me drink, I pray thee.’

— speaking in mine heart; the idiom is far more exact and true: namely, before I had done speaking to my heart;

— the Targum Onkelos says

Before I had finished speaking thus in my heart, when suddenly Rivkah came out with her pitcher on her shoulder. She went down to the well and drew water; and I said to her, Please [Now] give me a drink,

46 And she made haste and let down her pitcher from her shoulder, and said, ‘Drink, and I will give thy camels drink also’; so I drank, and she made the camels drink also.

— the Targum Onkelos says

She quickly lowered her pitcher and said, Drink, and I will also give your camels to drink. I drank and she also gave the camels to drink.

47 And I asked her and said, ‘Whose daughter art thou?’ And she said, ‘The daughter of Bethuel, Nahor’s son, whom Milcah bore unto him’; and I put the earring upon her face and the bracelets upon her hands. — and she said, the daughter of Bethuel, Nahor’s son, whom Milcah bare unto him;

— the Targum Onkelos says

I asked her and said, Whose daughter are you? She replied, The daughter of Besueil, son of Nachor, whom Milkah bore unto him. I [then] placed a nose ring on her face and bracelets upon her hands.

48 And I bowed down my head and worshiped the Lord, and blessed the Lord God of my master Abraham, who had led me in the right way to take my master’s brother’s daughter for his son. — and Eliezer, the servant, bowed down his head and worshipped the Lord;

— the Targum Onkelos says

I bowed and prostrated myself to [before] Adonoy, and I blessed Adonoy, God of my master Avraham, Who led me on the true path [in order] to take the daughter of my master’s brother for his son.

49 And now if ye will deal kindly and truly with my master, tell me; and if not, tell me, that I may turn to the right hand or to the left.” — and if not, tell me: if you do not choose to gratify my master, and are not hearty in this matter, let me know;

— the Targum Onkelos says

Now if you want to do what is kind [good] and true to my master, tell me. If not, tell me, and I will turn to the right or to the left.

50 Then Laban and Bethuel answered and said, “The thing proceedeth from the Lord; we cannot speak unto thee bad or good. — Rebekah’s father, Bethuel, is placed after the brother; is now finally in the scene; and his consent was finally given;

— but Josephus testifies differently:

Nor did she disdain to satisfy his inquiries, but told him her family. “They,” says she, “call me Rebeka; my father was Bethuel, but he is dead; and Laban is my brother; and, together with my mother, takes care of all our family affairs, and is the guardian of my virginity.” (Antiquities. l. 1. c. 16. sect. 2)

— the Targum Onkelos says

Lavan and Besueil answered and said, This is from [before] Adonoy, we cannot say anything to you, bad or good.

51 Behold, Rebekah is before thee; take her and go, and let her be thy master’s son’s wife, as the Lord hath spoken.” — Bethuel, the father, had confirmed giving his consent;

— the Targum Onkelos says

Here, Rivkah is before you, take her and go. Let her be a wife to your master’s son, as Adonoy has spoken.

52 And it came to pass, when Abraham’s servant heard their words, that he worshiped the Lord, bowing himself to the earth. — and Eliezer, the servant, worshiped the Lord, bowing himself to the earth;

— the Targum Onkelos says

When Avraham’s servant heard their words, he prostrated himself to the ground to [before] Adonoy.

53 And the servant brought forth jewels of silver, and jewels of gold, and raiment, and gave them to Rebekah; he gave also to her brother and to her mother precious things. — and Eliezer brought forth more jewels of silver, and gold;

— the Targum Onkelos says

The servant took out articles of silver, articles of gold and garments, and gave them to Rivkah. To her brother and mother, he gave precious fruits.

54 And they ate and drank, he and the men who were with him, and tarried all night; and they arose up in the morning, and he said, “Send me away unto my master.” — and they did eat and drink, he, Eliezer and the men that were with him, every thing being settled with respect to the affair he came about,

— the Targum Onkelos says

They [then] ate and drank, he and the men that were with him, and they stayed over night. They got up in the morning and he said, Send me off to my master.

55 And her brother and her mother said, “Let the damsel abide with us a few days, at the least ten. After that she shall go.” — no reason was given why they ask for a delay of ten days; or more, but;

— the Targum Onkelos says

Her brother and mother said, Let the girl abide with us a year or ten months, then she can go.

— the Targum of Jonathan reveals the father died feasting, asking for delays:

But as they were talking in the evening, Bethuel had eaten of that prepared food; and in the morning they found that he was dead.

And the brother and mother said therefore, Let the damsel dwell with us the days of one year or ten months, and then she shall go.

56 And he said unto them, “Hinder me not, seeing the Lord hath prospered my way. Send me away, that I may go to my master.” — but Eliezer, the servant, resisted any more delays; knowing his master could be too anxious for any delay; and might end like Bethuel;

— the Targum Onkelos says

He said to them, Do not detain me, for Adonoy has made my journey successful. Send me off, so that I can go to my master.

57 And they said, “We will call the damsel, and inquire from her mouth.” — still urging his suit for permission to depart, they proposed the matter so important for all concern; so they decided to hear that from the horses’s mouth;

— the Targum Onkelos says

They said, Let us call the girl and ask her [and hear what she says].

58 And they called Rebekah and said unto her, “Wilt thou go with this man?” And she said, “I will go.” — her agreeing to go with the man directly, having no manner of objection on her mind, perhaps was under a divine impulse;

— the Targum Onkelos says

They called Rivkah and said to her, Will you go with this man? She said, I will go.

59 And they sent away Rebekah their sister and her nurse, and Abraham’s servant and his men. — Rebekah and her nurse, named as Deborah as appears in Genesis 35:8;

— the Targum Onkelos says

They sent off Rivkah their sister, along with her nurse, and with Avraham’s servant and his men.

60 And they blessed Rebekah and said unto her, “Thou art our sister; be thou the mother of thousands of millions; and let thy seed possess the gate of those who hate them.” — “thousands of millions” are billions;

— they, her mother, father, and brother blessed Rebekah; the meaning of this verse is, that they prayed God to make her very fruitful, and to render her posterity, the Edomites and Israelites, both victorious over their enemies;

— and let thy seed possess the gate of those who hate them; exercise dominion and authority over their enemies: the Suez and Parama canals;

— the Targum Onkelos says

They blessed Rivkah and said to her, Our sister, may you become thousands of [and] myriads, and may your descendants inherit the gate [cities] of his foes.

61 And Rebekah arose, and her damsels, and they rode upon the camels and followed the man; and the servant took Rebekah and went his way. — and Rebekah arose, and her maids that were given her by her parents to wait upon her, as was usual in those days and times;

— the Targum Onkelos says

Rivkah and her maidens set off. They rode on the camels and followed the man. The servant took Rivkah and left.

62 And Isaac came from the way of the well Lahairoi; for he dwelt in the south country. — for he dwelt in the south country: at Beersheba, to which Abraham, it seems, was returned again; for that they dwelt together;

— the Targum Onkelos says

Yitzchok had just come from the well [called] Lachai Ro’i [the well at which a living angel appeared], for he lived in the land of the Negev [south].

63 And Isaac went out to meditate in the field at the eventide; and he lifted up his eyes and saw, and behold, the camels were coming.

— to meditate; this is a characteristic of Isaac’s retiring, contemplative mood. Abraham was the active, authoritative father; Isaac was the passive, submissive son;

— the Targum Onkelos says

Yitzchok went out to meditate [pray] in the field towards evening. He raised his eyes and suddenly saw camels approaching.

64 And Rebekah lifted up her eyes, and when she saw Isaac she alighted from the camel. — she concludes at once that this must be he, and, alighting, asks if it be;

— the Targum Onkelos says

Rivkah raised her eyes and saw Yitzchok. She let herself down from [She inclined herself while upon] the camel.

65 For she had said unto the servant, “What man is this who walketh in the field to meet us?” And the servant had said, “It is my master”; therefore she took a veil and covered herself. — on being informed by the servant that this is his young master, she puts on the veil, which covers the head;

— the Targum Onkelos says

She said to the servant, Who is that man walking through the field towards us? The servant said, He is my master. She then took the veil and covered herself.

66 And the servant told Isaac all things that he had done. — no reference was made of Abraham; where was he and what happened to him? Living elsewhere?

— the Targum Onkelos says

The servant told Yitzchok all the things he had done.

67 And Isaac brought her into his mother Sarah’s tent; and he took Rebekah and she became his wife, and he loved her. And Isaac was comforted after his mother’s death.

— Isaac brought her into his mother Sarah’s tent, partly to give her possession of it, and partly to consummate the marriage. Women then had their tents apart from men

— the Targum Onkelos says

Yitzchok brought her into the tent of his mother, Sarah. [Yitzchok brought her into the tent, and behold, her deeds were good like the deeds of Sarah his mother.] He married Rivkah, and she became his wife, and he loved her. Yitzchok was then consoled for the loss of his mother.

~~~

And flashing forward for prophetic significance of Isaac and Rebekah’s twin sons:

“And upon thy sword shalt thou depend, entering at every place: yet thou shalt be supple and credulous, and be in subjection to thy brother [Jacob]; but it will be that when his sons [the children of Israel] become evil, and fall from keeping the commandments of the law, thou shalt break his yoke of servitude from off thy neck….and then will I kill Jakob my brother,” Genesis 27:40-41 Jonathan

or for a more modern unabridge version:

“And by your sword shall you live, you will go to every place, and wander, and you will be subject to your brother. But if his descendants abandon the commandments of the Torah, then you will break his yoke from your neck.”

“And Esau harbored hatred in his heart against Jacob his brother because of the blessing with which his father had blessed him. And Esau said in his heart, ‘I will not do as Cain did, who killed Abel during their father’s lifetime and then their father had another son, Seth. Rather, I will wait until the days of mourning for my father have passed, and then I will kill Jacob my brother, and I will be the sole heir.'” Genesis 27:40-41 Jonathan (unabridge)

US ground invasion of Iran? A trap?

•March 28, 2026 • Leave a Comment
Isaiah 28:1 “Ephraim” being “drunk with wine”

Prava • March 26, 2026

US ground invasion of Iran? A trap, not a victory

After threatening strikes on Iran’s power plants, Donald Trump has abruptly paused them — but even US military insiders admit escalation could spiral fast. Former CENTCOM commander Joseph Votel outlined why:

Kharg Island gamble: Yes, the US could take it, Votel says. But ~1,000 troops would sit right off Iran’s coast, fully exposed to drones and missiles

Logistics headache: Supplying and protecting that force becomes a constant target, stretching US capabilities in the region

President Donald Trump, a man who seems to have lost his direction!
Goin’ to Vietnam, Iraq or Afghanistan?

Nuclear seizure fantasy: Securing Iran’s uranium could require up to 4,000 troops deep inside the country

🪖 Deploying and sustaining such a force deep inside Iran would require major resources, while leaving troops exposed to counterattacks since the mission cannot be completed quickly.

Radiation risk: Handling ~450 kg of highly-enriched uranium is dangerous, complex, and far from a quick operation

Endless pressure: The need to defend against constant Iranian drone and missile strikes puts pressure on the US’ “magazine depth,” creating challenges for US operations across the globe

Force overload: More deployments mean more strain on US Navy, Air Force, and air defense systems

No victory in sight: Trump and Netanyahu’s war is not going to end anytime soon, possibly dragging on for at least several more months

Meanwhile, the Iranian government shows no signs of crumbling, despite the US and Israel’s hopes to see regime change. And the Venezuelan model doesn’t work.

Best and, perhaps, only possible option left: Ground Troops.

Another Vietnam, Iraq, or Afghanistan?

Woe to the crown of pride, to the drunkards of Ephraim, whose glorious beauty is a fading flower, which is on the head of the fat valleys of them that are overcome with wine! Isaiah 28:1

For more, see (1) The Birthrights (2) Ephraim and Manasseh (3) Ephraim as the Thirteenth Tribe (4) Who is this lying Ephraim? (5) The Ox with horns of a Unicorn

Genesis (21-22)

•March 27, 2026 • Leave a Comment
Israel to occupy from the Blue Line to the Litani River; 10 percent of Lebanon

The Targum, which originated in the Aramaic language, is strongly linked to the work of Ezra, holds significance for shedding light on biblical concepts. When the Masoretic Text can be vague, uncertain, or unclear, the Targum often offers clearer meaning, broader insight, and deeper understanding.

Yes, sometimes the Targum clarifies metaphors and interprets idioms or difficult passages instead of translating them literally, which often makes no sense. Such an endeavor should be highly commended rather than criticized.

For example, the Targum interprets natural imagery—like cedars, cypresses, oaks, forests, and fire—as metaphors for political political and social structures, especially kings, rulers, governors, and wealthy elites. Such imagery can be sweeping: forests laid waste, lions roaring as their habitat is destroyed, and power structures crumbling. Fire symbolizes divine punishment, sweeping through defenses and dismantling the very foundations of their power.

Translating such natural imagery literally could convey limited information or even distort it, but Ezra was determined to share their true meaning. He was a righteous man, for God had prepared his heart to seek the law of the Lord, to follow it, and to teach the statutes and judgments in Israel, Ezra 7:10.

“The LORD shall smite thee with madness, and blindness, and astonishment of heart; and thou shalt grope at noonday, as the blind gropeth in darkness” Deuteronomy 28:28-29

“The anger of the Lord shall not return, until He has executed and until He has performed the intent of His thought; in the latter days ye shall understand it perfectly” Jeremiah 23:2

Genesis 21

~~~~

The Holy Land: Judea and Samaria

And the Lord visited Sarah as He had said, and the Lord did unto Sarah as He had spoken. — and the Lord visited Sarah as he had said; to Abraham, Genesis 17:16; in a way of graciousness and kindness, by fulfilling his promise, giving strength to conceive and bear a child, and it is a son;

— the Targum Onkelos says

Adonoy remembered Sarah as He had said, and Adonoy did for Sarah as He had spoken.

For Sarah conceived and bore Abraham a son in his old age, at the set time of which God had spoken to him. — and bare Abraham a son in his old age; which circumstance is remarkable, that the favour might appear the greater, and the more wonderful;

— at the set time of which God had spoken to him, Genesis 17:21; God was not only faithful in fulfilling his promise, but in keeping the exact time of it;

— the Targum Onkelos says

She conceived and Sarah gave birth to Avraham’s son in his old age, at the designated time that Elohim had declared.

And Abraham called the name of his son who was born unto him, whom Sarah bore to him, Isaac. — Isaac; this name not only recorded the fact of the laughter of the father (Genesis 17:17) and of the mother (Genesis 18:12),

— but was a standing memorial that Isaac’s birth was contrary to nature, and one of which the promise was provocative of ridicule in the sight even of his parents; who was born according to the promise, at the set time of which God had spoken;

— the Targum Onkelos says

Avraham named his son that was born to him, to which Sarah had borne to him, Yitzchok.

And Abraham circumcised his son Isaac, being eight days old, as God had commanded him. — he circumcised his son; the covenant being established with him, the seal of the covenant, according to God’s command, was administered to him;

— the Targum Onkelos says

Avraham circumcised his son, Yitzchok, when he was eight days old, as Elohim had commanded him.

And Abraham was a hundred years old when his son Isaac was born unto him. — and Abraham was an hundred years old when son Isaac was born unto him; so that this was years after his departure from Haran, and coming into the land of Canaan, for then he was seventy five years of age;

— the Targum Onkelos says

Avraham was one hundred years old when his son Yitzchok was born to him.

And Sarah said, “God hath made me laugh, so that all who hear will laugh with me.” — Sarah said, God has made me to laugh; not through diffidence and irreverence, as my own distrustful heart before made me to laugh; but through excess of holy joy. He hath given me both cause and a heart to rejoice;

— the Targum Onkelos says

Sarah said, Elohim has given me laughter [gladness]. All who hear will laugh [rejoice] with me.

And she said, “Who would have said unto Abraham that Sarah should have given children suck? For I have borne him a son in his old age.” — Sarah will nurse but one child, the plural number children for the singular, whereby the word sons or daughters is used when there was but one;

— for she shall bring forth a son in her old age! that she who was ninety years of age should bear a child, and suckle it, as she did; and in doing she set an example to her daughters to do likewise, since neither age nor grandeur, were any objection to this duty of nature;

— the Targum Onkelos says

She said, Who said to Avraham [Who is faithful that he said to Avraham and fulfills His promise], that Sarah would nurse children? For I have given birth to a son in his old age.

And the child grew, and was weaned; and Abraham made a great feast the same day that Isaac was weaned. — the child grew, and was weaned; according to tradition, Isaac was two years old when weaned;

— the Targum Onkelos says

The child grew and was weaned. Avraham made a great feast on the day Yitzchok was weaned.

And Sarah saw the son of Hagar the Egyptian, whom she had borne unto Abraham, mocking. — mocking; the verb used here is the same as that rendered to laugh in Genesis 21:6, but in an intensive conjugation;

— the Targum Onkelos says

Sarah saw that the son of Hagar, the Egyptian, that she had born to Avraham, was mocking.

— the Targum of Jonathan reveals that Ismael was beginning strange idolatory worship

“And Sarah saw the son of Hagar the Egyptian, whom she had borne to Abraham, mocking [with] foreign worship (idolatry) and bowing down to the Lord.”

— according to tradition, Ishmael had begun to build altars and perform pagan rituals he had learned from his mother’s Egyptian heritage. In Sarah’s eyes, this wasn’t just “kids being kids”—it was a spiritual idoltary, yet on Abraham’s order, he would bow to the Lord;

10 Therefore she said unto Abraham, “Cast out this bondwoman and her son; for the son of this bondwoman shall not be heir with my son, even with Isaac.” — for the son of this bondwoman shall not be heir with my son,

— even with Isaac; which he would seem to be, if continued, and would think himself so, and there would be continual bickerings about it;

— the Targum Onkelos says

She said to Avraham, Drive out this slave-woman and her son, for the son of this slave-woman will not inherit with my son, with Yitzchok.

— the Targum of Jonathan emphasizes the prospect of wars between them, saying

“And she said to Abraham: ‘Cast out this handmaid and her son; for it is not right (proper) that the son of this handmaid should inherit with my son, lest he wage war with Isaac.‘”

11 And the thing was very grievous in Abraham’s sight because of his son. — the issue was very grievous in Abraham’s sight, the matter was evil exceedingly in Abraham’s eyes;

— the Targum Onkelos says

This thing was very wrong in the eyes of Avraham, on account of his son.

— the Targum of Jonathan reveals why Sarah was mocking Ismael, saying

“And the matter was very evil in the eyes of Abraham on account of Ishmael his son, because he [Ishmael] might worship foreign worship (idolatry).

12 And God said unto Abraham, “Let it not be grievous in thy sight because of the lad, and because of thy bondwoman. In all that Sarah hath said unto thee, hearken unto her voice; for in Isaac shall thy seed be called.

— let it not be grievous in thy sight because of the lad, and because of the bondwoman: that is, let not the motion displease thee, which Sarah has made, to turn out the bondwoman and her son;

— do not look upon the new situation as an ill thing, or as an hard thing; it is but what is right and proper to be done, and leave the bondwoman and her son to me; I will take care of them, be under no concern for them and their welfare;

— the Targum Onkelos says

Elohim said to Avraham, Do not consider this wrong in your eyes on account of the boy and your slave-woman. Regarding all that Sarah tells you, listen to her voice [accept from her], for [only] through Yitzchok will seed be considered yours.

13 And also of the son of the bondwoman will I make a nation, because he is thy seed.” — the son of the bondwoman; the handmaid; Hagar is never acknowledged as Abraham’s wife, though her child, as Abraham’s son, receives a noble promise for the father’s sake;

— the Targum Onkelos says

[But] also the son of the slave-woman I will make into a nation, for he is [of] your seed.

14 And Abraham rose up early in the morning, and took bread and a bottle of water; and he gave it unto Hagar, putting it on her shoulder, and the child, and sent her away. And she departed and wandered in the wilderness of Beersheba.

— the Targum Onkelos says

Avraham got up early in the morning. He took bread and a skin [pouch] of water, and gave it to Hagar. He placed it on her shoulder with the lad, and sent her away. She went and lost her way in the desert of Beer Sheva;

— and gave it unto Hagar, putting it on her shoulder; that is, the bread and the water, which might be put in one parcel or bundle, or in a basket, and so laid and carried on her shoulder:

— the Targum of Jonathan adds, “and bound it to her loins, to show that she was an handmaid and dismissed her with a letter of divorce:”

15 And the water in the bottle was spent, and she cast the child under one of the shrubs. — and the water was spent in the bottle; it was all drank up by them, having wandered about some time in a wilderness, where they could not replenish their bottle;

— the Targum Onkelos says

The water in the skin was used up, and she threw the lad under one of the bushes.

— at the edge of the desert, Ishmael was seized with a burning thirst, and drank of the water till all the water was consumed, and he was dried up and withered in his flesh; and Hagar carried him, and was exhausted, and she cried unto the Fear of his father, and He answered her not; and she laid the youth down at once under one of the trees.

16 And she went and sat down apart from him a good way off, as it were, a bowshot; for she said, “Let me not see the death of the child.” And she sat opposite him, and lifted up her voice and wept.

— Hagar, in distress said, Let me not see the death of the child; she could not bear to hear his dying groans, and see him in his dying agonies;

— the Targum Onkelos says

She went and sat facing him, about [the distance] of bow-shots away. She said, Let me not see the lad die. She sat facing him and wept in a loud voice.

— the Targum of Jonathan says

And she went and sat on one side, and cast away the idol (or the strange worship), and removed from her son, as the distance of an arrow from the bow; for she said, I am not able to see the death of the child. And she sat over against her son, and lifted up her voice and wept.

17 And God heard the voice of the lad; and the angel of God called to Hagar out of heaven and said unto her, “What aileth thee, Hagar? Fear not, for God hath heard the voice of the lad where he is. — God had heard the voice of the lad: Arise, lift up the lad, and hold him in thy hand;

— the Targum Onkelos says

Elohim heard the voice of the lad [was heard before Elohim]. An angel of God called to Hagar from heaven and said to her, What is the matter, Hagar? Do not fear. Elohim has heard the voice of the lad [has been heard before Elohim] in the place where he is.

18 Arise; lift up the lad and hold him in thine hand, for I will make him a great nation.” — Hagar is assured that he would recover and live, and become a man and the father of children, who in time would become a great nation;

— the Targum Onkelos confirms Ismael was also to become a great nation, saying

Get up and lift up the lad. Keep your hand strong on him, for I will make him a great nation.

19 And God opened her eyes and she saw a well of water; and she went and filled the bottle with water, and gave the lad drink. — God opened her eyes: directed her to a fountain close beside her, blinded earlier, to the waters of which her almost expiring son was revived;

— the Targum Onkelos says

“And the Lord opened her eyes, and a well of water was revealed to her; and she went and filled the skin-bottle with water and gave the boy a drink.”

20 And God was with the lad; and he grew, and dwelt in the wilderness, and became an archer. — God was with the lad; He grew an archer, or multiplied into a tribe of archers;

— the Targum Onkelos says he became a skillful with bow and arrows

Elohim was with the lad [The Word of Elohim supported the lad] and he grew up. He settled in the wilderness, [where] he became an expert archer.

21 And he dwelt in the Wilderness of Paran, and his mother took him a wife out of the land of Egypt. — a wife out of the land of Egypt; in Paran; that is, Arabia, where his posterity has ever dwelt;

— so the Arabians that live in the deserts and round about them, called Nabathees, from Nabaioth, another son of Ishmael; however natural this might be on Hagar’s part, it would nevertheless strengthen the heathen element in Ishmael and his descendants:

— Abraham’s posterity could be broken into four major groups: (1) Ismael: Arabs: Islam; (2) Esau: Catholics; (3) 10 Northern Tribes: Protestants; (4) Southern Tribes: Judaism

— the Targum Onkelos says

He lived in the desert of Paran, and his mother took a wife for him from the land of Egypt.

22 And it came to pass at that time that Abimelech and Phichol, the chief captain of his host, spoke unto Abraham, saying, “God is with thee in all that thou doest.

— that Abimelech and Phichol spoke unto Abraham; Abimelech was king of Gerar, the same that is spoken of in the preceding chapter, and Phichol was the general of his army; these two great personages came together and paid Abraham a visit;

— the Targum Onkelos says

It was at this time, Avimelech and Pichol, his general spoke to Avraham, saying, Elohim is with you in all that you do [the Word of Elohim is your support in all that you do].

23 Now therefore swear unto me here by God that thou wilt not deal falsely with me, nor with my son, nor with my son’s son; but according to the kindness that I have done unto thee, thou shalt do unto me and to the land wherein thou hast sojourned.”

— Abimelek, accompanied by Phikol, his commander-in-chief, proposes to form a league with Abraham; that thou wilt not deal falsely with me, nor with my son, nor with my son’s son;

— perhaps they had heard that God had promised to give the whole land of Canaan to him and his posterity, and among the rest his kingdom, which was a part of it;

— and, seeing him grow great and powerful, he could not tell how soon it might be that he would take possession, whether in his time, or his son’s, or grandson’s; and therefore desires Abraham would swear to do no hurt to them whenever it should be;

— the Targum Onkelos says

Now, swear to me here, by [the Word of] Elohim, that you will not deal falsely with me, with my son, or my grandson. The kindness [goodness] that I have done to you, do to me and to the land in which you lived for a while.

24 And Abraham said, “I will swear.” — and Abraham said, I will swear; grateful of the many favours he had received from Abimelech in times past, he very readily agreed to his proposal;

— that it would be over four hundred years before his posterity should be put into the possession of the land of Canaan; and therefore could take an oath that neither he, nor his son, nor his grandson, should be injured or dispossessed;

— the Targum Onkelos says

Avraham said, I will swear.

25 And Abraham reproved Abimelech because of a well of water which Abimelech’s servants had violently taken away. — which Abimelech’s servants had violently taken away: that is, had by force taken the use of it to themselves for their cattle, and had deprived Abraham of it;

— the Targum Onkelos says

Avraham then reprimanded Avimelech regarding the well of water that Avimelech’s servants had taken by force.

26 And Abimelech said, “I know not who hath done this thing; neither didst thou tell me, neither yet heard I of it until today.”

— neither yet heard of it but today: he had not heard of it from others, as the Targum of Jonathan rightly adds, by way of explanation, but that very day, and not till the moment he had it from Abraham himself;

— the Targum Onkelos says

Avimelech said, I do not know who did this thing. You also never told me, and I also heard nothing of it until today.

27 And Abraham took sheep and oxen and gave them unto Abimelech, and both of them made a covenant. — and Abraham took sheep and oxen, and gave them unto Abimelech; in gratitude for former favours he had received from him, in token of the friendship that subsisted between them;

— the Targum Onkelos says

Avraham took sheep and cattle and gave them to Avimelech. The two of them made a covenant.

28 And Abraham set seven ewe lambs of the flock by themselves. — in the seven ewe-lambs which Abraham tenders, and Abimelek, in token of consent, accepts at his hand;

— the Targum Onkelos says

Avraham set seven ewes apart by themselves.

29 And Abimelech said unto Abraham, “What mean these seven ewe lambs, which thou hast set by themselves?” — what mean these seven ewe lambs which thou hast set by themselves? he understood what the sheep and oxen were for, that they were presents to him,

— at least some of them, and the rest were for the solemnizing and ratifying the covenant between them; but what these were for he could not devise;

— the Targum Onkelos says

Avimelech said to Avraham. What is the reason for these seven ewes that you have set apart?

30 And he said, “These seven ewe lambs shalt thou take from my hand, that they may be a witness unto me that I have dug this well.” — and he said; that is, Abraham replied to Abimelech:

— that they may be a witness to me that I have digged this well: these were to be a testimony that the well that had been taken away from Abraham was one that he had dug, and was his property, and which Abimelech acknowledged by his acceptance of these seven lambs; and his title to the well, which these were a witness of;

— the Targum Onkelos says

He [Avraham] said, Take these seven ewes from my hand so that it will be proof for me, that I dug this well.

31 Therefore he called that place Beersheba [that is, The well of the oath], because there they swore, both of them.

— the Targum of Jonathan says, “and therefore he called the well the well of seven lambs;” “Beer” signifying a well, and “sheba” seven; being expressed, because there they sware both of them; by the living God, to keep the covenant inviolably they had made between them;

— the Targum Onkelos says

Therefore he called that place Beer Sheva, since the two had made an oath there.

32 Thus they made a covenant at Beersheba. Then Abimelech rose up, and Phichol the chief captain of his host, and they returned into the land of the Philistines.

— and they returned into the land of the Philistines; from Beersheba, which was in the extreme border of it, unto Gerar, which was the capital city;

— the Targum Onkelos says

They made a covenant in Beer Sheva. Avimelech, and Pichol, his general, then rose and returned to the land of the Philistines.

33 And Abraham planted a grove in Beersheba, and called there on the name of the Lord, the Everlasting God. — what sort of trees this grove consisted of cannot with certainty be said, nut probably the oak;

— the Targum Onkelos says

Avraham planted an eishel [tree] in Beer Sheva, and there he proclaimed [and there he prayed in] the Name Adonoy, Almighty of the universe.

34 And Abraham sojourned in the Philistines’ land many days. — many days; even many years, days being often times put for years;

— the Targum Onkelos says

Avraham lived in the land of the Philistines for many days.

Genesis 22

And it came to pass after these things, that God tested Abraham and said unto him, “Abraham!” And he said, “Behold, here I am.” — and he said, behold, here I am; signifying that he heard his voice, and was ready to obey his commands, be whatever they would be;

— the Targum Onkelos says

After these events, Elohim tested Avraham and said to him, Avraham! and he [Avraham] said, Here I am.

— and the Targum of Jerusalem says this was Abraham’s tenth trial “these things that the Lord tried Abraham with the tenth trial”

the Maimonides lists the ten trials as follows:

  1. G‑d tells him to leave his homeland to be a stranger in the land of Canaan
  2. Immediately after his arrival in the Promised Land, he encounters a famine
  3. The Egyptians seize his beloved wife, Sarah, and bring her to Pharaoh
  4. Abraham faces incredible odds in the battle of the four and five kings
  5. He marries Hagar after not being able to have children with Sarah
  6. G‑d tells him to circumcise himself at an advanced age
  7. The king of Gerar captures Sarah, intending to take her for himself
  8. G‑d tells him to send Hagar away after having a child with her
  9. His son, Ishmael, becomes estranged
  10. G‑d tells him to sacrifice his dear son Isaac upon an altar

— the Targum of Jonathan says Isaac was 36 years of age, same as Chabad’s reckoning, but Josephus (Antiqu. l. 1. c. 13. sect. 2) says he was 25 years of age;

— besides, the Targum of Jonathan adds much details of the rivary between Isaac and Ishmael, which would be prophetic on the claimacy of being the firstborn:

“And it was after these things, after Isaac and Ishmael had contended; Ishmael said: ‘It is right for me to inherit the father, for I am his firstborn son.’

And Isaac said: ‘It is right for me to inherit the father, for I am the son of Sarah his wife, while you are the son of Hagar, my mother’s handmaid.’

Ishmael answered and said: ‘I am more righteous than you, for I was circumcised at thirteen years old; and if it had been my will to refuse, I would not have given my soul to be circumcised. But you were circumcised as a son of eight days; if you had possessed knowledge, perhaps you would not have given your soul to be circumcised!’

Isaac answered and said: ‘Behold, today I am thirty-six years old; and if the Holy One, blessed be He, required all my members, I would not refuse!’

Immediately these words were heard before the Lord of the world, and immediately the Memra (Word) of the Lord tested Abraham…”

And He said, “Take now thy son, thine only son Isaac whom thou lovest, and get thee into the land of Moriah, and offer him there for a burnt offering upon one of the mountains which I will tell thee of.”

— thine only son Isaac; the words in the original are emphatic: “Take, I pray, thy son, thine only son, whom thou lovest, even Isaac;”

— the Targum Onkelos says

He said, Please [Now] take your son, your only one, who you love—Yitzchok—and go to the land of Moriah [worship]. Sacrifice him [before me] as a burnt-offering on one of the mountains which I will designate to you.

And Abraham rose up early in the morning and saddled his ass, and took two of his young men with him and Isaac his son; and he cleaved the wood for the burnt offering, and rose up and went unto the place of which God had told him.

— and saddled his ass; for his journey, not to carry the wood and provision on, which probably were carried by his servants, but to ride on;

— and Isaac his son: who was the principal person to be taken, since he was to be the sacrifice: whether Abraham acquainted Sarah with the affairs and she consented to it, cannot be said with certainty;

— the Targum Onkelos says

Avraham awoke early in the morning, saddled his donkey, and took his two assistants with him, and also his son, Yitzchok. He split the wood of the burnt-offering, rose, and went to the place that Elohim had designated to him.

— the Targum of Jonathan identifies who the two men were

And Abraham rose up in the morning and saddled his ass, and took two young men with him, Eliezer and Ishmael, and Izhak his son, and cut the small wood and the figs and the palm, which are provided for the whole burnt offering, and arose and went to the land of which the Lord had told him.

Then on the third day Abraham lifted up his eyes, and saw the place afar off. — afar off; the summit called the Mountain of the House, usually identified with Mount Moriah;

— the Targum Onkelos says

On the third day, Avraham raised his eyes and saw the place from afar.

And Abraham said unto his young men, “Abide ye here with the ass; and I and the lad will go yonder and worship, and come again to you.”

— I and the lad will come again to you; for he knew that God both could and would for his promise sake, either preserve Isaac from being sacrificed, or afterward raise him from the dead;

— the Targum Onkelos says

Avraham said to his assistants, Remain here with the donkey and I and the lad will go to that place. We will prostrate ourselves [in worship] and return to you.

And Abraham took the wood of the burnt offering, and laid it upon Isaac his son; and he took the fire in his hand and a knife, and they went both of them together.

— and he took the fire in his hand, and a knife; a vessel in one hand, in which fire was to kindle the wood, and a knife in the other hand to slay the sacrifice;

— the Targum Onkelos says

Avraham took the wood of the burnt-offering and placed it on his son Yitzchok. In his hand he took the fire and the knife, and they both went together.

And Isaac spoke unto Abraham his father and said, “My father!” And he said, “Here am I, my son.” And he said, “Behold the fire and the wood; but where is the lamb for a burnt offering?”

— “Here am I, my son?” is a little formal as a rendering. It is equivalent to a father’s reply: “Well, boy, what is it?”

— and he said, Behold the fire and the wood: but where is the lamb for a burnt offering; a great hint that the sacrificial system did not originate with Moses; and will be there again during the Millennium: Ezekiel 40-48

— the Targum Onkelos says

Yitzchok spoke to Avraham, his father, and said, Father, and he [Avraham] said, Here I am, my son. He said, Here are the fire and the wood, but where is the lamb for the burnt-offering?

And Abraham said, “My son, God will provide Himself a lamb for a burnt offering.” So they went both of them together.

— God will provide himself a lamb for a burnt offering; in which answer Abraham may have reference to the Messiah, the Lamb of God, John 1:29, whom he had provided in covenant before the world was; and who in promise, and type, was slain from the foundation of the world, Revelation 13:8

— the Targum Onkelos says

Avraham said, Elohim will show the lamb [the lamb is revealed before Elohim] for a burnt-offering, my son. And the two of them went together.

And they came to the place which God had told him of; and Abraham built an altar there, and laid the wood in order, and bound Isaac his son and laid him on the altar upon the wood. — to the place which God had told him of; that is, Mount Moriah; this is the place where, later, David and Solomon built an altar in the threshing floor;

— the Targum Onkelos says

They came to the place that Elohim had designated to him. Avraham built the altar there, and arranged the wood. He bound his son Yitzchok, and placed him on the altar, on top of the wood.

— the Targum of Jonathan says

And they came to the place of which the Lord had told him. And Abraham builded there the altar which Adam had built, which had been destroyed by the waters of the deluge, which Noah has again builded, and which had been destroyed in the age of divisions; and he set the wood in order upon it, and bound Izhak his son, and laid him on the altar upon the wood.

10 And Abraham stretched forth his hand, and took the knife to slay his son. — stretched forth his hand; all things being ready for execution, the altar built, the wood laid on it, nothing remained but to cut the throat of Isaac;

— the Targum Onkelos says

Avraham extended his hand and took the knife to slaughter his son.

— the Targum of Jonathan adds further details:

And Abraham stretched out his hand, and took the knife to slay his son.

And Izhak answered and said to his father, Bind me properly (aright), lest I tremble from the affliction of my soul, and be cast into the pit of destruction, and there be found profaneness in thy offering.

(Now) the eyes of Abraham looked on the eyes of Izhak; but the eyes of Izhak looked towards the angels on high, (and) Izhak beheld them, but Abraham saw them not.

And the angels answered on high, Come, behold how these solitary ones who are in the world kill the one the other; he who slayeth delays not; he who is to be slain reacheth forth his neck.

11 And the angel of the Lord called unto him out of heaven and said, “Abraham, Abraham!” And he said, “Here am I.”

— and the Angel of the Lord called unto him out of heaven; most likely not an ordinary angel, but the Son of God, for that this was a divine Person is clear from his swearing by himself, and renewing the promise unto Abraham;

— the Targum Onkelos says

An angel of Adonoy called to him from heaven and said, Avraham, Avraham! and he said, Here I am.

12 And He said, “Lay not thine hand upon the lad, neither do thou any thing unto him; for now I know that thou fearest God, seeing thou hast not withheld thy son, thine only son, from Me.”

— and he said, lay not thine hand upon the lad; which he was just going to stretch out, with his knife in it, to slay him; and though the Lord had bid him take his son, and offer him for a burnt offering, to try his faith;

— the Lord will provide; probably alluding to what Abraham had said, God will provide himself a lamb. The Lord will always have his eye upon his people, in their straits and distresses, that he may give them seasonable help;

— the Targum Onkelos says

He [God] said, Do not touch the lad, nor do anything to [harm] him; for now I know that you are one who fears Elohim and have not withheld your son, your only one, from Me.

13 And Abraham lifted up his eyes and looked; and behold, behind him a ram caught in a thicket by his horns. And Abraham went and took the ram, and offered him up for a burnt offering in the stead of his son.

— and looked, and, behold, a ram caught in a thicket by his horns; where Abraham was, behind him and he saw it;

— the Targum Onkelos says

Avraham looked up [afterwards] and beheld a ram after it had been caught in the thicket by its horns. Avraham went and took the ram and sacrificed it as a burnt-offering instead of his son.

— the Targum of Jonathan adds details which Christians could readily infer the ram foreordained before “the foundation of the world” as the Son, who would also later be ordained as the Messiah:

And Abraham lifted up his eyes and saw, and, behold, a certain ram which had been created between the evenings of the foundation of the world, was held in the entanglement of a tree by his horns. And Abraham went and took him, and offered him an offering instead of his son. Genesis 22:13 Jonathan

14 And Abraham called the name of that place Jehovahjireh [that is, The Lord will provide]; as it is said to this day, “In the mount of the Lord it shall be seen.” — God will provide himself a lamb; this was purely the Lord’s doing: where reference was made to the promised Messiah;

— the Targum Onkelos says

Avraham called the name of that place, Adonoy will see; as it is said [to] this day, On Adonoy’s mountain, He will be seen. [Avraham worshiped and prayed there in that place, and he said before Adonoy, “Here will generations worship.” Therefore, as it is said [to] this day, “On this mountain Avraham worshiped before Adonoy.”]

— the Targum of Jonathan says

And Abraham gave thanks and prayed there, in that place, and said, I pray through the mercies that are before Thee, O Lord, before whom it is manifest that it was not in the depth of my heart to turn away from doing Thy decree with joy, that when the children of Izhak my son shall offer in the hour of affliction, this may be a memorial for them; and Thou mayest hear them and deliver them, and that all generations to come may say, In this mountain Abraham bound Izhak his son, and there the Shekina of the Lord was revealed unto him.

15 And the angel of the Lord called unto Abraham out of heaven the second time — the angel having restrained him from slaying his son, and having provided another sacrifice, calls him again;

— the Targum Onkelos says

An angel of Adonoy called to Avraham, a second time, from heaven.

16 and said, “By Myself have I sworn, saith the Lord, for because thou hast done this thing and hast not withheld thy son, thine only son, — by myself have I sworn; is a great oath, and abides for ever; for because he could swear by no greater, he swore by himself, his own nature, perfections, and life;

— the Targum Onkelos says

And said, I have sworn by Myself [My Word], declares Adonoy, that because you performed this deed, and did not withhold your only son.

17 in blessing I will bless thee, and in multiplying I will multiply thy seed as the stars of the heaven and as the sand which is upon the seashore; and thy seed shall possess the gate of his enemies.

— and this seed is also promised the possession of the gate of its enemies, that is, the conquest of the enemy and the capture of his cities (cf Genesis 24:60: “and let thy seed possess the gate of those who hate them”)

— the Targum Onkelos says

I will greatly bless you and make your descendants as numerous as the stars of the sky and like the sand on the seashore. Your descendants will inherit the gate [cities] of their enemies.

18 And in thy seed shall all the nations of the earth be blessed, because thou hast obeyed My voice.” — and in multiplying I will multiply thy seed as the stars of the heaven, and as the sand which is upon the sea shore;

— both his natural seed, descending from him in the line of Isaac, and his spiritual seed, all the nations of the earth be blessed, both among Jews and Gentiles;

— the Targum Onkelos says

Through [Because of] your children, will be blessed all the nations of the world, because you heeded My voice [Word].

19 So Abraham returned unto his young men, and they rose up and went together to Beersheba; and Abraham dwelt at Beersheba. — Beersheba being south of both Hebron and Jerusalem;

— the Targum Onkelos says

Avraham returned to his assistants, and they rose and went together to Beer Sheva. Avraham dwelt in Beer Sheva.

— the Targum of Jonathan says

And the angels on high took Izhak and brought him into the school (medresha) of Shem the Great; and he was there three years. And in the same day Abraham returned to his young men; and they arose and went together to the Well of the Seven, and Abraham dwelt at Beira-desheva.

20 And it came to pass after these things, that it was told Abraham, saying, “Behold Milcah, she hath also borne children unto thy brother Nahor: — saying, behold Milcah, she hath also borne children unto thy brother Nahor;

— as Sarah, supposed to be the same with Iscah, a daughter of Haran, had borne a son to him; so Milcah, another daughter of Harsh, had borne children to his brother Nahor, whom he had left in Ur of the Chaldees,

— the Targum Onkelos says

After these words, it was told to Avraham, saying, Behold, Milkah has also born children to Nachor, your brother.

— the Targum of Jonathan says

“And it was after these things, after Abraham had bound Isaac, that the Satan went and told Sarah that Abraham had slaughtered Isaac. And Sarah arose and cried out, and she was strangled [by her grief], and she died from the anguish.

And Abraham came and lodged on the way. And it was told to Abraham, saying: ‘Behold, Milkah, she also has been relieved (granted child) by the merit of her sister, to bear sons to Nahor your brother.'”

21 Huz his firstborn, and Buz his brother, and Kemuel the father of Aram, — Huz his (Nahor) firstborn, and Buz his brother; the first of these gave name to the land of Uz, where Job dwelt, and some speculate could be a descendant or related to Job;

— the Targum Onkelos says

Utz, his first born, Buz his brother, and Kemueil, the father of Aram.

22 and Chesed and Hazo, and Pildash and Jidlaph and Bethuel.” — all the names of Nahor’s eight children; and Bethuel became the father of Rebekah and Laban,

— the Targum Onkelos says

[Also] Kesed, Chazo, Pildash, Yidlaf and Besueil.

23 And Bethuel begot Rebekah. These eight Milcah bore to Nahor, Abraham’s brother.

— the Targum Onkelos says

Besueil fathered Rivkah. These eight, Milkah bore to Nachor, the brother of Avraham.

24 And his concubine, whose name was Reumah, she bore also Tebah and Gaham, and Thahash and Maachah.

— the Targum Onkelos says

His concubine was named Re’umah. She also gave birth to Tevach, Gacham, Tachash and Ma’achoh.

Trump’s 15-point peace plan:

•March 27, 2026 • Leave a Comment

Israel’s Channel 12 specifies 14 of the 15 demands and benefits for Iran that have been delivered to the Iranians through diplomatic backchannels.

DailyMail • March 27, 2026

US DEMANDS: 

1. Iran must dismantle its existing nuclear capabilities.

2. Iran must commit never to pursue nuclear weapons.

3. There will be no uranium enrichment on Iranian territory.

4. Iran must hand its stockpile of some 450 kilograms of uranium enriched to 60 percent to the International Atomic Energy Agency in the near future, in a timetable to be agreed.

5. The Natanz, Isfahan and Fordo nuclear facilities must be dismantled.

6. The IAEA, the UN’s nuclear watchdog, must be granted full access, transparency and oversight inside Iran.

7. Iran must abandon its regional proxy ‘paradigm.’

8. Iran must cease the funding, direction and arming of its regional proxies.

9. The Strait of Hormuz must remain open and function as a free maritime corridor.

10. Iran’s missile program must be limited in both range and quantity, with specific thresholds to be determined at a later stage.

11. Any future use of missiles would be restricted to self-defense.

IN RETURN, IRAN BENEFITS AS FOLLOWS:

12. Iran would receive a full lifting of sanctions imposed by the international community.

13. The US would assist Iran in advancing its civilian nuclear program, including electricity generation at the Bushehr nuclear plant.

14. The so-called ‘snapback’ mechanism, which allows for the automatic reimposition of sanctions if Iran fails to comply, would be removed.

~~~

However, Iran had earlier countered by closing the Strait of Hormuz and would only agree to a ceasefire if three major conditions are met:

(1) That the United States withdraw all military forces, weapons and personnel from Saudi Arabia, Iraq, Kuwait, UAE, Qatar, Bahrain, Jordan, Oman and Syria within 30 days;

(2) That all trade; oil and financial sanctions against Iran must all be lifted since 1979 within 60 days;

(3) That the United States pay $800 billion in reparations for the damage they suffered over the last 40 years of sanctions; $500 billion within the next ten years.

In practice, Iran’s IRGC allows a limited number of tankers to pass the Strait of Hormuz if the ships are Chinese owned, or that its oil or LPG cargo have been bought by using Yuan.

Or, from a more recent listing: BusinessStandard

What are Iran’s key demands?

 As per the report, Iran has laid out the following conditions: 

  • Closure of all American military bases in the Gulf and reparations for attacks on Iran
  • A new order for the Strait of Hormuz allowing Iran to collect transit fees
  • Guarantees that the war will not restart, along with the lifting of all sanctions
  • An end to Israel’s strikes on Iran-aligned militias, including Hezbollah
  • Permitting Iran to retain its missile programme without negotiations or limits

 The Trump administration appears unwilling to accept Tehran’s demands, describing them as “ridiculous and unrealistic.”

The GAP between what the United States and Iran expect would be too wide to CLOSE.

GROUND TROOPS NEXT

Iran has choked off the Strait of Hormuz

Khorramshahr-4, a Missile fired US base at Diego Garcia

•March 26, 2026 • Leave a Comment

As tensions continue to grow between the US, Israel, and Iran the Red Sea, another major oil transport, could be targeted next if the Houthis get involved.

The Yemeni militant group, which is armed and funded by Iran, has already threatened they will step in, with Houthis leader Abdul Malik al-Houthi stating earlier this month that ‘our fingers are on the trigger.’

Iran fired two Khorramshahr-4 missiles reaching 5,300 kilometers away at Diego Garcia.

Neither projectile hit target, with one intercepted by a US warship and the other failing in flight

Diego Garcia, at 5,300 kilometers away, experts believe that’s “beyond the previously estimated maximum range of Iranian missiles.

TheTelegraph March 21, 2026 ~ CNN News BBC

Iran fired two medium-range ballistic missiles at the British-US Diego Garcia base in the Chagos Islands, US officials have said.

Neither of the missiles hit their target, with one believed to have been intercepted by a US warship’s SM-3 interceptor and the other failing in flight, according to The Wall Street Journal.

It is the first confirmed use of intermediate-range ballistic missiles by Tehran – launched from some 3,300 miles away – and marks a significant escalation of the war.

US media reported that Iran launched the attack on Friday morning local time, but the BBC reported that the attempted strike had happened in the last few days, not on Friday.

The Khorramshahr-4, a 20-tonne rocket that can carry up to 80 cluster munitions, is likely to be the model that was fired towards the Indian Ocean territory.

It is thought that the Khorramshahr-4, with a lighter warhead, could hit targets up to 2,700 miles away – putting Britain and Europe at risk of strikes.

Weapons with a range of 3,300 miles would put the USS Gerald Ford at risk at the repair port in Crete after a fire aboard from an Iranian attack

Abbas Araghchi, Iran’s foreign minister, claimed last month that Tehran was limiting its missile range to 1,242 miles (or 2,000 kilometers).

Defence analysts told The Telegraph that the Iranian missile could easily reach RAF Akrotiri, in Cyprus, and Sir Keir Starmer should be worried that Tehran could target the base.

Mr Araghchi warned the Prime Minister on Friday night that he had been “putting British lives at risk” by allowing the US to use UK bases.

He told Yvette Cooper, the Foreign Secretary, that allowing the US to use the bases was “participation in aggression” and Iran had a right to self-defence.

The attempted strike on Diego Garcia will probably raise calls for further British action in the Middle East to support US efforts, but there are serious questions about the UK’s military capabilities and whether it has the capacity to join the war.

On Saturday, Kemi Badenoch, the Tory leader, said Britain was being “dragged into” the Iran war “whether we like it or not” and criticised Sir Keir for not backing US strikes earlier.

If Iran could hit US bases at Diego Garcia, they could also hit Paris and London

On Friday, the Government agreed to allow the US to use British bases to launch strikes on Iranian sites targeting the Strait of Hormuz.

It had previously only allowed US forces to use the bases for defensive operations to prevent Iran firing missiles that put British interests or lives at risk.

Downing Street has said that ministers approved an expansion of the targets to help protect ships in the strait, a conduit for 20 per cent of the world’s oil, based on “collective self-defence.”

The attempted missile attack on Diego Garcia will raise questions about the UK’s preparedness to fend off Iranian strikes on British bases around the world as the war drags on.

Genesis (19-20)

•March 25, 2026 • Leave a Comment

“We must through much tribulation enter into the Kingdom of God,” Acts 14:22

Genesis 19

1 And there came two angels to Sodom at evening, and Lot sat in the gate of Sodom. And Lot, seeing them, rose up to meet them, and he bowed himself with his face toward the ground;

— here came two angels; that is, two of the three that had just before been with Abraham, who were now sent to execute God’s purpose concerning Sodom;

— the Targum Onkelos says

The two angels came to Sedom in the evening, while Lot was sitting at the gate of Sedom. Lot saw them, and he got up to greet them, and he bowed with his face to the ground.

and he said, “Behold now, my lords, turn in, I pray you, into your servant’s house and tarry all night, and wash your feet, and ye shall rise up early and go on your ways.” And they said, “Nay, but we will remain in the street all night.”

— they said, Nay, but we will abide in the street all night; so they not only give Lot an opportunity of evincing the sincerity and cordiality of his invitation, it was their real intention to abide in the street, to manifest the great difference between Lot and the barbarous Sodomites;

— the Targum Onkelos says

He said, Behold [Please] now my lords, please [now] turn in to your servant’s house. Stay over night, bathe your feet, and get up early and continue on your way. They said, No, we will spend the night in the street.

And he pressed upon them greatly, and they turned in unto him and entered into his house; and he made them a feast and baked unleavened bread, and they ate. — Lot’s invitation; at first declined, is at length accepted; and they entered his house;

— the Targum Onkelos says

He urged them greatly, and they turned in to him and came to his house. He made a feast for them, and baked matzos [for them], and they ate.

But before they lay down, the men of the city, even the men of Sodom — both young and old, all the people from every quarter —compassed the house around. — here were the old and young, all vile and from every quarter; for practices too shameful to be mentioned!

— the Targum Onkelos says

They had not yet lain down when the men of the city, the men of Sedom, surrounded the house—young and old alike—all the people from one end [of the city] to the other end.

And they called unto Lot and said unto him, “Where are the men who came in to thee this night? Bring them out unto us, that we may know them.”

— bring them out that we may know them; not who they were, or from whence they came; nor did they pretend anything of this kind to hide and cover their design from Lot, but they were open and impudent, and declared their sin without shame and blushing;

— the Targum Onkelos says

They called to Lot and said to him, Where are the men who came to you tonight? Bring them out to us that we may know them.

— the Targum of Jonathan says

And they cried to Lot, and said to him, Where are the men who entered with thee tonight? Bring them out to us, and we will lie with them.

And Lot went out at the door unto them, and shut the door after him — and Lot went out at the door unto them, and shut the door after him;

— the Targum Onkelos says

Lot went out to them in front of the entrance, shutting the door behind him.

and said, “I pray you, brethren, do not so wickedly. — Lot pleaded, do not so wickedly; as to use ill a man’s guests, to abuse strangers, to break the laws and rules of hospitality, and especially to commit that unnatural sin they were bent upon;

— the Targum Onkelos says

He said, My brothers, please [now] do not act wickedly.

Behold now, I have two daughters who have not known a man. Let me, I pray you, bring them out unto you, and do ye to them as is good in your eyes. Only unto these men do nothing, for therefore came they under the shadow of my roof.”

— I have two daughters; this was unadvisedly and unjustifiably offered, probably through the great discomposure and perturbation which his mind was in;

— the Targum Onkelos says

Behold! I have two daughters who have never known a man, I will bring them out to you, and do with them as you please; only do nothing to these men, since after all, they came under the shelter of my roof.

And they said, “Stand back.” And they said again, “This one fellow came in to sojourn, and he will become a judge! Now will we deal worse with thee than with them.” And they pressed sore upon the man, even Lot, and came near to break the door.

— and they said, stand back; turn on one side, get away from the door, that we may come to it;

— this one fellow came in to sojourn, and he will needs be a judge; this one man, and he a stranger and sojourner, not a citizen of this city, sets himself against the whole body of the inhabitants, and takes upon himself to be judge what is right and wrong;

— the Targum Onkelos says

They said, Step back out of the way! They said, This one came as an immigrant, and now he wants to be a judge. We will now deal worse with you than with them. They pushed hard against Lot, and came near to break the door.

10 But the men put forth their hands, and pulled Lot into the house to them, and shut the door. — but the men, who were the two angels who had met Abraham, put forth their hand; they came to the door, and opened it, and put out their hands, one on one side the door, and the other on the other;

— the Targum Onkelos says

The men put out their hands, and pulled Lot to them, into the house, and closed the door.

11 And they smote the men who were at the door of the house with blindness, both small and great, so that they wearied themselves to find the door. — again the men, who were the two angels, smote the others with blindness;

— the Targum Onkelos says

The men who were at the entrance of the house, they struck with blindness—young and old alike—so that they wearied themselves trying to find the entrance.

12 And the men said unto Lot, “Hast thou here any besides? Soninlaw, and thy sons, and thy daughters, and whomsoever thou hast in the city — bring them out of this place. — the men said; these were the angels who had met Abraham earlier;

— the Targum Onkelos says

The men said to Lot, Who else do you have here—a son-in-law, your sons, your daughters? Whoever you have in the city, bring them out of his place.

13 For we will destroy this place, because the cry of them has waxed great before the face of the Lord, and the Lord hath sent us to destroy it.” — again, the “we” are the two angels; who said “we will destroy this place”

— might be clearer from the Message Bible:

10-11 But the two men reached out and pulled Lot inside the house, locking the door. Then they struck blind the men who were trying to break down the door, both leaders and followers, leaving them groping in the dark.

12-13 The two men said to Lot, “Do you have any other family here? Sons, daughters—anybody in the city? Get them out of here, and now! We’re going to destroy this place. The outcries of victims here to God are deafening; we’ve been sent to blast this place into oblivion.” Genesis 19:10-12 MSG

— the Targum Onkelos says

We are going to destroy this place, for the wailing concerning them has become great in the presence of Adonoy; and Adonoy has sent us to destroy it.

14 And Lot went out and spoke unto his sons-in-law, who married his daughters, and said, “Up, get ye out of this place; for the Lord will destroy this city!” But he seemed as one who mocked unto his sons-in-law.

— Lot spoke to his sons-in-law; it is a possibilty that these sons-in- law had married other daughters of Lot; and according to Jewish sources, Lot had two other daughters that perished in Sodom;

— but according to Josephus (Antiquities. l. 1. c. 11. sect. 4) were espoused to men in the city, but not yet married; and on account of such espousals, as were usual in the eastern countries, Lot calls them his sons-in-law;

— the Targum Onkelos says

Lot went out and spoke to his sons-in-law who had married his daughters. He said [to them], Get up! Get out of this place, for Adonoy is going to destroy the city! He appeared as a comedian in the eyes of his sons-in-law.

— the Targum of Jonathan says

“And Lot went out and spoke with his sons-in-law, who had married his daughters, and said, ‘Arise, go out from this place, for the Lord is destroying the city!’ But the word was like a wonder (absurdity), like a man who is mocking, in the eyes of his sons-in-law.”

15 And when the morning arose, then the angels hastened Lot, saying, “Arise, take thy wife and thy two daughters who are here, lest thou be consumed in the iniquity of the city.” — when the morning arose; Lot had thus the night for making his preparations, part of this he spent in his visits to his sons-in-law;

— the Targum Onkelos says

At the break of dawn, the angels urged Lot on, saying, Get up! Take your wife and your two daughters who are here [who are found to be faithful to you], lest you be swept away in the iniquity of the city.

16 And while he lingered, the men laid hold upon his hand, and upon the hand of his wife and upon the hand of his two daughters, the Lord being merciful unto him; and they brought him forth and set him outside the city.

— while he lingered; he did not make so much haste as the case required, and this would have been fatal to him, if the angels had not laid hold on his hand, and brought him forth. Herein the Lord was merciful to him; and if God had not been merciful to them, their lingering had been their ruin;

— the Targum Onkelos says

He hesitated, and the men grabbed his hand and the hand of his wife and two daughters, for Adonoy had pity on him. They brought him out and placed him outside the city.

17 And it came to pass, when they had brought them forth outside, that he said, “Escape for thy life! Look not behind thee, neither stay thou in all the plain. Escape to the mountain, lest thou be consumed!” — look not behind thee; they must not loiter by the way; stay not in all the plain;

— for it would all be made into one dead sea; he must not take up short of the place of refuge appointed him; escape to the mountain; such are the commands given to those who are delivered out of a sinful state: first, return not to sin and second, rest not in the world, for that is staying in the plain;

— the Targum Onkelos says

When they were brought out [of the city], he [the angel] said, Escape [Have pity] for your life! Do not look back! Do not remain anywhere in the valley [plain]. Escape to the mountain, lest you be swept away.

18 And Lot said unto them, “Oh, not so, my lord. — oh, not so, my Lord; that is, let me not be obliged to go so far as to the mountain;

— the Targum Onkelos says

Lot said to them, Please, not so my Master. [Please, now, my Master.]

19 Behold now, thy servant hath found grace in thy sight, and thou hast magnified thy mercy, which thou hast shown unto me in saving my life; and I cannot escape to the mountain, lest some evil take me, and I die.

— lest some evil take me, and I die; or “that evil” the burning of Sodom, and the cities of the plain, lest that should overtake him before he got to the mountain;

— thus Lot had some distrust of the power of God to strengthen him to go thither, who had appeared so wonderfully for him in his present deliverance; and he might have assured himself, that he that brought him out of Sodom would never suffer him to perish in the destruction of it;

— the Targum Onkelos says

Behold your servant has found favor in Your eyes [before You]. Great is your kindness [goodness] that you have done with me, to keep me alive. I cannot escape to the mountain, lest the evil attach itself to me and I die.

20 Behold now, this city is near enough to flee unto, and it is a little one. Oh, let me escape thither, (is it not a little one?) and my soul shall live.” — the MSG version says:

But Lot protested, “No, masters, you can’t mean it! I know that you’ve taken a liking to me and have done me an immense favor in saving my life, but I can’t run for the mountains—who knows what terrible thing might happen to me in the mountains and leave me for dead.

Look over there—that town is close enough to get to. It’s a small town, hardly anything to it. Let me escape there and save my life—it’s a mere wide place in the road.” Genesis 19:19-21 MSG

— the Targum Onkelos says

Behold, please, this city is near [enough] to flee there. It is insignificant. Let me escape there! It is insignificant, and my life will be saved.

21 And he said unto him, “See, I have accepted thee concerning this thing also, that I will not overthrow this city for which thou hast spoken. — the MSG version says:

“All right, Lot. If you insist. I’ll let you have your way. And I won’t stamp out the town you’ve spotted. But hurry up. Run for it! I can’t do anything until you get there.” That’s why the town was called Zoar, that is, Smalltown. Genesis 19:19-21 MSG

— the Targum Onkelos says

He said to him, See I have also given you consideration regarding this. I will not overturn the city that you mentioned [for which you have beseeched].

22 Hasten thee, escape thither; for I cannot do any thing till thou hast come thither.” Therefore the name of the city was called Zoar. — called Zoar in later times, probably first by Lot, from his use of the word “little” which was his request, which Zoar signifies; called Bela, see Genesis 14:2

— the Targum Onkelos says

Hurry, escape there, for I can do nothing until you get there. The city was therefore called Zoar.

23 The sun had risen upon the earth when Lot entered into Zoar. — in haste; the ruin of Sodom was suspended till he was secure;

— the Targum Onkelos says

The sun had risen upon the earth, when Lot came to Zoar.

24 Then the Lord rained upon Sodom and upon Gomorrah brimstone and fire, from the Lord out of heaven; — the Lord rained upon Sodom and upon Gomorrah brimstone and fire; the Lord (Yehovah יְהוָ֖ה);

— from the Lord (Yehovah יְהוָ֖ה) out of heaven; this destruction was brought upon them by Yehovah the Son of God, who had appeared to Abraham in an human form, and gave him notice of it, and heard all he had to plead for those cities, and then departed from him to Sodom,

— and the Son, who was the author of this catastrophe; this amazing shower of fire and brimstone was re-inforced and rained by him from Yehovah his Father, out of heaven; as the Targums of Jonathan and Jerusalem both call him, the Word of the Lord;

— the Targum Onkelos says

Adonoy caused to rain upon Sedom and Amorah—sulfur and fire—from [before] Adonoy, from heaven.

25 and He overthrew those cities, and all the plain and all the inhabitants of the cities, and that which grew upon the ground. — and he overthrew those cities; of Sodom, Gomorrah, Admah, and Zeboiim: very probably at the same time that this fiery tempest was from the heavens; and all the plain; the plain of Jordan, and the cities on it, all but Zoar;

— the Targum Onkelos says

He overturned these cities, and the entire plain, and all those who lived in the cities and all that grew upon the ground.

26 But his wife looked back from behind him, and she became a pillar of salt. — but his wife looked back from behind him; herein she disobeyed an express command; according to the Targums of Jonathan and Jerusalem, she was a native of Sodom; hence menories of her kinmen and sons-in-law; and she became a pillar of salt;

— the Targum Onkelos says

His [Lot’s] wife looked behind him; and she became a pillar of salt.

— the Targum of Jonathan says

“And his wife looked from behind the angel to know what would be the end of her father’s house, for she was of the daughters of the Sodomites; and because she had sinned with salt by revealing [the presence of] the poor, behold, she was made a pillar of salt.”

— the Targum Jerusalem says

“Because Lot’s wife was from the children of the children of the people of Sodom, she looked back from behind her to see what would be the end of her father’s house; and behold, she stands as a pillar of salt until the time when the Resurrection comes, when the dead shall live.”

27 And Abraham got up early in the morning to the place where he stood before the Lord; — stood before the Lord, and he looked toward Sodom; he has an extensive view spread out before him which would be the Dead Sea;

— the Targum Onkelos says

Avraham got up early in morning [to return] to the place where he had stood before the Presence of Adonoy [to the place where he had served in prayer before Adonoy].

28 and he looked toward Sodom and Gomorrah, and toward all the land of the plain, and beheld. And lo, the smoke of the country went up as the smoke of a furnace.

— the violence of the fire is indicated by the last word, which is not the ordinary word for a furnace, but means a kiln, such as that used for burning chalk into lime, or for melting ores of metal;

— the smoke of a furnace; after the fiery shower was over, and the cities burnt down, the smoke ascended toward heaven, as the smoke of mystical Babylon will do, Revelation 19:3; like the reek of a boiling cauldron; or like the smoke of a lime kiln always burning;

— the Targum Onkelos says

He [Avraham] stared at Sedom and Amorah, and the whole land of the plain, and he saw the heavy smoke rising from the earth like the smoke of a furnace.

29 And it came to pass, when God destroyed the cities of the plain, that God remembered Abraham, and sent Lot out of the midst of the overthrow when He overthrew the cities in which Lot dwelt. — the prayer or promise made by Abraham, Genesis 18:23-32, who doubtless in his promise for Sodom would not forget Lot;

— the Targum Onkelos says

When Elohim destroyed the cities of the plain; Elohim remembered Avraham, and He sent Lot out of the upheaval when He overturned the cities in which Lot had lived.

30 And Lot went up out of Zoar and dwelt on the mountain, and his two daughters with him, for he feared to dwell in Zoar; and he dwelt in a cave, he and his two daughters. — for he feared to dwell in Zoar; probably he found it as wicked as Sodom; and therefore concluded it could not survive long;

— and dwelt in the mountain; which the Lord had directed him to go to before, but was unwilling, and chose Zoar, and his two daughters with him; and they dwelt in a cave;

— the Targum Onkelos says

Lot went up from Zoar and lived in the mountain; and his two daughters went with him, for he was afraid to live in Zoar. He lived in a cave, he and his two daughters.

31 And the firstborn said unto the younger, “Our father is old, and there is not a man on the earth to come in unto us after the manner of all the earth. — the whole earth; for they thought the same deluge of fire which destroyed the four cities, and all other places;

— the Targum Onkelos says

The older girl said to the younger, Our father is old, and there is no man [left] on earth who will come into us in the normal manner.

32 Come, let us make our father drink wine, and we will lie with him, that we may preserve seed of our father.” — and we will lie with him, that we may preserve the seed of our father; have children by him, and propagate and preserve the human species; this incestuous copulations, they might think lawful;

— the Targum Onkelos says

Come let us urge our father to drink wine, and sleep with him; that we may give life to seed [children] from our father.

33 And they made their father drink wine that night, and the firstborn went in and lay with her father; and he perceived not when she lay down, nor when she arose. — he perceived not; wherein there is nothing strange, it being usual with drunken men to do many things in that condition, which, when they come to themselves, they perfectly forget;

— the Targum Onkelos says

They urged wine upon their father that night; and the older girl went in and slept with her father. He was not aware that she lay down or got up.

~~~~

34 And it came to pass on the morrow that the firstborn said unto the younger, “Behold, I lay yesternight with my father. Let us make him drink wine this night also, and go thou in and lie with him, that we may preserve seed of our father.”

— the firstborn said to the younger, behold, I lay last night with my father; informed her, that what they had contrived succeeded according to her wish, and therefore, with her encouragement to go on, proposes to take the same method again;

— the Targum Onkelos says

The next day, the older girl said to the younger, Last night I slept with my father. Let us urge wine upon him tonight also, and you go in and sleep with him that we may give life to seed from our father.

35 And they made their father drink wine that night also. And the younger arose and lay with him; and he perceived not when she lay down, nor when she arose. — and the younger arose, and lay with him following the bad example of her sister; and he perceived not when she lay down, nor when she arose;

— the Targum Onkelos says

That night also, they urged their father [to drink] wine. The younger went up and slept with him, and he was not aware that she lay down or got up.

36 Thus were both the daughters of Lot with child by their father. — Lot’s daughters had so little feeling of shame in connection with their conduct, that they gave names to the sons they bore, which have immortalized their paternity;

— the Targum Onkelos says

Lot’s two daughters became pregnant from their father.

37 And the firstborn bore a son and called his name Moab; the same is the father of the Moabites unto this day. — his name Moab; the Moabites, who originally inhabited the country northeast of the Dead Sea, and afterward, they occupied the district east of the Salt Sea;

— the Targum Onkelos says

The older girl gave birth to a son and she named him Moav. He is the ancestor of the Moabite nation even to this day.

38 And the younger, she also bore a son and called his name Benammi; the same is the father of the children of Ammon unto this day. — the Ammonites dwelt to the northeast of Moab, where they had a capital called Rabbah; they both ultimately merged into the more general class of the Arabs;

— and according to Deuteronomy 2:9, Deuteronomy 2:19, later on, Israel was ordered not to touch the territory of either of these tribes because of their descent from Lot, Abraham’s nephew;

— the Targum Onkelos says

The younger girl also gave birth to a son, and she named him Ben-Ami. He is the ancestor of the people of Ammon even to this day.

Genesis 20

~~~~

1 And Abraham journeyed from thence toward the south country, and dwelt between Kadesh and Shur and sojourned in Gerar. — and Abraham sojourned in Gerar; in the southern border of Canaan which were occupied by the Philistines. We are not told upon what occasion he removed;

— the Targum Onkelos says

Avraham journeyed from there to the land of the Negev [south], and he lived between Kadeish [Rekem] and Shur [Chagar]. He lived for a while in Gerar.

And Abraham said of Sarah his wife, “She is my sister.” And Abimelech king of Gerar sent and took Sarah. — she is my sister;

— twenty years before, Abraham had acted in the same way in Egypt, and Pharaoh had rebuked him; she was now ninety years of age, yet her naturally beauty had not faded;

— the Targum Onkelos says

Avraham said regarding Sarah, his wife, She is my sister. Avimelech, king of Gerar sent [messengers] and took Sarah.

But God came to Abimelech in a dream by night, and said to him, “Behold, thou art but a dead man, because of the woman whom thou hast taken; for she is a man’s wife.”

— God came to Abimelech in a dream by night; put fear into his mind, by which he cautioned him against taking Sarah to be his wife; so careful was the Lord that no wrong should be done to such a godly and virtuous person, to which she was exposed through the weakness of her husband;

— and said unto him, behold, thou art but a dead man, for the woman which thou hast taken; that is, God would punish him with death, unless he restored the woman, whom he had taken, to her husband; 

— the Targum Onkelos says

Elohim came to Avimelech [Word came from before Elohim to Avimelech] in a dream at night, and said to him, Behold, you shall die because of the woman you took, for she is a married woman [a man’s wife].

But Abimelech had not come near her; and he said, “Lord, wilt Thou slay also a righteous nation? — “Thou wilt die,” the point of death if he persisted; wilt thou also slay a righteous nation?

— he probably referred to the late destruction of Sodom and the cities of the plain, which, no doubt, must have caused great consternation; and or he knew that this had been usual for people to suffer for the crimes of their governors, or kings, if they sin;

— the Targum Onkelos says

Avimelech had not come near to her. He said, My Master, will You also kill an innocent nation?

Said he not unto me, ‘She is my sister’? And she, even she herself said, ‘He is my brother.’ In the integrity of my heart and innocency of my hands have I done this.” — in the integrity of my heart; not only does Abimelech assert this, but God himself (Genesis 20:6) admits the plea;

— the Targum Onkelos says

Did he not say to me, She is my sister? And she also said, He is my brother. With an innocent [upright] heart and clean [righteous] hands I did this.

And God said unto him in a dream, “Yea, I know that thou didst this in the integrity of thy heart, for I also withheld thee from sinning against Me. Therefore I suffered thee not to touch her. — without any adulterous design in my heart, or outward actions tending to it, being wholly ignorant of what thou now informest him;

— the Targum Onkelos says

Elohim said to him [Word from Elohim was said to him] in a dream, I also know [it is also revealed before me] that you did this with an innocent [upright] heart. I also prevented you from sinning against [before] Me. That is why I did not give you the chance to touch her.

Now therefore restore the man his wife; for he is a prophet, and he shall pray for thee, and thou shalt live. And if thou restore her not, know thou that thou shalt surely die, thou and all that are thine.” — for he is a prophet; of course Abraham is a true prophet of God;

— to whom he communicates his secrets; is able to foretell things to come, as well as to interpret the mind of God, that he might pray for him and save his life, and threatened him with certain death to himself and all belonging to him in case he should refuse;

— a prophet is God’s spokesman, who speaks with authority the things of God Exodus 7:1; Exodus 4:15. This implies two things: first, the things of God are known only to him, and therefore must be communicated by him; secondly, the prophet must be enabled of God to announce in correct terms the things made known to him;

— these things refer not only to the future, but in general to all such matters as fall within the purpose and procedure of God, like Moses and Aaron in Exodus 7:1. They may even include things otherwise known or knowable by man, so far as these are necessary to the exposition of the divine will. Now Abraham has heretofore received numerous communications from God; this, also constitutes him a prophet;

— the Targum Onkelos says

Now return the man’s wife, for he is a prophet. He will pray for you and you will live. If you do not return her, you should know that you will surely die—you and all that is yours.

Therefore Abimelech rose early in the morning, and called all his servants, and told all these things in their hearing; and the men were sore afraid.

— and the men were sore afraid; lest they should be struck with death; and perhaps they might call to mind the burning of Sodom and Gomorrah for their sins, they had lately heard of, and might fear that some such calamity would befall them;

— the Targum Onkelos says

Avimelech got up early in the morning, and called all his servants. He spoke all these words in their ears [before them], and the men were very frightened.

Then Abimelech called Abraham and said unto him, “What hast thou done unto us? And how have I offended thee, that thou hast brought on me and on my kingdom a great sin? Thou hast done deeds unto me that ought not to be done.”

— thou hast done deeds unto me that ought not to be done; in saying Sarah was his sister, and persuading her to say the same;

— the Targum Onkelos says

Avimelech called Avraham and said to him, What have you done to us? What wrong did I do to you that you brought on me and upon my kingdom such a great sin? Deeds that ought not to be done, you have done to me.

10 And Abimelech said unto Abraham, “What sawest thou, that thou hast done this thing?” — that thou hast done this thing? he desires to know what he had observed, either in him or his people, that gave him any reason to conclude that they were a lustful people, lest they should kill him for his wife’s sake;

— the Targum Onkelos says

Avimelech [then] said to Avraham, What did you see that you did such a thing?

11 And Abraham said, “Because I thought surely the fear of God is not in this place, and they will slay me for my wife’s sake. — surely the fear of God is not in this place; this is a certain truth, which he thought might be depended upon, and taken for granted, since it was everywhere;

— the Targum Onkelos says

Avraham said, Because I said [thought] there is no fear of Elohim in this place, and they will kill me [in order] to take my wife.

12 And yet indeed she is my sister: she is the daughter of my father, but not the daughter of my mother, and she became my wife. — and yet indeed she is my sister; in the same sense as Lot was his brother; for she was sister to Lot, and both were the children of Haran, the brother of Abraham;

— the Targum Onkelos says

In any case, she is my sister, the daughter of my father, but not the daughter of my mother, and she became my wife.

13 And it came to pass, when God caused me to wander from my father’s house, that I said unto her, ‘This is thy kindness which thou shalt show unto me: at every place whither we shall come, say of me, “He is my brother.”’”

— at every place whither we shall come, say of me; or for the sake of me, in order to save me from the hands of wicked men, whom he feared would slay him for her sake: he is my brother; and so he hoped, instead of being ill used or killed, he should meet with favour and friendship on her account;

— the Targum Onkelos says

When Elohim caused me to wander from my father’s house [When the nations strayed after the works of their hands, Elohim brought me close to His worship from my father’s house], I said to her, this is the kindness [goodness] you shall do for me. At every place we come [go] to, say of me, He is my brother.

14 And Abimelech took sheep and oxen, and menservants and womenservants, and gave them unto Abraham, and restored to him Sarah his wife. — the Philistine gives atoning presents on restoring Sarah, and grants her husband permission to dwell in his land wherever it pleased him; this also implies that he had done Abraham a wrong;

— the Targum Onkelos says

Avimelech took sheep, cattle, male and female slaves, and he gave them to Avraham. He [also] returned his wife Sarah to him.

15 And Abimelech said, “Behold, my land is before thee. Dwell where it pleaseth thee.” — and Abimelech said, behold, my whole land is before thee; instead of bidding him be gone, and sending him away in haste out of his country, as the king of Egypt did;

— the Targum Onkelos says

Avimelech said, Behold, my land is before you. Live wherever you see fit.

16 And unto Sarah he said, “Behold, I have given thy brother a thousand pieces of silver; behold, he is to thee a covering of the eyes unto all who are with thee and with all other.” Thus she was reproved.

— behold, he is to thee a covering of the eyes, unto all that are with thee; a protection of her chastity: so an husband, in our language, is said to be a cover to his wife, or that she is under a cover;

— the Targum Onkelos says

To Sarah, he said, Behold I have given to your brother a thousand pieces [shekalim] of silver. It will be for you a [compensational] eye covering for all who are with you, that you may face every one. [It will be for you a garment of honor, in return for my having sent for you, and taken you, and seeing you and all that is with you. And regarding everything that you said, you were just.]

17 So Abraham prayed unto God. And God healed Abimelech, and his wife and his maidservants; and they bore children, — and God healed Abimelech, and his wife, and his maidservants: who by reason of some disease were rendered unfit for and incapable of cohabitation with their husbands, and they with them;

— and they bare children; cohabited and conceived, bare and brought forth children, all which are comprehended in this expression;

— the Targum Onkelos says

Avraham prayed to [before] Elohim, and Elohim healed Avimelech, his wife, and his female slaves, and they gave birth [and they were relieved].

18 for the Lord had closed up fast all the wombs of the house of Abimelech because of Sarah, Abraham’s wife. — for the Lord had fast closed up all the wombs of the house of Abimelech; with large tumours probably, so that they could not cohabit with their husbands and conceive;

— the Targum Onkelos says

For Adonoy had restrained every womb in the house of Avimelech according to the word of Sarah, Avraham’s wife.

Did Dr Ralph Baric at UNC Create SARS-CoV-2?

•March 24, 2026 • Leave a Comment
Baric is widely regarded as the world’s leading betacoronavirus researcher

UNZ by Jeffrey Sachs and Jim Haslam • March 16, 2026 ~ What Might the US Owe the World for Covid-19?

The new revelation that America’s top coronavirus scientist, Dr Ralph Baric of the University of North Carolina (UNC), worked with the intelligence agencies in the lead-up to the COVID-19 pandemic significantly raises the likelihood that Baric is the creator of SARS-CoV-2, the virus that caused the COVID-19 pandemic.

Yet the evidence for and against this hypothesis remains incomplete because the US government is engaged in an ongoing cover-up of key information. Regardless of the government’s willingness to be forthcoming, Baric himself could shed copious light on a matter of major public and scientific importance by making available his lab materials from the period leading up to the pandemic.

There is firm evidence of the following key points:

  1. Baric’s lab had the technical ability (reverse genetics systems, chimeric spike protein, infectious clone production) to build viruses similar to SARS-CoV-2.
  2. The 2018 DEFUSE proposal to the Defense Advanced Research Projects Agency (DARPA), led by Baric, explicitly outlined laboratory manipulations capable of producing a SARS-CoV-2–like virus.
  3. Although DARPA declined to fund DEFUSE, most team members subsequently received similar funding through other National Institutes of Health (NIH) grants.
  4. US intelligence agencies (including CIA and ODNI) consulted Baric and other experts from 2015 onwards and even ran pandemic war games (eg, Event 201Crimson Contagion) just before the pandemic. The CIA now assesses, albeit with low confidence, that a lab-related incident in China is more likely than a purely natural origin.
  5. This new finding is consistent with the “lab leak” hypothesis that Baric created the virus and “provided” it to the Wuhan Institute of Virology (WIV) for experiments on “wild-caught” Chinese bats.
  6. Early in the pandemic, Baric omitted the furin cleavage site in his intelligence briefing. He later testified that he had seen it, and the idea of inserting such a site “was clearly mine.”
  7. SARS-CoV-2 remains the only known SARS-like (sarbecovirus) with such a furin cleavage site (FCS), which significantly enhances infectivity and transmissibility.

One of us (Haslam) has set forth the most detailed and likely hypothesis regarding the origin of the pandemic, in the book COVID-19: Mystery Solved: It leaked from a Wuhan lab but it’s not Chinese junk (2024). No information has come to light that challenges or refutes the following sequence of events, as hypothesized in the book:

  • Baric’s lab in North Carolina creates a chimeric SARS-like virus (SARS-CoV-2 or its immediate progenitor called HKU3-Smix) using DEFUSE-style methods.
  • The proposed novel virus (HKU3-Smix) differed from SARS-CoV-1 by 25%; SARS-CoV-2’s spike differed by 24.7%. Baric later testified, “We were within the range.”
  • Baric used Egyptian fruit bats as a surrogate at Rocky Mountain Laboratories in Montana (a high-containment NIH facility that conducts DARPA research). His biotechnology was designed to be portable in a small tube and usable under BSL-2 conditions.
  • The constructed virus was then sent to WIV for further experiments, likely at a Chinese bat colony (Rhinolophus sinicus) near the BSL-4 facility.
  • The virus infected a lab worker, probably asymptomatically, and spread (initially undetected) in Wuhan from the WIV, triggering the pandemic.
  • Egyptian fruit bats (Rousettus aegyptiacus) have emerged as a non-natural reservoir host for SARS-CoV-2, and were referenced in DARPA DEFUSE.

Over the past year, we have debated this lab leak hypothesis with the WHO Scientific Advisory Group for the Origins of Novel Pathogens (SAGO). That debate became public with their recent Nature paper. We reminded SAGO that they have not identified a progenitor virus with 99% genome similarity, nor have they pinpointed an animal reservoir or intermediate host. We have proposed both Baric’s HKU3-Smix and Egyptian fruit bats.

We may also point to the whistleblower allegations about CIA internal behavior that support the idea that the CIA has known far more than it has let on all along. A 2023 article in Science reported an anonymous whistleblower’s claim that CIA managers offered monetary incentives to CIA analysts to downplay the lab-leak hypothesis. The CIA has denied this, and the matter is under congressional scrutiny.

Jeffrey Sachs and others are asking: Did Dr Baric at UNC Create SARS-CoV-2?

Ralph Baric’s role is crucial in this hypothesis. Baric is widely regarded as the world’s leading betacoronavirus researcher. Well before COVID-19, he:

  • Developed reverse genetics systems for SARS-like coronaviruses.
  • Collaborated with Shi Zhengli’s team at the WIV, while testifying that Shi could not and did not replicate his engineering methods.
  • Worked on gain-of-function style experiments to understand spillover risk.

The new disclosures show that in 2015, Baric participated in a Biological Security Executive Group (BSEG) meeting convened by the Office of the Director of National Intelligence (ODNI), which included CIA participation, to brief on biological threats. Emails released in response to congressional inquiries also suggest that ODNI and the CIA later contacted Baric for expert advice on coronavirus issues; in January 2020, he briefed an ODNI “B Group” on possible lab-leak scenarios. Again, Baric did not mention the unusual furin cleavage site, which he admitted to seeing just three weeks earlier.

The organization EcoHealth Alliance (EHA), helmed at the time by Peter Daszak, is also central to the hypothesis because EHA:

  • Received major NIH grants, including with Baric, to study bat coronaviruses, including active collaboration with WIV.
  • Submitted the DEFUSE proposal with Baric and WIV, under which Daszak outsourced safe humanized mice work and PCR testing.
  • Also received funding from Department of Defense agencies (DTRA) and USAID for global surveillance of emerging pathogens.

DEFUSE was submitted in 2018 to DARPA by EcoHealth Alliance with partners at WIV and UNC (Baric). In 2021, the DEFUSE proposal was leaked by whistleblower Major Joseph Murphy, who disclosed classified US government information with significant public-health implications. Key elements of DEFUSE included:

  • Sampling SARS-like bat coronaviruses,
  • Using Baric’s reverse genetics system to insert novel features into spike proteins, including furin cleavage sites,
  • Testing these modified viruses in humanized mice and bat colonies to assess spillover risk.

DEFUSE shows that US-funded scientists led by Baric envisioned and detailed exactly the kind of manipulations (inserting a furin cleavage site into a SARS-like coronavirus) that may have created SARS-CoV-2. Moreover, as Haslam has painstakingly shown, most of the scientific team in the DEFUSE proposal was later funded by the NIH after DARPA rejected the proposal.

Recently released emails, discovered by DRASTIC, reveal new details on the funding of DARPA DEFUSE. In 2018-19, Daszak and Baric recycled text from their rejected bid in two NIH grants.

These overlaps are shown in the table below.

Table submitted to the WHO SAGO committee

On March 5, 2020, US government biodefense officials asked Baric in the Red Dawn emails whether SARS-CoV-2 contained “any restriction sites.” Baric responded, “No, there is absolutely no evidence of genetic engineering.” SARS-CoV-2 contains five restriction sites, yielding six pieces. Baric later testified, “We think our [UNC] approach is safer [than the WIV] because we’ve divided the genome into six pieces.”

The Ongoing Government Coverup

The US Government knows far more than it has revealed about the origins of SARS-CoV-2. While the cover-up does not prove Haslam’s hypothesis—submitted to hundreds of scientists and the World Health Organization—it makes the hypothesis far more plausible than the official narratives have implied. In short, the US government has consistently hidden from the public view the nature of US-backed research and Baric’s role in it.

Crucially, the US Government did not disclose DEFUSE at the start of the pandemic. The existence and contents of the proposal became public only after Major Murphy found it in a top-secret Department of Defense (DoD) folder.

Baric spoke publicly to the media before DEFUSE leaked, but has not done so since it became public. Neither NIH, DoD, nor any intelligence agency came forward early to say: “By the way, the key EcoHealth/WIV/UNC team wrote a detailed proposal in 2018 to modify SARS-like coronaviruses in ways that bear on the current virus.” That silence deliberately deprived the scientific community and the public of vital context and amplified the impression that a purely natural origin was the only serious explanation on the table.

The second key element of the cover-up concerns how NIH and the National Institute of Allergy and Infectious Diseases (NIAID) handled the early recognition that SARS-CoV-2 might be engineered. On January 31, 2020, Scripps professor Kristian Andersen emailed Anthony Fauci, stating that he and colleagues “all find the genome inconsistent with expectations from evolutionary theory.”

In other words, the initial assessment by some of the most influential virologists consulted by Fauci was that an artificial origin had to be seriously considered. Andersen concluded that the new SARS-CoV-2 genome “looks engineered” after comparing it with a bat sample called RaTG13, which Shi Zhengli of the WIV had published only days earlier. The comparison of RaTG13 and SARS-CoV-2 (with PRRAR) is as follows:

YECDIPIGAGICASYQTQTNS____RSVASQSIIAYTMSLGAENSVAYSNN (RaTG13)

YECDIPIGAGICASYQTQTNSPRRARSVASQSIIAYTMSLGAENSVAYSNN (SARS2)

Under the 2018 DEFUSE proposal and related 2019 NIAID grants, Baric testified that Shi was to share samples like RaTG13 with him prior to publication. Although Shi could not isolate a live RaTG13 virus, Baric had written that inserting a furin cleavage site could help “recover non-cultivable viruses.”

Importantly, Baric’s cell cultures preserve the furin cleavage site, while Shi’s Vero cells delete it. In this framework, Baric would “introduce” a furin cleavage site (eg, PRRAR) and then “provide” Shi with the resulting chimera for testing on Chinese bats at the WIV.

The next day, February 1, 2020, Fauci and Francis Collins participated in a hastily convened teleconference organized by Jeremy Farrar of the Wellcome Trust, bringing together Andersen, Eddie Holmes, Robert Garry, and other prominent virologists.

Subsequent congressional hearings and released emails and messages show that, on that call and in the ensuing days, several participants considered a laboratory origin—including genetic manipulation—to be plausible or even likely (with estimates such as 60–70% lab-related, 30–40% natural) before rapidly shifting toward the conclusion that a natural origin was far more likely.

The call itself and its full participant list were not publicly disclosed at the time. They became known only gradually, via FOIA requests and congressional investigations.

What is clear is that: (i) NIH and NIAID did not inform the public that their hand-picked experts initially saw signs consistent with engineering, and (ii) the documents related to this call—emails, notes, and audio if it exists—have been released in a piecemeal, highly redacted manner rather than proactively. Andersen testified that they excluded Baric from the February 1, 2020, call due to his conflicts of interest with the WIV.

Two days later, both Andersen and Baric were invited to present evidence of engineering to NASEM officials (eg, FBI, CIA, White House).

In a redacted February 3, 2020, Slack message revealed in Baric’s testimony, Andersen wrote, “I should mention that Ralph Baric pretty much attacked me on the call with NASEM, essentially calling anything related to potential lab escape ludicrous, crackpot theories. I wonder if he, himself, is worried about this, too.” Andersen later admitted he had “no idea” that Baric was on the February 1 call, because Farrar did not invite him, but apparently Fauci did.

Senator Rand Paul’s office has also documented that just days before the Farrar call, Baric briefed a secretive Biological Security Executive Group (“BSEG”) convened under the ODNI umbrella on the “current coronavirus situation” and possible lab-related scenarios.

The existence of that January 2020 briefing, and of follow-on contacts between Baric, Daszak, the FBI, and CIA, has only recently come to light through FOIA and independent digging (ResearchGate). The underlying slides, minutes, and analytic use of Baric’s input remain classified.

What Might the US Owe the World for Covid-19? by Jeffrey Sachs

Genesis (17-18)

•March 23, 2026 • Leave a Comment

The Targum, which originated in the Aramaic language, is strongly linked to the work of Ezra, holds significance for shedding light on biblical concepts. When the Masoretic Text can be vague, uncertain, or unclear, the Targum often offers clearer meaning, broader insight, and deeper understanding.

Yes, sometimes the Targum clarifies metaphors and interprets idioms or difficult passages instead of translating them literally, which often makes no sense. Such an endeavor should be highly commended rather than criticized.

For example, the Targum interprets natural imagery—like cedars, cypresses, oaks, forests, and fire—as metaphors for political political and social structures, especially kings, rulers, governors, and wealthy elites. Such imagery can be sweeping: forests laid waste, lions roaring as their habitat is destroyed, and power structures crumbling. Fire symbolizes divine punishment, sweeping through defenses and dismantling the very foundations of their power.

Translating such natural imagery literally could convey limited information or even distort it, but Ezra was determined to share their true meaning. He was a righteous man, for God had prepared his heart to seek the law of the Lord, to follow it, and to teach the statutes and judgments in Israel Ezra 7:10.

“The LORD shall smite thee with madness, and blindness, and astonishment of heart; and thou shalt grope at noonday, as the blind gropeth in darkness” Deuteronomy 28:28-29

“The anger of the Lord shall not return, until He has executed and until He has performed the intent of His thought; in the latter days ye shall understand it perfectly” Jeremiah 23:20

Genesis 17

1 And when Abram was ninety years old and nine, the Lord appeared to Abram and said unto him, “I am the Almighty God. Walk before Me, and be thou perfect.

— Abram was ninety years old and nine; thirteen years, therefore, had passed by since the birth of Ishmael, who doubtless during this time had grown very dear to the childless old man;

— the Targum Onkelos says

When Avram was ninety-nine years old, Adonoy appeared [became revealed] to Avram and said to him: I am Almighty Shaddai, walk [worship] before Me and be perfect.

And I will make My covenant between Me and thee, and will multiply thee exceedingly.” — and will multiply thee exceedingly; as he had before promised at several times, and now renews it, lest be should think that Ishmael was the promised seed;

— the Targum Onkelos says

I will give My covenant between Me [My Word] and you, and I will multiply you[r descendants] exceedingly.

And Abram fell on his face; and God talked with him, saying, — and Abram fell on his face while God was talking to him;

— the Targum Onkelos says

Avram fell on his face. Elohim spoke with him, saying:

“As for Me, behold, My covenant is with thee, and thou shalt be a father of many nations. — and thou shalt be a father of many nations: as he was of many Arabian nations in the line of Ishmael;

— and of the Midianites, and others, in the line of his sons by Keturah; and of the Israelites in the line of Isaac, as well as of the Edomites in the line of Esau; and in a spiritual sense the father of all that believe, in all the nations of the world, circumcised or uncircumcised;

— the Targum Onkelos says

As for Me, here is My covenant with you; you shall be the father of a multitude of nations.

Neither shall thy name any more be called Abram, but thy name shall be Abraham; for a father of many nations have I made thee.

— a multitude of nations and kings are to trace their descent from Abram; the twelve princes of Ishmael, of many Arab tribes; the twelve tribes of Israel; the dukes of Edom sprang from him; and Keturah’s descendants;

— the Targum Onkelos says

No longer shall your name be called Avram, but your name shall be Avraham, for the father of a multitude of nations I have appointed you.

And I will make thee exceeding fruitful, and I will make nations of thee, and kings shall come out of thee. — and I will make nations of thee; as the nations of Israel and Judah;

— of the Midianites and Edomites, of the Arabs, and and kings shall come out of thee; as the twelve princes of Ishmael, the kings of Edom and Midian, of the Arabs, and of Israel and Judah;

— the Targum Onkelos says

I will make you exceedingly fruitful and I will make you into nations [assemblies]; and kings [who rule over nations] will descend from you.

And I will establish My covenant between Me and thee and thy seed after thee in their generations for an everlasting covenant, to be a God unto thee and to thy seed after thee. — thy name shall be Abraham; it signified some new circumstance in the history, rank, or religion of the individual who bears it;

— the Targum Onkelos says

I will sustain My covenant between Me [My Word] and you, and between your descendants after you throughout their generations as an eternal covenant, to be a God to you, and to your descendants after you.

And I will give unto thee and to thy seed after thee the land wherein thou art a stranger, all the land of Canaan, for an everlasting possession; and I will be their God.” — all the land of Canaan, for an everlasting possession; this respects only the natural seed of Abraham, and those in the line of Isaac and Jacob;

— the Targum Onkelos says

I will give to you, and to your descendants after you, the land of your temporary residence, all the land of Canaan as an eternal possession, and I will be a God to them.

And God said unto Abraham, “Thou shalt keep My covenant, therefore, thou and thy seed after thee in their generations. — thou, and thy seed after thee, in their generations; in successive ages;

— the Targum Onkelos says

Elohim said to Avraham: And as for you, you must preserve My covenant, you and your descendants after you throughout their generations.

10 This is My covenant which ye shall keep between Me and you and thy seed after thee: every manchild among you shall be circumcised. — circumcision to be a sign of entering into a covenant, and especially into one to which children were to be admitted;

— and even until the new age, where the uncircumcised wouldn’t be allowed into his Sanctuary, Ezekiel 44:7, 9; if such requirement applied to strangers what more of the Israelites, especially those serving in the inner court;

— the Targum Onkelos says

This is My covenant which you must preserve between Me [My Word] and you, and your descendants after you: every male among you shall be circumcised.

11 And ye shall circumcise the flesh of your foreskin; and it shall be a token of the covenant between Me and you. — the covenant of circumcision;

— as the rainbow, might have been in existence before it was adopted as the token of a covenant; is here said to be the covenant which Abraham and his seed must keep, as a copy or counterpart; it is a sign and a seal;

— the covenant is about the land; wherein thou art a stranger, all the land of Canaan, that God would give to Abram and his seed for an everlasting possession; and every manchild among Abram and his seed shall be sealed into a covenant by being circumcised;

— the Targum Onkelos specifically says it is a sign

You shall circumcise the flesh of your foreskin. This shall be the sign of the covenant between Me [My Word] and you.

— the Targum of Jonathan says the same

And you shall circumcise the flesh of your foreskin, as a sign of the covenant between My Word and you.

12 And he that is eight days old shall be circumcised among you, every manchild in your generations, he that is born in the house or bought with money from any stranger who is not of thy seed. — any stranger who is not of thy seed, but want to live in the same land with the seed of Abram, shall be circumcised among you;

— the Targum Onkelos says

At the age of eight days every male among you must be circumcised, throughout your generations; he that is a house-born [slave] or one that was bought with money from any stranger who is not your descendant.

13 He that is born in thy house and he that is bought with thy money must be circumcised; and My covenant shall be in your flesh for an everlasting covenant. — the everlasting covenant is about the land that God was planning to bestow upon those who are part of the covenant; nothing about everlasting life that came later;

— the Targum Onkelos says

Your house-born slaves must be circumcised, and also those bought with your money. This shall be My covenant in your flesh as an eternal covenant.

14 And the uncircumcised manchild whose flesh of his foreskin is not circumcised, that soul shall be cut off from his people; he hath broken My covenant.” — this sealed only the covenant of the land of Canaan to Isaac’s posterity;

— the Targum Onkelos says

An uncircumcised male, who will not circumcise his foreskin, that soul [man] shall be cut off from its people; he has broken [changed] My covenant.

15 And God said unto Abraham, “As for Sarai thy wife, thou shalt not call her name Sarai, but Sarah shall her name be. — Sarai is now formally taken into the covenant, as she is to be the mother of the promised seed;

— the Targum Onkelos says

And Elohim said to Avraham [As for] Sarai your wife, do not call her by the name Sarai, for Sarah is her name.

16 And I will bless her and give thee a son also by her. Yea, I will bless her, and she shall be a mother of nations; kings of people shall be of her.” — a son of her: this is the first place where it was definitely promised that Abram’s heir should be Sarah’s own son;

— the Targum Onkelos says

I will bless her, and I will also give you a son through her. I will bless her, and she will be [a mother] of nations [assemblies], kings of peoples [who rule over nations] will descend from her.

17 Then Abraham fell upon his face and laughed, and said in his heart, “Shall a child be born unto him that is a hundred years old? And shall Sarah, who is ninety years old, bear?”

— and laughed; not through distrust of the promise, as Sarah did (Genesis 18:12), for he staggered not at that through unbelief, but for joy at such good news;

— the Targum Onkelos says he laughed and “he rejoiced”

Avraham fell on his face and laughed [rejoiced]. He said in his heart: Can a hundred year old man have children? Shall Sarah, who is ninety years old give birth?

18 And Abraham said unto God, “O that Ishmael might live before Thee!” — Abraham prays that Ishmael’s might be preserved, and that it might be spent in the fear, worship, and service of God; so the Targum of Jonathan says, “O that Ishmael might live and worship before thee,”

— the Targum Onkelos says

And Avraham said to [before] Elohim: May it be granted that Yishmael live before You.

19 And God said, “Sarah thy wife shall bear thee a son indeed, and thou shalt call his name Isaac; and I will establish My covenant with him for an everlasting covenant, and with his seed after him.

— Thou shalt call his name Isaac; that is, he laughs; the name was to be a perpetual memorial that Isaac’s birth was naturally such an impossibility as to excite ridicule;

— the Targum Onkelos says

Elohim said: Indeed, your wife Sarah will bear you a son, and you will name him Yitzchok. I will establish My covenant with him as an eternal covenant to his descendants after him.

20 And as for Ishmael, I have heard thee. Behold, I have blessed him, and will make him fruitful and will multiply him exceedingly. Twelve princes shall he beget, and I will make him a great nation.

— the blessings of the covenant are reserved for Isaac, but common blessings were abundantly promised to Ishmael; or twelve sons of Ishmael, his son by Hagar; and, adds he, these going into Arabia;

— the Targum Onkelos says

And as for Yishmael, I have heard you [I have accepted your prayer]. I have blessed him, and I will make him fruitful, and will increase him exceedingly. He will become the father of twelve princes, and I will make him into a great nation.

21 But My covenant will I establish with Isaac, whom Sarah shall bear unto thee at this set time in the next year.” — but my covenant will I establish with Isaac, implying the covenant wasn’t with Ishmael;

— the Targum Onkelos says

But I will establish My covenant with Yitzchok, who Sarah will bear to you at this time next year.

22 And He left off talking with him, and God went up from Abraham. — and God went up from Abraham; from the earth, where he had been with Abraham, and ascended above him up to heaven;

— the Targum Onkelos says

And when He finished speaking with him, [the Glory of] Elohim ascended from Avraham.

23 And Abraham took Ishmael his son, and all that were born in his house, and all that were bought with his money, every male among the men of Abraham’s house, and circumcised the flesh of their foreskin in the selfsame day, as God had said unto him.

— and Abraham took Ishmael his son; to circumcise him; he took his son first, to set an example to his servants; which were three hundred and eighteen when he rescued Lot from the kings, Genesis 14:14; and perhaps they might have increased;

— the Targum Onkelos says

Avraham took his son, Yishmael, and all those that were born in his household, and all that he had bought with his money, every male member of Avraham’s household, and he circumcised the flesh of their foreskin on that very day as Elohim had said to him.

24 And Abraham was ninety years old and nine when he was circumcised in the flesh of his foreskin. — and Abraham was ninety years old and nine; when he was circumcised in the flesh of his foreskin;

— the Targum Onkelos says

Avraham was ninety-nine years old when he was circumcised in the flesh of his foreskin.

25 And Ishmael his son was thirteen years old when he was circumcised in the flesh of his foreskin. — Ishmael was thirteen years old; hence Arabs and Mohammedans defer circumcision until the thirteenth year;

— the Targum Onkelos says

And his son Yishmael was thirteen years old when he circumcised the flesh of his foreskin.

26 In the selfsame day was Abraham circumcised, and Ishmael his son. — in the selfsame day was Abraham circumcised, and Ishmael his son; this is repeated, that it might be taken notice of that both were circumcised according to the command of God, and on the very day in which it was given;

— the Targum Onkelos says

On that very day Avraham and his son Yishmael were circumcised.

27 And all the men of his house, born in the house, and bought with money from the stranger, were circumcised with him. — born in the house, or bought with money of the stranger, were circumcised with him; by their will, and with their consent; not forced on them;

— the Targum Onkelos says

All the men of his household, those born in his household, and bought with money from a stranger, were circumcised with him.

Genesis 18

“Is anything too hard for the Lord?” asked the Lord

1 And the Lord appeared unto him in the plains of Mamre, as he sat in the tent door in the heat of the day. — as Abraham was sitting in the tent door in the heat of the day, reposing; then three “men” stood before him;

— the Targum Onkelos says

Adonoy appeared [became revealed] to him in the groves [plains] of Mamrei and he was sitting at the door of the tent in the heat of the day.

And he lifted up his eyes and looked, and lo, three men stood by him. And when he saw them, he ran to meet them from the tent door, and bowed himself toward the ground — three men; these three men were three spiritual, heavenly beings, now assuming human shapes, that they might be visible to Abraham,

— the Targum Onkelos says

He lifted his eyes and saw, and behold three men were standing over him. He saw [them], and ran from the door of the tent to greet them, and he bowed down to the earth.

— the Targum of Jonathan reveals that ministering angels are usually send with a single duty, says

“And he lifted up his eyes and looked, and behold, three angels in the likeness of men were standing before him, who were sent for the need of three specific things; for it is not the way of the ministering angels to be sent for more than one single matter.

One came to bring him the news that Sarah would bear a male son; one came to rescue Lot; and one came to overthrow Sodom and Gomorrah. And when he saw them, he ran to meet them from the door of the tent and bowed down to the ground.”

— the Targum Jerusalem says it more explicitly

“Three angels were sent to our father Abraham, and the three of them were sent for three [different] things; for it is not possible for one of the angels of the heights that more than one single matter should be sent by his hand.

The first angel was sent to announce to our father Abraham that Sarah would give birth to Isaac; the second angel was sent to rescue Lot from the midst of the overthrow; the third angel was sent to overthrow Sodom and Gomorrah, Admah and Zeboiim.

Therefore, a word of prophecy from before the Lord was with Abraham the righteous, and the Memra (Word) of the Lord was revealed to him in the valley of vision while he was sitting at the door of the tent, warming himself from his circumcision in the heat of the day.”

and said, “My lord, if now I have found favor in thy sight, pass not away, I pray thee, from thy servant. — my lord; Heb ‘donai, a term of simple respect, or denoting one having authority;

— the Targum Onkelos says

He said, My Master, if I have found favor in Your eyes [before you], please [now] do not bypass your servant.

Let a little water, I pray you, be fetched, and wash your feet and rest yourselves under the tree; — and wash your feet; which was very refreshing to travellers in hot countries, who walked barefoot or in sandals; and this he proposes to be done by one of his servants;

— the Targum Onkelos says

Let a bit of water be brought [They will take a bit of water] and wash your feet. Rest yourselves under the tree.

and I will fetch a morsel of bread and comfort ye your hearts. After that ye shall pass on, for therefor are ye come to your servant.” And they said, “So do, as thou hast said.” — and they said, so do as thou hast said; they agreed to it, that water should be fetched to wash their feet, and food for them to eat;

— the Targum Onkelos says

I will get bread and you will sustain your heart. Afterwards you will continue on your way, since you have passed by your servant. They said, Fine, do as you have said.

And Abraham hastened into the tent unto Sarah, and said, “Make ready quickly three measures of fine meal, knead it, and make cakes upon the hearth.” — Sarah is tasked and occupied with the baking;

— the Targum Onkelos says

Avraham hurried to Sarah’s tent and said, Hurry! [take] three measures of the finest flour; knead it and make cake-rolls.

And Abraham ran unto the herd and fetched a calf, tender and good, and gave it unto a young man, and he hastened to dress it.

— Abraham and his servant are responsible for the selection and killing of a calf, the cooking of the meat, and the procuring of butter and milk from the herd; a meal in which meat is provided is a rarity in a Bedouin’s life, and is the sign of the offering of hospitality;

— the Targum Onkelos says

Avraham ran to the cattle, and took a tender, choice calf. He gave it to the lad. and hurried to prepare it.

And he took butter and milk and the calf which he had dressed, and set it before them; and he stood by them under the tree, and they ate. — and they did eat; or seemed to eat, though as they assumed bodies so animated as to be capable of talking and walking, why not of eating and drinking? as the Targum of Jonathan implies;

— the Targum Onkelos says

He took butter, milk, and the calf he had prepared, and set it before them. He stood over them [served them] under the tree, and they ate.

And they said unto him, “Where is Sarah thy wife?” And he said, “Behold, in the tent.” — Where is Sarah thy wife? by naming her, they gave intimation to Abraham, that though they seemed strangers, yet they well knew him and his family;

— the Targum Onkelos says

They said to him, Where is Sarah, your wife? He said Here, in the tent.

10 And he said, “I will certainly return unto thee according to the time of life; and lo, Sarah thy wife shall have a son.” And Sarah heard it from the tent door, which was behind him.

— Sarah heard it in the tent door, which was behind him; the women’s place is in the back of the tent, normally divided by a thin partition from the men’s;

— the Targum Onkelos says

He said I will return to you next year [at this time when you will be alive], and Sarah, your wife will have a son. Sarah was listening at the door of the tent, that was behind him.

11 Now Abraham and Sarah were old and well stricken in age, and it ceased to be with Sarah after the manner of women. — and it ceased to be with Sarah after the manner of women;

— her monthly visitors had left her, so that she was unfit for conception, and there could be no hope of it in a natural way;

— the Targum Onkelos says

Avraham and Sarah were old, well on in years. Sarah no longer had the way of women.

12 Therefore Sarah laughed within herself, saying, “After I have waxed old shall I have pleasure, my lord being old also?” — Sarah laughed; not from joy and admiration, but from distrust and contempt, as if it were incredible;

— Heb; in her heart, that is, she secretly derided it, though none but herself, as she thought, knew it;

— the Targum Onkelos says

Sarah laughed to herself saying, Now that I am worn out [old], shall I have the pleasure [of a son] [youthfulness], my master being [also] an old man.

13 And the Lord said unto Abraham, “Why did Sarah laugh, saying, ‘Shall I of a surety bear a child, who am old?’ — which am old? suggesting there was no reason for it, and signifying his displeasure and indignation;

— the Targum Onkelos says

Adonoy said to Avraham, Why did Sarah laugh saying, Can I really give birth when I am old?

14 Is any thing too hard for the Lord? At the time appointed I will return unto thee, according to the time of life, and Sarah shall have a son.” — at the time appointed will I return to thee, according to the time of life, and Sarah shall have a son;

— such words are repeated not merely for the confirmation of Abraham’s faith, which staggered not, but to remove any of Sarah’s doubts;

— the Targum Onkelos says

Is anything too far removed [hidden] from [before] Adonoy? At the appointed time I will return to you, at this time of life [when you will be alive], and Sarah will have a son.

15 Then Sarah denied, saying, “I laughed not,” for she was afraid. And He said, “Nay, but thou didst laugh.” — somewhat a lie, to say she did not laugh when she did; which she might be tempted to say in her confusion; for she was afraid;

— the Targum Onkelos says

Sarah denied it saying, I did not laugh, for she was afraid. He said, Not so, for [but] you did laugh.

16 And the men rose up from thence, and looked toward Sodom; and Abraham went with them to bring them on the way. — and looked toward Sodom; set their faces and steered their course that way, by which it appeared they intended to go thither;

— the Targum Onkelos says

The men stood up from where they were, and they gazed upon Sedom. Avraham went with them to send them [escort them] [on their way].

— the Targum of Jonathan says that he that brought the news to Sarah “ascended to high heavens,” and the other two looked toward Sodom; but it seems most likely, that, when the two went on their way to Sodom, Abraham went with them for a distance;

— and upon Abraham’s return, the first may have descended from the first atmosphere, which is the first heaven (not the highest heaven), and continue his discourse with Abraham;

17 And the Lord said, “Shall I hide from Abraham that thing which I do, — and the Lord said; (וַֽיהֹוָ֖ה) Yehovah the Hebrew word we call Lord, shows that this angel was God himself: for this word Yehovah is God;

— the Targum Onkelos says

Adonoy said, Shall I conceal from Avraham what I am about to do?

18 seeing that Abraham shall surely become a great and mighty nation, and all the nations of the earth shall be blessed in him.

— the Targum Onkelos says

Avraham is indeed to become a great and mighty nation, and through him [and because of him] shall be blessed all the nations of the world.

— the Targum of Jonathan says: Abraham is to be a great and mighty people, and through him shall all the peoples of the earth be blessed.

19 For I know him, that he will command his children and his household after him, and they shall keep the way of the Lord to do justice and judgment, that the Lord may bring upon Abraham that which He hath spoken of him.”

— this judgment upon Sodom is to be explained to him, that he may train his household to avoid the sins of this doomed city;

— “to keep the way of the Lord, to do justice and judgment; and all this to the further intent that the Lord may bring upon Abraham what he hath spoken of him,” to do justice and judgment; to attend to all the laws, statutes, and judgments of God;

— the Targum Onkelos says

For I have given him special attention because he commands his children [For it is known to Me that he will command his children], and his household after him, and they will preserve the way of Adonoy [the ways that are good in the eyes of Adonoy], doing charity and justice, so that Adonoy will bring upon Avraham all that which He has spoken of him.

20 And the Lord said, “Because the cry of Sodom and Gomorrah is great, and because their sin is very grievous, — because the cry of Sodom and Gomorrah is great; their sins were grievous; attended with very aggravated circumstances;

— the Targum Onkelos says

[Thus] Adonoy said, The wailing concerning Sedom and Amorah is so great, and their sin is so very grave.

21 I will go down now and see whether they have done altogether according to the cry of it, which has come unto Me; and if not, I will know.” — their cry, which ascends to heaven, is an appeal for judgement or punishment;

— I will go down and see; these cities were to be made examples to all future ages of God’s severity; and therefore ample proof given that the judgment was neither rash nor excessive; but well considered by God himself, (Eze 18:23; Jer 18:7)

— the Targum Onkelos says

I will descend now and see [I will become revealed now and judge], if their wailing which has come to [before] Me is indicative of their conduct; destruction [shall come upon them] [I will destroy them]. If not I will know. [If they will repent, I will not punish them.]

22 And the men turned their faces from thence, and went toward Sodom; but Abraham stood yet before the Lord. — but Abraham stood yet before the Lord; before the first person, whom Abraham now began to know more clearly;

— he stood before him with all reverence and humility, to hear what the Lord (Yehovah יְהוָֽה) had further to say to him, as well as to say something to him himself; he stood “yet” that is, he continued to stand after the departure of the two angels that were gone to Sodom. Onkelos and Jonathan paraphrase it, “he ministered in prayer before the Lord.”

— the Targum Onkelos says

The men turned from where they were, and went toward Sedom. Avraham was still standing [serving with prayer] before Adonoy.

23 And Abraham drew near and said, “Wilt Thou also destroy the righteous with the wicked? — Abraham prayed or pleaded earnestly that Sodom might be spared, if but a few righteous persons should be found in it;

— the Targum Onkelos says

Avraham came forward and said, Will You [actually] destroy the righteous with the wicked [in anger]?

24 Perhaps there be fifty righteous within the city; wilt Thou also destroy and not spare the place for the fifty righteous that are therein? — within the city, within the pentapolis, which consisted of five cities;

— the Targum Onkelos says

Suppose [Perhaps] there are fifty righteous people in the midst of the city, will You still destroy it [in anger], and not bear with the place for the sake of the fifty righteous people inside it?

— the Targum of Jonathan says,

“Perhaps there may be fifty righteous persons in the city who pray before thee, ten for every city, answerable to the five cities of Sodom and Gomorrah, Admah, Zeboiim, and Zoar:”

25 That be far from Thee to do in this manner — to slay the righteous with the wicked; and that the righteous should be as the wicked, that be far from Thee! Shall not the Judge of all the earth do right?”

— to slay the righteous with the wicked? which is true of temporal calamities but certainly not true of eternal punishment; shall not the Judge of all the earth do right? meaning the Lord, to whom he drew nigh, and was pleading with,

— even the Son of God in human form, who, as he made the world, was the Governor of it and Judge in it; and indeed, as Mediator, has all judgment committed to him, and is appointed to be Judge of quick and dead at the last day;

— the Targum Onkelos says

It would be sacrilege [Your judgments are true therefore it is impossible] [to attribute] to You such an act, to kill the righteous with the wicked, treating the righteous and the wicked alike. It would be sacrilege to attribute this to You [Your judgments are true]: Shall the Judge of all the earth not do justice?

26 And the Lord said, “If I find in Sodom fifty righteous within the city, then I will spare all the place for their sakes.” — then will I spare all the place for their sakes; not Sodom only, but the whole country, (Gomorrah, Admah, Zeboiim, and Zoar) of which Sodom was the chief;

— the Targum Onkelos says

Adonoy said; If, in Sedom, I find fifty righteous within the city, I will bear with the entire place for their sake.

27 And Abraham answered and said, “Behold now, I have taken upon me to speak unto the Lord, I, who am but dust and ashes. — but dust and ashes, yet he speaks as one amazed at his own boldness, and the liberty God graciously allowed him, considering God’s greatness;

— the Targum Onkelos says

Avraham responded and said, Here I have begun to speak to [before] my Master, and I am but dust and ashes.

28 Perhaps there shall lack five of the fifty righteous; wilt Thou destroy all the city for lack of five?” And He said, “If I find there forty and five, I will not destroy it.” — and he asked, if l find there forty and five, I will not destroy it; that is, forty five righteous persons?

— the Targum Onkelos says

But suppose [perhaps] they lack five of the fifty righteous? Will You destroy all the city because of five? He said, I will not destroy if I find forty-five there.

29 And he spoke unto Him yet again and said, “Perhaps there shall be forty found there?” And He said, “I will not do it for forty’s sake.” — and he said, I will not do it for forty’s sake; but spare them for their sake;

— the Targum Onkelos says

He [Avraham] continued to speak to [before] Him and said, Suppose [Perhaps] there are forty found there? He said, I will not do it [inflict destruction] for the sake of the forty.

30 And he said unto Him, “Oh let not the Lord be angry, and I will speak: Perhaps there shall thirty be found there.” And He said, “I will not do it if I find thirty there.” — he said unto him, Oh, let not the Lord be angry, and I will speak; this he feared, through his importunity, he should be wearisome to him and incur his displeasure;

— the Targum Onkelos says

He said, Let not my Master show anger and I will [continue] to speak. Suppose [Perhaps] thirty are found there? He said, I will not do it [inflict destruction] if I find thirty there.

31 And he said, “Behold now, I have taken upon me to speak unto the Lord: Perhaps there shall be twenty found there.” And He said, “I will not destroy it for twenty’s sake.” — and he said, I will not destroy it for twenty’s sake; if there were no more in it, I would spare it for their sake;

— the Targum Onkelos says

He said, Here I wished to speak to [before] my Master. Suppose [Perhaps] twenty are found there? He said, I will not destroy for the sake of the twenty.

32 And he said, “Oh let not the Lord be angry, and I will speak yet but this once: Perhaps ten shall be found there.” And He said, “I will not destroy it for ten’s sake.” — and he said, I will not destroy it for ten’s sake; though no more righteous persons were found in it;

— he ended at ten, perhaps because he supposed there were at least ten righteous persons in Lot’s family, Lot and his wife, and their four daughters, and their four husbands; but they forgot that two of Lot’s daughters were unmarried, and how many he had married is not known; ten they say make a congregation, and wherever there are ten righteous persons, a place is saved for their sakes;

— the Targum Onkelos says

He said, Let not my Master show anger [Let there not be anger before my Master], and I will speak just once more. Suppose [Perhaps] ten are found there? He said, I will not destroy for the sake of the ten.

33 And the Lord went His way, as soon as He had finished communing with Abraham; and Abraham returned unto his place. — and Abraham returned unto his place; to his tent in the plains of Mamre, waiting to observe or hear what would be the issue and event of things respecting Sodom and Gomorrah;

— the Targum Onkelos says

Adonoy departed [The glory of Adonoy ascended] when He finished speaking to Avraham, and Avraham returned to his place.

Singapore’s Lawrence Wong, leaning towards Japan

•March 22, 2026 • Leave a Comment

Lawrence Wong, 53, who urged China to forgive Japan, had his family history exposed; his grandfather’s livelihood was provided by the Japanese army.

Min News • March 17, 2026 ~ inf.news

On November 19, 2025, Singaporean Prime Minister Lawrence Wong, facing international media, urged China to “put history aside,” referring to the Diaoyu Islands as the “Senkaku Islands,” and calling Japan the “most trusted major power” in Southeast Asia.

Even more unexpectedly, this sparked outrage among Singaporeans, who flooded his social media accounts with comments questioning whether he had forgotten the location of the war memorial.

Soon, someone dug up his family history-his grandfather had cooked for the Japanese during the Japanese occupation, serving as a chef for the Malayan Railways, and at that time, the railway system was one of the logistical lifelines controlled by the Japanese army. Why did Lawrence Wong’s remarks provoke such a strong backlash? Did his family history influence his judgment on international issues?

Singaporean Prime Minister Lawrence Wong, born December 18, 1972, grew up in a 5-room HDB flat in Marine Parade

On May 15, 2025, Lawrence Wong officially took office as Prime Minister of Singapore. At that time, his image in China was relatively positive. Shortly after taking office, he visited China and talked about the “One China Principle,” “opposition to Taiwan independence,” and “willingness to deepen cooperation,” which received a lot of positive coverage from Chinese media.

In late June 2025, at the Tianjin Davos Forum, he stated that Singapore would maintain good relations with both China and the United States, without taking sides. These remarks led people to believe that he would continue Lee Hsien Loong’s “balancing act,” avoiding taking sides easily between major powers.

However, a few months later, Lawrence Wong’s behavior began to deviate significantly.

The turning point came in early November 2025. Japanese Prime Minister Sanae Takaichi publicly declared in the Diet that “a crisis in Taiwan would constitute a crisis of Japan’s survival.” The subtext of this statement was that Japan would consider military intervention should a conflict break out in the Taiwan Strait.

These provocative remarks quickly triggered a strong reaction from China. Chinese Vice Foreign Minister Sun Weidong immediately summoned the Japanese ambassador to China, and the Ministry of National Defense also clearly stated that if Japan interferes in the Taiwan Strait, it will be considered an act of aggression, and China will retaliate forcefully.

Just as Sino-Japanese relations had plummeted to a freezing point, Lawrence Wong “jumped out” at the Bloomberg Forum and made those remarks advising China to “set aside history.”

He said that China should, like [other] Southeast Asian countries, “let go of its historical baggage” and “look forward.” He also stated that Japan, now the “most trusted major power” in Southeast Asia, should play a greater role in regional security.

Lawrence Wong’s remarks completely shattered the “neutral” image he had previously cultivated.

In particular, his use of the term “Senkaku Islands” is noteworthy. Even Western media outlets typically use a neutral term when addressing the Diaoyu Islands issue. As the Prime Minister of Singapore, a non-claimant state, he proactively adopted Japan’s official terminology, making no attempt to conceal his stance.

This was not a slip of the tongue, nor a diplomatic blunder, but a carefully prepared political statement.

Lawrence Wong’s remarks have triggered a chain reaction in Southeast Asia. Malaysian commentator Wee Kim Siang publicly criticized him for making five serious mistakes, including being unqualified to represent Southeast Asia, favoring the provocative party, confusing right and wrong, lacking diplomatic sensitivity, and forgetting his own country’s history.

Myanmar military representative Cho Myo Sin also stepped forward and said, “Japan has no remorse whatsoever and is still following the old path of militarism.”

Civil society organizations in South Korea and the Philippines also protested, saying he was whitewashing the perpetrators and causing further harm to the victims of war.

The reaction was even stronger in Singapore.

Many Singaporean netizens left messages on social media, questioning Lawrence Wong: What gives you the right to speak on our behalf and forgive? Can you speak for the 50,000 Chinese who were massacred in Singapore?

Not only ordinary netizens, but also discontent has begun to emerge within the ruling party. Some members of parliament privately remarked that Lawrence Wong may have forgotten that the mass graves dug when factories were built in Singapore were only a few decades old.

What angers Singaporeans even more is the renewed exposure to that “forgotten history.”

On Lunar New Year 1942, Singapore fell to the Japanese. Three days later, the Japanese army launched a “massacre,” killing as many as 50,000 Chinese.

The mastermind behind this massacre was Tomoyuki Yamashita, commander of the Japanese 25th Army. He ordered a “screening” of potential anti-Japanese Chinese. This “screening” involved a concentrated review to determine who should live and who should die.

The Japanese army had no clear standards; they judged people by their appearance, whether they had tattoos, and even by drawing lots to decide who would live and who would die. Some young people were killed simply because they wore glasses and were considered intellectuals; some Hainanese became key targets because of their “strong anti-Japanese sentiments.”

Changi Beach, Punggol Beach, Sigana, and other places were stained red with blood. Japanese soldiers used machine guns to mow down people, stabbed them with bayonets, and even tied people together and pushed them into the sea.

Lee Kuan Yew also nearly died at the time. He mentioned in his memoirs that he was also taken for “identification” that day, and only managed to escape by applying to go home to get some things.

The massacre lasted a week. The Singaporean Chinese community estimated the death toll to be over 100,000, while the figures accepted by the postwar trials that the “Sook Ching” massacre, were between 25,000 and 50,000, according to the Singapore National Archives.

To commemorate this tragic history, Singapore erected a 67-meter-high memorial to the victims in 1967, and a national memorial ceremony is held every February 15.

In 2017, when Singapore held a World War II memorial exhibition, it was met with protests from the public simply because it used the name “Shōnan,” which was used during the Japanese occupation. Ultimately, the government had to apologize and change the name.

Against this historical backdrop, Lawrence Wong’s statement about “shelving history” naturally sparked uneasy controversy.

Even more shockingly, as the incident unfolded, Singaporean netizens unearthed his family history and discovered that it was not a coincidence at all.

Lawrence Wong is a descendant of Hainanese people. His grandfather, Wong Chee Ming, worked as a cook for the Malayan Railways in Ipoh, and during the Japanese occupation, prepared meals specifically for the Japanese army.

At that time, traveling through the peninsula from the colonial era, the railway bureau was a military logistics unit later controlled by the Japanese army, which means that Lawrence Wong’s grandfather made a living by cooking for the Japanese army. In the Hainanese community of that era, culinary roles were common and as such, he worked earlier as a chef for the Malayan railways.

In those days of famine, many Chinese were forced to flee from the Japanese army and lived in dire straits. However, the Wong family’s life was relatively stable because of this job, and they even had enough money to make a living.

Netizens sarcastically commented that it’s no wonder Lawrence Wong speaks up for Japan; it turns out his family’s livelihood comes from the Japanese.

His father, Wong Kim Soon, later worked as a salesman for a Malaysian multinational corporation and named him “Xun Cai,” meaning “follow the money.” This profit-seeking mentality seems to have been passed down through three generations.

Lawrence Wong studied economics in the United States in his early years. After returning to the country, he rose through the ranks, serving in the Ministry of Trade and Industry and the Ministry of Finance. He became Prime Minister in 2024. Almost every choice he made along the way was driven by “interests.”

His “choosing sides” was not a momentary impulse, but an inevitable manifestation of his long-term values.

In a previous interview with American media, he prepared a speech in advance, not only using the term “Senkaku Islands” but also emphasizing that “Southeast Asia can forgive Japan” and urging China to “look forward.”

Genesis (15-16)

•March 21, 2026 • Leave a Comment

The Targum, which originated in the Aramaic language, is strongly linked to the work of Ezra, holds significance for shedding light on biblical concepts. When the Masoretic Text can be vague, uncertain, or unclear, the Targum often offers clearer meaning, broader insight, and deeper understanding.

“The LORD shall smite thee with madness, and blindness, and astonishment of heart; and thou shalt grope at noonday, as the blind gropeth in darkness” Deuteronomy 28:28-29

Genesis 15

~~~~

1 After these things the word of the Lord came unto Abram in a vision, saying, “Fear not, Abram. I am thy shield and thy exceeding great reward.”

— up to this time Abram had received only general promises of offspring, and of the land being the possession of his seed; where is that land? and years were passing by, and the fulfilment of Abram’s hopes remained distant as ever;

— but the war with the Elamite king he had also made for himself powerful enemies; and though the immediate result was fortunate, yet many Canaanite nations may have witnessed with displeasure so remarkable an exhibition of the power and energy of an intruder, an “immigrant!”

— and thus the time had come when the patriarch needed and obtained more formal assurances, first, of the bestowal upon him of offspring (Genesis 15:1-6), and, secondly, of the future possession of that land, now called Palestine (Genesis 15:18-21);

— the Targum Onkelos says

After these events, the word of Adonoy came to Avram in a vision, saying: Fear not Avram, I am your shield [My Word is your strength], your reward is very great.

— the Targum of Jonathan (Jerusalem also) preambles the scene of Abraham’s personal worries, which prompt the Lord’s response, saying

After these words, after the kings had gathered together and had fallen before Abram, and he had slain the four kings and turned back nine armies, Abram thought in his heart and said:

‘Woe to me! Perhaps now I have received the reward for my appointments in this world, and I will have no portion in the World to Come.
Or perhaps the brothers and relatives of those whom I killed will go and join themselves into legions and come against me.
Or perhaps at that [previous] time some small merit was found with me and therefore they fell before me, but at another time merit will not be found with me and the Name of Heaven will begin judgment against me.’

Then the word of the Lord came to Abram in a vision, saying:

‘Do not fear. Even though their warriors gather in legions and come against you, My Word will be your shield.
And even though they fell before you in this world, the reward of your good deeds is kept and prepared before Me for the world to come — very great.’”

And Abram said, “Lord God, what wilt Thou give me, seeing I go childless and the steward of my house is this Eliezer of Damascus?” — Abram is still childless and landless;

— what wilt thou give me? there is a slight tone of complaint in these words. God promised Abram a “reward great exceedingly”

— Abram answers that no reward can really be great so long as he has no heir;

— the Targum Onkelos says

Avram said: My Master, God, what will You give me since I continue to be childless, and the manager of my household [this supplier who is in my house] is Eliezer of Damascus.

— the Targum of Jonathan says

“And Abram said: ‘O Lord God, many blessings You have given me, and many [more] are before You to give me; but what benefit is there to me, since I am passing from this world without children? And Eliezer, the son of my household’s steward—by whose hands miracles were performed for me in Damascus—expects to inherit me.'”

— Who was Eliezer, a servant of Abraham? Eliezer was Abraham’s most trusted servant and estate manager, Abraham says of him “the steward of my house is Eliezer of Damascus.” Some believe Eliezer is the unnamed servant in Genesis 24 whom Abraham sent to find a wife for Isaac.

And Abram said, “Behold, to me Thou hast given no seed; and lo, one born in my house is mine heir.” — “What wilt thou give me?” Of what use will land or wealth be to me, the immediate reward specified by the promise?

— the Targum Onkelos says

And Avram said: Behold, You have not given me children, and thus one of my household will be my heir.

And behold, the word of the Lord came unto him, saying, “This shall not be thine heir, but he that shall come forth out of thine own loins shall be thine heir.” — but he that shall come forth out of thine own bowels shall be thine heir; that is, one shall inherit all thou hast, that shall be begotten by thee;

— an own son of Abram’s, and not a servant born in his house; one that should spring out of his own loins: one “out of thy womb”, that is, out of his wife’s, which was his; the phrase designs a genuine and legitimate son, who would be legally his heir;

— the Targum Onkelos says

Suddenly the word of Adonoy came to him, saying: That one will not be your heir; only he that will come from within your body [a son that you will beget] will be your heir.

And He brought him forth outdoors and said, “Look now toward heaven and count the stars, if thou be able to number them.” And He said unto him, “So shall thy seed be.” — Abram’s seed according to the flesh were like the “dust of the earth,” Genesis 13:16, and his spiritual seed are like the stars of heaven;

— the Targum Onkelos says

He [then] took him outside and said: Look towards the heavens and count the stars if you are able to count them. He then said to him: So [numerous] will your descendants be.

And he believed in the Lord; and He accounted it to him for righteousness. — Abram believed the Lord. And the Lord accepted Abram’s faith, and that faith made him right with God;

— the Targum Onkelos says

He believed in [the Word of] Adonoy, and this He accounted to him for righteousness.

And He said unto him, “I am the Lord who brought thee out of Ur of the Chaldeans, to give thee this land to inherit it.” — the Lord next confirms and explains the promise of “the land” to Abram and further assurance was given tohim of “this land ” the land of Canaan for an inheritance;

— the Targum Onkelos says

He said to him: I am Adonoy who brought you out of Ur Kasdim, to give to you this land as an inheritance.

And he said, “Lord God, whereby shall I know that I shall inherit it?” — he asks for a sign, not out of distrust of God’s promise, for he was strong in faith, but for further assurance and confirmation;

— the Targum Onkelos says

And he said: My Master, God, how will I know that I will inherit it?

And He said unto him, “Take Me a heifer of three years old, and a shegoat of three years old, and a ram of three years old, and a turtledove, and a young pigeon.” — the sign to Abram is the sign of the covenant:

— take me an heifer; offer me a sacrifice, a occasion of great importance, when two or more parties join in a compact, they either observe precisely the same rites as Abram did, or, where they do not, they invoke the lamp as their witness;

— the Targum Onkelos says

He said to him: Bring Me [Sacrifice before Me] three heifers, three goats and three rams, a dove, and a young pigeon.

10 And he took unto Him all these, and divided them in the midst and laid each piece one against another; but the birds divided he not. — divided them in the midst; that is, the three animals, the heifer, goat, and ram into two equal parts;

— laid each piece one against another, one half against the other, the left side against the right, shoulder against shoulder, and leg against leg, so that they might seem to join;

— partly in hope they would join together, that God would in his time put those parts together, and unite those dry bones, (to which the Israelites are compared, Ezekiel 37:1-28), and clothe them with flesh; and partly that the persons entering into covenant might pass between those parts, and so testify their union and conjunction in one and the same sacrifice.

— but the birds were not divided; but laid them one against another; as the birds used in sacrifice under the law were not to be divided, Leviticus 1:17; which may signify that when the Jewish people, in the latter day, are brought together into their own land, when they will better answer the character of turtles and doves than they ever did, will be no more divided and separated from each other;

— most preparation for an offering were then burnt, but this intended offerings were not burnt. Why not? Perhaps, God’s commitment of “I am thy shield!” is debatable; or conditional?

— the Targum Onkelos says

He brought [sacrificed] all these to [before] Him; he split them in the middle [into two equal parts], and placed each piece opposite the other. The bird, however, he did not split.

— the Targum of Jonathan says

“And he brought all these before Him, and he divided them in the middle, and he arranged each part opposite its fellow; but the birds he did not divide.”

11 And when the fowls came down upon the carcasses, Abram drove them away. — and when the birds of prey came down upon the carcases, Abram scared them away;

— had there been a sacrifice the fire would have kept the vultures from approaching; but the bodies lay exposed, and Abram therefore kept guard over them, lest the purpose of the ceremonial should be frustrated by any want of respect shown to the outward symbols;

— the Targum Onkelos says

Birds of prey [vultures] descended upon the carcasses, but Avram drove them away.

— in a standard sacrificial offering (Olah), the animals are slaughtered and burnt on an altar. However, here, Abraham cuts them in half and lays the pieces facing each other, but he does not light a fire;

— the Targum Jerusalem reveals that the birds of prey are “the kingdoms of the earth which are worshippers of idols,”

And when the birds descended, they came not nigh the divisions: those birds are unclean fowl, and those unclean fowl are the kingdoms of the earth which are worshippers of idols, and which counsel evil counsels against the sons of Israel; but the integrity of the righteous Abram hindered them.

— it’s worth noting that the Targums identify the fowls as birds of prey, or specifically the predatory vultures that came down, which symbolize their plundering neighbours, the “kingdoms of the earth.” Historically, these are: Assyria, Babylon, Persia, Greece, Rome and the Ottoman empire, but during the endtime:

A) Ezekiel 4 – 390/40 Years Timeline

B) The Flaming Sword and Fire from the South!

C) A Psalm 83 Prophecy

D) A Greater “Out of Egypt” Exodus (another Exodus for the twelve tribes)

E) Return of the Whole House of Israel – Ezekiel 36-37 (stick of Judah to be joined to the stick of Joseph)

F) The Gog and Magog Prophecy (triumph of Ephraim finally)

In all these Abraham’s shooing off the birds of prey away during the endtime, as Gentile nations are trying to destroy the nation of Israel, Abraham’s act of “driving them away” was a fulfilment that it was his own endeavor to protect his descendants throughout their history; the Septuagint version says, “Abram sat by them;” he sat by the carcasses and watched them, that no hurt came to them;

— and it is important to note that it wasn’t God who drove the vultures away, but Abraham. And as the offering were not burnt and be accepted by God immediately, hence God’s initial promise of “Fear not, Abram. I am thy shield and thy exceeding great reward” is not quickly consumated. Or, for another explanation, that God had promise the Shield protection initially, but Abraham’s lack of faith by asking for a sign, and the burnt offering wasn’t consumated immediately;

And I will give the men who have transgressed My covenant, who have not performed the words of the covenant which they had made before Me when they cut the calf in twain and passed between the parts thereof—

the princes of Judah and the princes of Jerusalem, the eunuchs, and the priests, and all the people of the land who passed between the parts of the calf— Jeremiah 23:18-19

— note that this covenant was meant to Abraham’s posterity who had transgressed God’s covenant, “who have not performed the words of the covenant,” reenforcing the theme that sinners need to go through numerous trials to purify themselves before God;

— and although the offering was not burnt and be accepted immediately, it should also be noted that later on, “a smoking furnace and a burning lamp passed between those pieces, v17;” synifying that at the end, God did accept the sacrifices ultimately. But then, this happened later, after Abraham had to shoo off the birds of prey through his own effort.

For more, see Sequence of Keystone Prophecies till the End

12 And when the sun was going down, a deep sleep fell upon Abram; and lo, a horror of great darkness fell upon him. — when the sun was going down; the time described was the evening following the night on which he had received the assurance that his seed should be countless as the stars;

— the Targum Onkelos says

As the sun was setting, a deep sleep fell upon Avram; and behold, a dread of deep darkness fell upon him.

— the Targum Jerusalem reveals the four kingdoms; and that Edom is Rome

“And it was when the sun was going down to set, a deep and pleasant sleep fell upon Abram; and behold, Abram saw the four kingdoms that were destined to rise to enslave his children: Dread—which is Babylon; Darkness—which is Media; Great—which is Greece; Falling—which is the kingdom of Persia (Rome/Edom), which is destined to fall and shall have no rising again for ever and ever.”

13 And He said unto Abram, “Know of a surety that thy seed shall be a stranger in a land that is not theirs, and shall serve them; and they shall afflict them four hundred years. — thy seed shall be strangers; so they were in Canaan first and afterward in Egypt: before they were lords of their own land, they were strangers in a strange land;

— only by entering under Joshua 400 years later would the land be theirs, otherwise they were only strangers to the land;

— the Targum Onkelos says

And He [Adonoy] said to Avram: Know for sure that your descendants will be foreigners in a land that is not theirs. They will enslave them and oppress them [for] four hundred years.

14 And also that nation whom they shall serve will I judge, and afterward shall they come out with great substance. — that nation; had it been expressly revealed that the country that would afflict them was Egypt, the principal seat of their servitude, and the instrument of their sorest bondage;

— will I judge: that is, punish after judgement, which prediction was in due course fulfilled – and afterward shall they come out with great substance;

— the Targum Onkelos says

But also that nation whom they will serve I will judge; afterwards they will leave with great wealth.

15 And thou shalt go to thy fathers in peace; thou shalt be buried at a good old age. — and thou shall go to thy fathers in peace; or die, which is a going the way of all flesh;

— the Targum Onkelos says

You will join your fathers in peace; you will be buried at a good old age.

16 But in the fourth generation they shall come hither again, for the iniquity of the Amorites is not yet full.” — for the iniquity of the Amorite is not yet full; from this sentence we have much to learn:

— the Amorites in Amos 2:9, “whose height was like the height of the cedars, and he was strong as the oaks; yet I destroyed his fruit from above and his roots from beneath.” Perhaps like Hamas today;

— first; the Lord foreknows the moral character of people; second, in his providence he administers the affairs of nations on the principle of moral rectitude; third, nations are spared until their iniquity is full; fourth, they are then cut off in retributive justice in due time;

— the Targum Onkelos says

The fourth generation will return here, for the sin of the Emorites will not be complete until then [now].

17 And it came to pass that when the sun went down and it was dark, behold, a smoking furnace and a burning lamp passed between those pieces. — behold a smoking furnace; this signified the affliction of his seed in Egypt: they were there in the furnace of affliction, and labouring in the very fire;

— a burning lamp; this speaks comfort in this affliction: and this God showed Abram at the same time with the smoking furnace. The lamp indicates direction in the smoke; God’s word was their lamp, a light shining in a dark place; synifying, perhaps, that at the end, God did accept the sacrifices ultimately;

— the Targum Onkelos says

The sun set and it became very dark; and behold, a smoking furnace and a flaming torch had passed between these pieces.

— the Targum of Jonathan says

“And it came to pass, when the sun had set and there was darkness, behold, Abram saw Gehenna (Hell) emitting smoke and coals of fire, and kindling sparks of flame to judge the wicked within it; and behold, it passed between these divided pieces.”

18 On the same day the Lord made a covenant with Abram, saying, “Unto thy seed have I given this land, from the river of Egypt unto the great river, the River Euphrates:

— from the river of Egypt; the river of Egypt is the Nile, which overflowed annually and made the basin fruitful; so the Targum of Jonathan calls it the Nile of Egypt; it was rendered, “from the Nile of Mizraim” or Egypt to the great river, Euphrates;

— Keil and Delitzsch: the river (נהר) of Egypt is the Nile, and not the brook (נחל) of Egypt (Numbers 34:5); the character of the promise, the two large rivers, the Nile and the Euphrates, are mentioned as the boundaries within which the seed of Abram would possess the promised land,

— and from hence to the river Euphrates, the eastern boundary, was the utmost extent of it in which it was ever possessed, as it was in the times of David and Solomon, II Samuel 8:3;

— the Targum Onkelos says

On that day Adonoy made a covenant with Avram, saying: To your descendants I have given this land, from the river of Egypt as far as the great river, the Euphrates.

— the Targum of Jonathan specifically identifies the river as the Nile of Egypt

“On that day, the Lord made a covenant with Abram—[decreeing] not to judge his children in [Gehenna] and to redeem them from the [oppression of] kingdoms—saying: ‘To your children I give this land, from the Nile of Egypt unto the great river, the river Euphrates.'”

19 the Kenites and the Kenizzites and the Kadmonites, — the Kenites; thought to be the Idumeans, who sprung from Kenaz of Esau’s posterity; found among the Amalekites in the south (1 Samuel 15:6); note that Jethro, the father-in-law of Moses, was a Kenite (Judges 1:16); he was also the priest of Midian; and they dwelt among the Midianites; so they were very mixed by comparing Exodus 3:1 with Judges 1:16;

— the Kenizzites are also supposed by some to be the descendants of Kenaz, a grandson of Esau, Genesis 36:11; but then they must be so called here by anticipation, or  that is, the land they were anticipated to live there; since Kenaz was not then born; Caleb, the head of the tribe of Judah, was a Kenizzite, Numbers 32:12Joshua 14:6;

and from Deuteronomy 2:5:

Meddle not with them [the children of Esau, who dwell in Seir]; for I will not give you of their land, no, not so much as a foot breadth, because I have given Mount Seir unto Esau for a possession.

— the Kadmonites; elsewhere the Kadmonites are never mentioned again; probably dwellers on the eastern desert frontier of the Jordan, an eastern or an ancient people, of whom we know nothing;

— besides, none of the land of the children of Esau, at least of those that dwelt about Mount Seir (Deuteronomy 2:5) was to be given to the children of Israel; henced could the Edomites or Idumeans (at least a portion of them had left, some remained) have moved away while the children of Israel were in Egypt?

— the Targum Onkelos says

[The lands of] the Kenites [Shalmites], Kenizites, Kadmonites,

20 and the Hittites and the Perizzites and the Rephaim, — the Hittites, who had their name from Heth, a son of Canaan, see Genesis 10:15; they dwelt about Hebron, in the south of the land of Canaan:

— the Perizzites and the Rephaim; probably these are included in the common name of Canaanites, those that lived in the land of Canaan; 

— the Targum Onkelos says

The Chittites, Perizites, the Refa’im [the mighty ones],

21 and the Amorites and the Canaanites and the Girgashites and the Jebusites.” —  v16 above; “for the iniquity of the Amorites is not yet full” but soon it would be full, like Hamas today;

— the Jebusites; who inhabited Jerusalem and its surroundings, which was first called Jebus, from the founder of this nation;

— in this and the previous verses ten nations are reckoned as occupying the land of Canaan at that time, whereas only seven are mentioned in the times of Moses and Joshua; Deuteronomy 7:1Joshua 3:10;

— although the Lord made a covenant with Abram, saying, “Unto thy seed have I given this land, from the river of Egypt unto the great river, the River Euphrates,” that seed were meant to be the whole house of Israel. Hence, during the Exodus, Moses was tasked of bringing the children of Israel out of the land of Egypt, for “I have also established My covenant with them, to give them the land of Canaan, the land of their pilgrimage, wherein they were strangers” Exodus 6:4.

“When the Lord thy God shall bring thee into the land whither thou goest to possess it, and hath cast out many nations before thee — the Hittites, and the Girgashites, and the Amorites, and the Canaanites, and the Perizzites, and the Hivites, and the Jebusites, seven nations greater and mightier than thou” Deuteronomy 7:1

And Joshua said, “Hereby ye shall know that the living God is among you, and that He will without fail drive out from before you the Canaanites and the Hittites and the Hivites and the Perizzites and the Girgashites and the Amorites and the Jebusites” Joshua 3:10.

and from MSG

When the sun was down and it was dark, a smoking firepot and a flaming torch moved between the split carcasses. That’s when God made a covenant with Abram: “I’m giving this land to your children, from the Nile River in Egypt to the River Euphrates in Assyria—the country of the Kenites, Kenizzites, Kadmonites, Hittites, Perizzites, Rephaim, Amorites, Canaanites, Girgashites, and Jebusites.”

— and from another perspective, the reason is given in the Book of Jubilees:

And Ham and his sons went into the land which he was to occupy, which he acquired as his portion in the land of the south.

And Canaan saw the land of Lebanon to the river of Egypt that it was very good, and he went not into the land of his inheritance to the west (that is to) the sea,

and he dwelt in the land of Lebanon, eastward and westward from the border of Jordan and from the border of the sea.

And Ham, his father, and Cush and Mizraim, his brothers, said unto him: “Thou hast settled in a land which is not thine, and which did not fall to us by lot:

do not do so; for if thou dost do so, thou and thy sons will fall in the land and (be) accursed through sedition;

for by sedition ye have settled, and by sedition will thy children fall, and thou shalt be rooted out for ever.

Dwell not in the dwelling of Shem; for to Shem and to his sons did it come by their lot.

Cursed art thou, and cursed shalt thou be beyond all the sons of Noah, by the curse by which we bound ourselves by an oath in the presence of the holy judge, and in the presence of Noah our father.”

But he (Canaan) did not hearken unto them, and dwelt in the land of Lebanon from Hamath to the entering of Egypt, he and his sons until this day.
And for this reason that land is named Canaan. Book of Jubilees Chapter 10:40-48

— again, the commitment earlier by an oath; from the Book of Jubilees:

And thus the sons of Noah divided unto their sons in the presence of Noah their father, and he bound them all by an oath, imprecating a curse on every one that sought to seize the portion which had not fallen (to him) by his lot.

And they all said, “So be it; so be it,” for themselves and their sons for ever throughout their generations Book of Jubilees Chapter 9:18-19

~~~~

The Promised Land of Greater Israel, “Fear not, Abram. I am thy shield.”

— Deuteronomy 7:1Joshua 3:10; and these three – the Kenites and the Kenizzites and the Kadmonites- were not among them. Perhaps they were all from the children of Esau, a posterity of Shem (whereas the others are mostly posterity of Ham, and of Canaan), and during this time interval of over 400 years, they had already moved north and eventually settled in Spain and then westward onto the New World;

— note, too, that in the New World, several states of the United States (namely Texas, Arizona, New Mexico, Nevada, and Utah, Colorado, Wyoming and California) have the Spanish Mexicans settled there first, then later during the Mexican-American War from 1846 to 1848, the American zionists took over, which accounted for a loss of 55% of Mexico’s territory;

During the Mexican-American War, Mexico lost 55% of her Territory

— the Targum Onkelos says

The Emorites, Canaanites Girgashites and Yevusites.

— for a more indepth study of Esau or Edom, see Obadiah

Genesis 16

“The anger of the Lord shall not return, until He has executed and until He has performed the intent of His thought; in the latter days ye shall understand it perfectly” Jeremiah 23:20

1 Now Sarai, Abram’s wife, bore him no children; and she had a handmaid, an Egyptian, whose name was Hagar. —  the marriage of Hagar to Abram, who was his secondary wife; and though he may be excused, he cannot be justified; for from the beginning it was not so;

— the Targum Onkelos says

Avram’s wife Sarai had not borne him children. She had an Egyptian handmaid whose name was Hagar.

— the Targum of Jonathan reveals Hagar as a daughter [from a concubine] of Pharaoh

“And Sarai, the wife of Abram, had not borne children to him; and she had an Egyptian handmaid whose name was Hagar, the daughter of Pharaoh, whom he [Pharaoh] had given to her as a handmaid at the time that he had taken her [Sarai], and he was struck by a word from before the Lord.”

And Sarai said unto Abram, “Behold now, the Lord hath restrained me from bearing. I pray thee, go in unto my maid. It may be that I may obtain children by her.” And Abram hearkened to the voice of Sarai.

— Sarah, despairing of bearing a son herself, as she was now seventy-five, and had been ten years in Canaan, concluded that her heir was to be born of a substitute;

— the Targum Onkelos says

Sarai said to Avram: See now, Adonoy has restrained me from having children; pray [now], come to my handmaid perhaps I will be built-up through her. Avram hearkened to the voice of Sarai.

And Sarai, Abram’s wife, took Hagar her maid, the Egyptian, after Abram had dwelt ten years in the land of Canaan, and gave her to her husband Abram to be his wife. — after Abram had dwelt ten years in the land of Canaan; so that he was now eighty five years of age;

— the Targum Onkelos says

Sarai, the wife of Avram took Hagar the Egyptian, her handmaid, at the end of ten years that Avram had lived in the Land of Canaan and gave her to Avram her husband to be his wife.

And he went in unto Hagar, and she conceived. And when she saw that she had conceived, her mistress was despised in her eyes. — her mistress was despised in her eyes; thus began the ill consequences of Abram’s marriage to Hagar;

— the Targum Onkelos says

He came to Hagar and she conceived. When she realized that she was pregnant, her mistress became slighted in her eyes.

And Sarai said unto Abram, “My wrong be upon thee. I have given my maid into thy bosom; and when she saw that she had conceived, I was despised in her eyes. The Lord judge between me and thee.”

— my wrong be upon thee; that is, may the wrong done to me be avenged upon thee; Sarai’s act had been one of self-denial for Abram’s sake, and now that it has led to her being treated insolently she makes Abram answerable for it;

— the Targum Onkelos says

Sarai said to Avram: The insult against me is your fault [I have a judgment against you]. I gave my maid to you and when she saw that she had conceived, I became slighted in her eyes. Let Adonoy judge between me and you.

— the Targum of Jonathan reveals Sarai’s deep sense of betrayal but she didn’t acknowledged her role in asking Abram to lie with her maidservant Hagar; and that the Pharaoh was a son of Nimrod

“And Sarai said to Abram: ‘All my suffering is because of you! For I was confident that you would act with justice for me, as I left my land and my father’s house and came with you to a foreign land. And now, because I was not bearing children, I freed my handmaid and gave her into your embrace; but she saw that she had conceived, and my honor became despised in her sight.

And now, let my suffering be revealed before the Lord, and let Him spread His peace between me and you, and let the earth be filled from us, so that we shall not need the children of Hagar, the daughter of Pharaoh, the son of Nimrod—who cast you into the fiery furnace!'”

But Abram said unto Sarai, “Behold, thy maid is in thy hand. Do to her as it pleaseth thee.” And when Sarai dealt harshly with her, she fled from her face. — do to her as it pleaseth thee: not giving her liberty to take away her life, nor to use her cruelly,

— but to deal with her as a mistress might lawfully do with a servant, or however exercise that power which a first wife had over a second;

— the Targum Onkelos says

Avram said to Sarai: [The fate of] your maid is in your hands, do with her as you see fit. Sarai dealt harshly with her, and she [Hagar] ran away from her.

And the angel of the Lord found her by a fountain of water in the wilderness, by the fountain on the way to Shur. — by the fountain in the way to Shur; a place before or back to Egypt, from whence the wilderness had its name;

— the Targum Onkelos says

An angel of Adonoy found her by a spring of water in the desert, at the spring on the road to Shur [Chagar].

And he said, “Hagar, Sarai’s maid, whence camest thou? And whither wilt thou go?” And she said, “I flee from the face of my mistress Sarai.” — though she had became Abram’s wife, yet she was still Sarai’s maid;

— the Targum Onkelos says

And he said: Hagar, handmaid of Sarai, from where have you come and where are you going? She said: I am running away from my mistress, Sarai.

And the angel of the Lord said unto her, “Return to thy mistress, and submit thyself under her hands.” — the angel of the Lord interrogates her, and requires her to return to her mistress, and humble herself under her hands;

— the Targum Onkelos says

The angel of Adonoy said to her: Return to your mistress and submit yourself to her.

10 And the angel of the Lord said unto her, “I will multiply thy seed exceedingly, that it shall not be numbered for multitude.” — the Hagarenes, Saracens, and various other tribes of Arabs were descended from Ishmael, and they have been, and still are, a great multitude of people;

— the Targum Onkelos says

The angel of Adonoy said to her: I will greatly multiply your descendants that they can not be counted because of their great number.

11 And the angel of the Lord said unto her, “Behold, thou art with child, and shalt bear a son and shalt call his name Ishmael [that is, God shall hear], because the Lord hath heard thy affliction. — Ishmael; that is, God will hear; and the reason is, because the Lord hath heard;

— the Targum Onkelos says

The angel of Adonoy said to her: Behold you will conceive, and give birth to a son. You shall name him Yishmael, for Adonoy has heard [accepted] your prayer.

12 And he will be a wild man. His hand will be against every man, and every man’s hand against him; and he shall dwell in the presence of all his brethren.” — his hand will be against every man, and every man’s hand against him; signifying, that he would be of a quarrelsome temper and warlike disposition, continually engaged in fighting with his neighbours;

— and they with him in their own defence; and such the Arabs his posterity always have been, and still are, given to rapine and plunder, harassing their neighbours by continual excursions and robberies, and pillaging passengers of all nations, which they think they have a right to do;

— and he shall dwell in the presence of all his brethren; the sons of Abram by Keturah, the Midianites, and others; and the Edomites that sprung from Esau, the son of his brother Isaac; and the Israelites, the descendants of Jacob, another son of Isaac; and his kinsmen the Moabites and Ammonites, upon all which he and his posterity bordered;

— the Targum Onkelos says

He will be a wild, uncivilized man [rebel against people]. His hand [will be] against everyone [He will need everyone] and everyone’s hand will be against him [and everyone’s hand will need him]; and in the presence of all his brothers he will dwell.

— the Targum of Jonathan reveals his future relationship with his brothers

“And he will be like a wild ass among men; his hands will take vengeance of his adversaries, and the hands of his adversaries will be stretched out to do him evil; and he shall be mingled among all his brethren, and shall dwell [near them].”

13 And she called the name of the Lord who spoke unto her: “Thou God seest me.” For she said, “Have I also here looked upon Him that seeth me?” — looked after him that seeth me, that is, seen the face of my gracious God! That God should appear to me in my master’s house, that I should have such a favour;

— the Targum Onkelos says

She called [She prayed in] the Name Adonoy Who had spoken to her: [She said] You are Almighty Who sees [everything], for she said: Have I also seen here [a vestige] after my having seen? [Have I also began to see here [a vestige] after it was revealed to me?]

14 Therefore the well was called Beerlahairoi [that is, The well of Him that liveth and seeth me]. Behold, it is between Kadesh and Bered. — behold, it is between Kadesh and Bered; Kadesh is the same with Kadesh Barnea in the wilderness;

— the Targums of Onkelos and Jonathan call it Rekam, the same with Petra, the chief city of Arabia Petraea, near the wilderness of Kadesh, which in his times was inhabited by Saracens, inhabited in later times by the Nabathaeans, the posterity of Ishmael;

— the Targum Onkelos says

Therefore the well was called: Be’er Lachai Ro’i [the well at which a living angel appeared]; it is between Kadeish [Rekem] and Bared [Chagar].

15 And Hagar bore Abram a son; and Abram called his son’s name, whom Hagar bore, Ishmael. — and Abram called his son’s name, which Hagar bare, Ishmael;

— that Hagar upon her return reported to Abram the whole of the conversation she had with the angel; wherefore Abram believing what she said, in obedience to the order and command of the angel, gave him this name;

— the Targum Onkelos says

Hagar bore Avram a son and Avram named his son, that Hagar bore him, Yishmael.

16 And Abram was fourscore and six years old when Hagar bore Ishmael to Abram. — and Abram was eighty years old when Hagar bare Ishmael to Abram. Which is easily reckoned, for he was seventy five years of age when he left Haran, Genesis 12:4

— and he had been ten years in Canaan when Hagar was given him by Sarai for his wife, Genesis 16:3; and so must be then eighty five years of age, and of course must be eighty six when Ishmael was born;

— the Targum Onkelos says

Avram was eighty-six years old when Hagar bore Yishmael to Avram.

Iran’s Fattah 1 & II, Sejjil Missiles

•March 20, 2026 • Leave a Comment

President Donald Trump said he is ‘not afraid’ to deploy US ground troops within Iran, further emphasizing the lengths he is willing to go in his Middle East war.
Speaking from the Oval Office alongside Ireland’s Taoiseach, Micheal Martin, the President fielded many questions about the Iran war.
‘Are you afraid that if you put boots on the ground in Iran, it could be another Vietnam?’ one reporter asked.
‘No,’ Trump shot back, adding, ‘I’m not afraid of anything.’
Earlier, the President has also said that he would deploy ground troops if necessary.
But on other occasion, Trump had also said he wouldn’t send troops anywhere, leaving his on-off on-off behavior uncertain.

The Fattah-1

Unveiled in June 2023, the Fattah-1 (Persian: ’conqueror’) is an Iranian medium-range ballistic missile developed by the Islamic Revolutionary Guard Corps. Iran has described the missile as “hypersonic,” at Mach 13, a description which has been noted as “dubious” or “inspirational” by several media outlets including Calcalist, the Times of Israel and the Warzone.

But according to Iran, its high maneuverability and speed helps it to evade missile defense systems.

According to Iran, it can maneuver in and out of the atmosphere, and is capable of bypassing missile defenses. Iran describes it as a hypersonic missile.

However, according to Fabian Hinz, research fellow for Defense and Military Analysis at the International Institute for Strategic Studies, Fattah does not fall under the general classification of hypersonic weapons, but is rather a medium-range ballistic missile (MRBM) that has a “second stage incorporates the warhead, aerodynamic controls and a small solid-propellant motor with a moveable nozzle for thrust vector control (TVC) that resembles a maneuverable reentry vehicle (MaRV)” rather than a hypersonic glide vehicle, meaning it can only maneuver for a short part of the flight in the terminal phase.

Hinz noted that “Iran attempted to overcome this limitation by mating a small TVC rocket motor to a MaRV, enabling exo-atmospheric maneuvering.”

Arash Marzbanmehr, a pro-IRGC military analyst, has defined Fattah and Kheibar Shekan missiles as near-hypersonic or quasi-hypersonic missiles

The Fattah-2

In November 2023, Iran unveiled a newer version of the missile, the Fattah-2. With a payload of 200 kg on its warhead, a range of up to 1,500 kilometers, and can travel at speeds up to Mach 15, the new Fattah-2 is classified as a advanced ballistic missile, capable of targeting Israel from any corner of western Iran.

This range encompasses critical strategic targets throughout the Middle East, including Israeli military installations and US bases in the region.

The recent deployment of the Fattah 2 hypersonic missile in a live-fire strike against Israeli assets marks a terrifying milestone in modern warfare. This isn’t another rocket; it’s a big leap in technology. It has made virtually all Western air defense systems outdated overnight.

Not risking these Fattah-2 at Mach 15, the US aircraft carrier USS Abraham Lincoln had fled south from the Gulf of Oman into the Indian Ocean

Why Traditional Defense Fails Here?

The magic of the Fattah-2 lies not in its speed, but in its brain. Unlike the Fattah-1, which was a standard hypersonic glide vehicle, the Fattah-2 utilizes a second-generation Hypersonic Glide Vehicle (HGV).

The Flight Path: It doesn’t arc like a baseball. Instead, it comes off the booster and rides the upper atmosphere like a stone skipping across a pond.

Maneuverability: At Mach 15, it performs S-shaped turns. The Israeli Rafael VP confirmed an unconfortable fact: to intercept something so fast and changing direction, a defense system must react at about 30 times the speed of sound. Current tech doesn’t exist.

In the recent strikes, Iranian footage claimed that the missile dodged several interceptor rockets. Independent analysts also confirmed this before it hit its target. It’s not about being faster than the interceptor; it’s about being more unpredictable.

A Mach 15 missile is a strategic weapon for strategic assets (airbases, naval vessels, command centers). Currently there is no defence. At this hypersonic speed, US’s THAAD and Aegis systems could only lost their radar “eyes,” and these missiles launch from any points in Iran could decimate all Israel and US bases in Qatar (like Al Udeid), and the Fifth Fleet in Bahrain (NSA Bahrain).

Strategy: take out their radars first with these Fattah-2s. The most effective defense is radar from Thaad, but it travels only at Mach 8 and for predictable ballistic paths, not a missile with an erratic path at hypersonic speed. Once these radars are down, slower drones or other missiles with heavier payload could follow up for a devastating effect.

Sejjil Missiles

The Sejjil is an Iranian solid-fueled, medium-range ballistic missile (MRBM) with a range of up to 2,500 km and a payload capacity of around 700 kg, designed for rapid deployment and strategic deterrence.

First unveiled in 2008, the Sejjil marked Iran’s first operational missile to use a solid-fuel propulsion system, setting it apart from its liquid-fueled predecessors like the Shahab-3.

The development of the Sejjil demonstrates Iran’s growing domestic missile manufacturing capability, minimizing reliance on foreign technology sources. Its design suggests influences from both Chinese and North Korean missile technology, but it remains an indigenous product of Iran’s defense industry.

Capable of carrying a payload of approximately 700 kg—suitable for conventional or potentially nuclear warheads—the Sejjil plays a crucial role in Iran’s regional power projection and deterrence strategies.

Solid-fuel, long range > 2000 km: Iran fires the dancing Sejjil missile at Israel

Key Specifications of Sejjil

The Sejjil missile stands out due to its advanced technical features that mark a significant improvement over previous Iranian ballistic systems. One of its most notable characteristics is its two-stage solid-fuel propulsion system, which allows for faster preparation and launch compared to liquid-fueled missiles.

Such feature enables Iran to keep the missile launch-ready without the lengthy fueling processes required by earlier systems like the Shahab series.

Additionally, the Sejjil is reported to possess an impressive accuracy with a Circular Error Probable (CEP) of approximately 50 meters, making it a credible threat even against hardened military targets.

Anti-radar coatings and advanced guidance systems further enhance its ability to evade missile defense systems, positioning the Sejjil as one of the most formidable assets in Iran’s ballistic missile arsenal.

Iran first successfully tested the Sejjil-1 missile in 2008, showcasing its two-stage solid-fuel propulsion and confirming its potential operational range. A year later, the upgraded Sejjil-2 variant was unveiled and tested, featuring improvements in range, payload capacity, and guidance systems.

These tests demonstrated Iran’s growing expertise in solid-fuel rocket technology—a crucial step toward enhancing missile readiness and reducing launch preparation time.

Khorramshahr-4 (Kheibar): A liquid-fueled missile with a range of 2,000 km and a heavy 1,500 kg warhead. It is one of Iran’s most advanced strategic weapons.

US missiles

On the other side, the most powerful American missile is the Tomahawks (range: 1,550 mi; 2,500 km: say firing from Crete to anywhere in Iran). Each missile is estimated to cost more than $2 million depending on the variant.

Hundreds of Tomahawks hit Iranian radar installations, command centers, missile sites and naval facilities in Operation Epic Fury’s opening hours, yet the US builds only about 90 missiles per year (some reports say 150); and as the US fired ~400 Tomahawks in the first 72 hours (>10% inventory gone) in Iran, this conflict is now exposing the terrifying cracks in America’s defense industrial base.

Introduced in 1983, the Tomahawk is US’s long-range precision-guided cruise missile and cornerstone of its strike capability since the Cold War. Launched from Navy destroyers, cruisers, and submarines, it flies low at subsonic speeds of 570 mph with a typical 690 lb warhead striking hundreds of miles inland.

Total Stockpile: The US Navy typically maintains an inventory of roughly 3,500 to 4,000 Tomahawk missiles. Firing 400 missiles deplete approximately 10% to 12% of the entire global stockpile in just three day (and more than 850 Tomahawk cruise missiles in four weeks of war with Iran)

The US Navy fired roughly 400 Tomahawks in the first 72 hours alone wiping out more than 10% of its ready inventory and exceeding total production over the past five years. (And an estimated 850 by March 28, 2026; roughly a quarter of 3,800)

Building each new missile takes up to 24 months as Raytheon grapples with a fragile supply chain of single-source suppliers for solid rocket motors and precision electronics.

Inventory Depletion: With an estimated pre-war stockpile of ~3,800 TLAMs, the US has now expended roughly 17% to 19% of its total global inventory.

Since the conflict began on February 28, the destroyers escorting the Lincoln Carrier Strike Group (CSG-3) have fired an estimated 280 to 320 Tomahawks.

Restocking the depleted arsenal at current rates would take over four and a half years.

The rapid depletion gives Iran increased operational freedom while creating a dangerous window for China to potentially initiate a conflict with Taiwan before the US can rebuild stocks.

Priced at two to four million dollars per missile every launch represents a massive unsustainable cost that weakens US position for any larger conflict in the Indo-Pacific.

“Woe to the crown of pride, to the drunkards of Ephraim, whose glorious beauty is a fading flower, which is on the head of the fat valleys of them that are overcome with wine!” Isaiah 28:1

“The crown of pride, the drunkards of Ephraim, shall be trodden under feet” Isaiah 28:3

Genesis (13-14)

•March 19, 2026 • Leave a Comment

The Targum, which originated in the Aramaic language, is strongly linked to the work of Ezra, holds significance for shedding light on biblical concepts. When the Masoretic Text can be vague, uncertain, or unclear, the Targum often offers clearer meaning, broader insight, and deeper understanding.

Yes, sometimes the Targum clarifies metaphors and interprets idioms or difficult passages instead of translating them literally, which often makes no sense. Such an endeavor should be highly commended rather than criticized.

For example, the Targum interprets natural imagery—like cedars, cypresses, oaks, forests, and fire—as metaphors for political political and social structures, especially kings, rulers, governors, and wealthy elites. Such imagery can be sweeping: forests laid waste, lions roaring as their habitat is destroyed, and power structures crumbling. Fire symbolizes divine punishment, sweeping through defenses and dismantling the very foundations of their power.

Translating such natural imagery literally could convey limited information or even distort it, but Ezra was determined to share their true meaning. He was a righteous man, for God had prepared his heart to seek the law of the Lord, to follow it, and to teach the statutes and judgments in Israel Ezra 7:10.

“The anger of the Lord shall not return, until He has executed and until He has performed the intent of His thought; in the latter days ye shall understand it perfectly” Jeremiah 23:20

And Abraham built an altar to the Lord at a plave between Bethel and Ai, thereafter was called Mount Ephraim

Genesis 13

1 And Abram went up out of Egypt, he and his wife and all that he had, and Lot with him, into the south.

— ‘Get thee out from thy father’s house, and from thy country, and from thy kindred,’ was the command to Abram, and to most others called;

— and Lot with him; Lot accompanied him into Egypt, because he comes with him out of it; into the south; that is, into the Negev;

— the Targum Onkelos says

Avram went up from Egypt; he, his wife, and all that he had, together with Lot into the south.

And Abram was very rich in cattle, in silver, and in gold. — and Abram was very rich; he was rich; in cattle, in silver, and in gold; cattle are mentioned first, as being the principal part of the riches of men in those days, such as sheep and oxen;

— the Targum Onkelos says

Avram was very wealthy in livestock, silver and gold.

And he went on his journeys from the south even to Bethel, unto the place where his tent had been at the beginning, between Bethel and Ai, — he went on to Bethel; because there he had formerly had an altar, and although the altar had fallen down,

— between Bethel and Ai, or Hai; thereafter was called Mount Ephraim, and was four miles from Jerusalem on the north; see Genesis 12:8

— the Targum Onkelos says

He continued on his travels from the south to Beis-Eil, until the place where he originally had [set up] his tent, between Beis-Eil and Ai.

unto the place of the altar which he had made there at the first; and there Abram called on the name of the Lord. — unto the place of the altar, which he had made there at the first; when he first came to that place, and before he went down to Egypt;

— the Targum Onkelos says

To the site of the altar which he made there at first; and there Avram called [prayed] in the Name of Adonoy.

And Lot also, who went with Abram, had flocks and herds and tents. — Lot; he, too, had possibly received presents in Egypt, for we find him rivalling his uncle in wealth;

— the Targum Onkelos says

Lot who accompanied Avram also had sheep, cattle and tents.

And the land was not able to bear them, that they might dwell together; for their substance was great, so that they could not dwell together.

— both arises from a large increase of riches, that relations and friends are obliged to part; what one would think would make them more comfortable together, is the cause and occasion of their separation;

— the Targum Onkelos says

The land was unable to support them that they might dwell together, for their wealth was so great that they were unable to dwell together.

— the Targum of Jonathan reveals deails about the Canaanites and the Perizzites

And contentions arose between the shepherds of Abram’s flock, and the shepherds of the flocks of Lot; for the shepherds of Abram had been instructed by him not to go among the Kenaanaee and the Pherizaee, who, as yet, had power in the land, and to restrain the cattle that they should make no depredation in going to the place of their pasture: but the shepherds of Lot would go and feed in the grounds of the Kenaanaee and Pherizaee who yet dwelt in the land.

And there was strife between the herdsmen of Abram’s cattle and the herdsmen of Lot’s cattle; and the Canaanites and the Perizzites dwelled then in the land. — and there was a strife between the herdmen of Abram’s cattle and the herdmen of Lot’s cattle; not between the two masters, but between their servants;

— the Targum Onkelos says

There was a quarrel between the herdsmen of Avram’s flocks and the herdsmen of Lot’s flocks. The Canaanites and the Perizzites were then living in the land.

— the Targum of Jonathan says

And contentions arose between the shepherds of Abram’s flock, and the shepherds of the flocks of Lot; for the shepherds of Abram had been instructed by him not to go among the Kenaanaee and the Pherizaee, who, as yet, had power in the land, and to restrain the cattle that they should make no depredation in going to the place of their pasture: but the shepherds of Lot would go and feed in the grounds of the Kenaanaee and Pherizaee who yet dwelt in the land.

And Abram said unto Lot, “Let there be no strife, I pray thee, between me and thee and between my herdsmen and thy herdsmen; for we are brethren. — for we be brethren, that is, both by nature near kinsmen, as the word brother is oft used, and in the faith and religion too, amongst whom contentions are very indecent and scandalous;

— the Targum Onkelos says

Avram said to Lot: Please [Now], let there not be strife between me and you, and between my herdsmen and your herdsmen, for we are kinsmen.

Is not the whole land before thee? Separate thyself, I pray thee, from me. If thou wilt take the left hand, then I will go to the right, or if thou depart to the right hand, then I will go to the left.”

— the Targum Onkelos says

Is not all the land before you? Please [Now] separate from me, if [you go] to the left [north], I [will go] to the right [south], and if [you go] to the right [south], I [will go] to the left [north].

— the Targum of Jonathan says, “if thou wilt go to the north, I will go to the south, or if thou wilt go to the south, I will go to the north:’

10 And Lot lifted up his eyes and beheld all the plain of Jordan, that it was well watered everywhere (before the Lord destroyed Sodom and Gomorrah), even as the garden of the Lord, like the land of Egypt as thou comest unto Zoar.

— all the plain of Jordan; a great plain so called, because there the pleasant river Jordan divided itself into divers little streams or rivulets;

— the Targum Onkelos says

Lot raised his eyes and saw the entire Jordan Plain, that it was [an] abundantly watered [place]; before Adonoy destroyed Sedom and Amorah, it was like Adonoy’s garden, like the land of Egypt, going towards Zoar.

11 Then Lot chose for himself all the plain of Jordan; and Lot journeyed east, and they separated themselves the one from the other. — and Lot journeyed east; and that part of the land on which Sodom and Gomorrah stood, were to the east of Bethel;

— the Targum Onkelos says

Lot chose for himself the entire Jordan Plain; Lot journeyed from the east [before], and they separated one from another.

12 Abram dwelled in the land of Canaan, and Lot dwelled in the cities of the plain, and pitched his tent toward Sodom. — Abram dwelt in the land of Canaan; in that part of the land where the family of the Canaanites had their abode;

— the Targum Onkelos says

Avram lived in the land of Canaan; and Lot lived in the cities of the Plain, setting up his tents as far as Sedom.

13 But the men of Sodom were wicked and sinners before the Lord exceedingly. — the men of Sodom were wicked; exceeding great sinners, guilty of the most notorious crimes, and addicted to the most scandalous and unnatural lusts; and these they committed openly and publicly in the sight of God;

— the Targum Onkelos says

The people of Sedom were wicked [with their property] and sinful [with their bodies] towards [before] Adonoy, exceedingly.

14 And the Lord said unto Abram after Lot was separated from him, “Lift up now thine eyes, and look from the place where thou art, northward and southward and eastward and westward;

— the Targum Onkelos says

Adonoy said to Avram after Lot had separated from him: Raise your eyes and look about from the place where you are, to the north, to the south to the east and to the west.

15 for all the land which thou seest, to thee will I give it and to thy seed for ever. — on top of Mount Ephraim: all the land which thou seest; so extensive a survey of the country, in all directions,

— northward, and southward, and eastward, and westward; all point in the neighborhood; and those plains and hills, then lying desolate before the eyes of the solitary patriarch, were to be peopled with a mighty nation “like the dust of the earth in number”

— the Targum Onkelos says

For all the land that you see I give to you and to your descendants forever.

16 And I will make thy seed as the dust of the earth, so that if a man can number the dust of the earth, then shall thy seed also be numbered. — and to thy seed for ever; the meaning is, that he gave it to his posterity to be enjoyed; in the days of Solomon, and as they will be in the latter day;

— the Targum Onkelos says

I will make your descendants [numerous] as the dust of the earth; so that if a man can count the dust of the earth, then your descendants too will be countable [just as it is impossible for a man to count the dust of the earth, so too your descendants will not be countable].

17 Arise, walk through the land in the length of it and in the breadth of it, for I will give it unto thee.” — Arise, walk through the land; enter and take possession, for thy posterity; survey the land, and it will appear better than upon a distant prospect;

— the Targum Onkelos says

Rise, walk through the land—its length and breadth—for to you I will give it.

18 Then Abram removed his tent and came and dwelt in the plain of Mamre, which is in Hebron, and built there an altar unto the Lord. — the city Hebron was called Mamre; an ancient city built seven years before Zoan or Tanis in Egypt, Numbers 13:22

— the Targum Onkelos says

Avram set up his tent, and he came and settled in the Plains of Mamrei which are in Chevron, and he built there an altar to [before] Adonoy.

Hebron; an ancient city built seven years before Zoan or Tanis of Egypt

Genesis 14

1 And it came to pass in the days of Amraphel king of Shinar, Arioch king of Ellasar, Chedorlaomer king of Elam, and Tidal king of nations, — and it came to pass, in the days of Amraphel king of Shinar; or Babylon, as Onkelos, says, where Nimrod began his kingdom,

— the Targum Onkelos says

This happened in the days of Amraphel, king of Shinar [Babylon], Aryoch, king of Elasar, Kedorlaomer, king of Ailam, and Tidal, king of Goyim [king of peoples].

— the Targum of Jonathan reveals that Amraphel was Nimrod,

And it was in the days of Amraphel,–he is Nimrod, who commanded Abram to be cast into the furnace; he was then king of Pontos; Ariok, (so called) because he was (arik) tall among the giants, king of Thalasar, Kedarlaomer, (so called) because he had bound himself (or gone over) among the bondmen of the king of Elam, and Thidal, crafty as a fox, king of the peoples subjected to him,

that these made war with Bera king of Sodom, and with Birsha king of Gomorrah, Shinab king of Admah, and Shemeber king of Zeboiim, and the king of Bela, which is Zoar. — the cities Sodom and Gomorrah were well established by then; even after the confusion of tongues and that they had dispersed;

— the Targum Onkelos says

They waged war against Bera, king of Sedom, Birsha, king of Amorah, Shinav, king of Admah, Shemeiver, king of Tzevoyim, and the king of Bela, which is Zoar.

All these were joined together in the Vale of Siddim, which is the Salt Sea. — the Salt Sea; as afterwards so called, not at this time, but the Dead Sea, being 1300 feet below the level of the Mediterranean; for then it would not have been fit for armies to be drawn up in battle array in it;

— the Targum Onkelos says

All these joined together [assembled] at the valley of Siddim [the plain of the fields], which is [now] [the place of] the Salt Sea.

Twelve years they served Chedorlaomer, and in the thirteenth year they rebelled. — they served; that is, paid a yearly tribute in those days;

— the Targum Onkelos says

[For] twelve years they had served Kedorlaomer, and for thirteen years they rebelled.

And in the fourteenth year came Chedorlaomer and the kings that were with him, and smote the Rephaim in Ashteroth Karnaim, and the Zuzim in Ham, and the Emim in Shaveh Kiriathaim, — in the fourteenth year; after some pause and preparation, Chedorlaomer, in conjunction with his allies, set himself to punish the revolters;

— the Targum Onkelos says

In the fourteenth year, Kedorlaomer came together with the kings that were with him and they defeated the Rephaim [the mighty ones] in Ashteros Karnayim, the Zuzim [the powerful ones] in Ham, the Aimim [the ones that incite fear] at Shaveh Kiryasayim,

and the Horites in their Mount Seir, unto Elparan, which is by the wilderness. — the Horites were the aboriginal inhabitants of Mount Seir, where they dwelt in caves; such as are still to be seen in Petra and other places around; they were centuries later absorbed into the Edomites;

— the Targum Onkelos says

And the Chorites in their hills of Seir, as far as Eil [the Plain of] Paran which borders [is next to] the wilderness.

And they returned and came to Enmishpat, which is Kadesh, and smote all the country of the Amalekites and also the Amorites, who dwelt in Hazezontamar. — flashing forward, the country of the Amalekites; they were later inhabited by the posterity of Esau;

— the Targum Onkelos says

They turned back and came to Ein Mishpat [the plain of compromise] which is Kadeish [Rekem], and they struck all the territory of Amaleik, as well as the Emorites who lived in Chazazon Tamar [Ein Gedi].

And there went out the king of Sodom, and the king of Gomorrah, and the king of Admah, and the king of Zeboiim, and the king of Bela (the same is Zoar), and they joined battle with them in the Vale of Siddim, — five kings came out and joined battle with the four in the dale of Siddim;

— the Targum Onkelos says

The king of Sedom set out, along with the king of Amorah, the king of Admah, the king of Tzevoyim, and the king of Bela, which is Zoar, and engaged them in battle in the Valley of Siddim [in the plain of the fields].

against Chedorlaomer the king of Elam, and against Tidal king of nations, and Amraphel king of Shinar, and Arioch king of Ellasar — four kings against five.

— the Targum Onkelos says

Against Kedorlaomer, king of Eilam, Sidal, king of Goyim [king of peoples], Amraphel, king of Shinar [Babylon], and Aryoch, king of Elasar; [there were] four kings against the five.

10 And the Vale of Siddim was full of slime pits; and the kings of Sodom and Gomorrah fled and fell there, and those who remained fled to the mountain. — the five initiated the fight against the four but the vale of Siddim was full of slimepits, hence the four prevailed against the five;

— the Targum Onkelos says

The Valley of Siddim [The plain of the fields] was [full of] mortar pits [pits from which they raise up mortar]; [and when] the Kings of Sedom and Amorah fled they fell there [into the pits], while the remainder fled to the mountains.

11 And they took all the goods of Sodom and Gomorrah and all their victuals, and went their way. — and they took all the goods of Sodom and Gomorrah; they entered these cities and pillaged them, and carried off everything valuable in them;

— the Targum Onkelos says

They took [captured] all the wealth of Sedom and Amorah and all their provisions and they went on their way.

12 And they took Lot, Abram’s brother’s son, who dwelt in Sodom, and his goods and departed.

— the victors plundered the cities of Sodom and Gomorrah, and carried off Lot, who dwelt in Sodom, and all his possessions, along with the rest of the captives, probably taking the route through the valley of the Jordan up to Damascus;

— the Targum Onkelos says

They took [captured] Lot and his wealth. [Lot was] Avram’s nephew. Then they went on their way. He had been living in Sedom.

13 And there came one who had escaped, and told Abram the Hebrew, for he dwelt on the plain of Mamre the Amorite, brother of Eshcol and brother of Aner; and these were confederate with Abram.

— the plain of Mamre; these were confederate with Abram; probably there was also a league for mutual defence between him and them;

— the Targum Onkelos says

The one who had escaped came and told Avram the Ivri, who was living in the Plains of Mamrei the Emorite, the brother of Eshkol and Aneir. They were Avram’s allies.

— the Targum of Jonathan reveals the one who had escaped as Og, the King of Bashan (modern-day Golan Heights and Hauran), saying

“And Og came, who had been saved from the giants who died in the Flood; he had ridden upon the top of the Ark and had a covering over his head, and was sustained by the food of Noah. It was not because of his merit that he was saved, but so that the inhabitants of the world might see the power of the Lord and say: ‘Behold, the giants who were of old rebelled against the Master of the world, and He destroyed them from the earth.’

And when these kings [the four kings vs. the five] waged war, Og was with them. He said in his heart: ‘I will go and tell Abram about the matter of Lot who has been captured, so that he will come to rescue him from the hands of the kings and fall into their hands.’

He arrived on the eve of the day of Passover; he found him [Abram] making unleavened cakes (Matzot). Then he told Abram the Hebrew, and he was dwelling in the plains of Mamre the Amorite, brother of Eshkol and brother of Aner, and they were the masters of Abram’s covenant.”

— according to this tradition, Og was a remnant of the Nephilim (giants). He survived the Great Flood by clinging to the outside of Noah’s Ark. Noah fed him through a hole in the side of the boat. The text clarifies that God didn’t save him because he was a “good guy,” but as a living monument to show that even the mightiest rebels are subject to God’s will.

— in the biblical text, a “fugitive” tells Abraham that his nephew Lot was captured. The Midrash identifies this fugitive as Og. However, his intent was malicious: he hoped Abraham would rush into battle, be killed by the powerful Mesopotamian kings, and then Og could marry Abraham’s beautiful wife, Sarah.

14 And when Abram heard that his brother was taken captive, he armed his trained servants, born in his own house (three hundred and eighteen), and pursued them unto Dan. — and when Abram heard that his brother; regard Lot as his brother’s son, or at the same time his brother-in-law; or just brother;

— the Targum Onkelos says

When Avram heard that his kinsman was taken captive, he armed his trained servants [lads] who were born in his household, three hundred and eighteen [men], and he pursued [them] until Dan.

— the Targum of Jonathan says

And when Abram heard that his brother was made captive, he armed his young men who were trained for war, grown up in his house; but they willed not to go with him. And he chose from them Eliezer the son of Nimrod, who was equal in strength to all the three hundred and eighteen; and he pursued unto Dan.

Hebron, West Bank→Damascus, Syria 340 kilometers or 210 miles

15 And he divided himself against them, he and his servants by night, and smote them and pursued them unto Hobah, which is on the left hand of Damascus. — Hobah, on the left of Damascus, was over 200 miles toward the north from Hebron;

— the Targum Onkelos says

He divided [his men] against them at night, he and his servants and he attacked them. He pursued them until Chovah, which is to the left [north] of Damascus.

16 And he brought back all the goods, and also brought again his brother Lot and his goods, and the women also and the people. — he brought back all the goods which the victorious kings had taken from the princes and people mentioned earlier;

— the Targum Onkelos says

He brought back all the property. His kinsman [His brother’s son] Lot and his possessions he also brought back, as well as the women and the people.

17 And the king of Sodom went out to meet him at the Valley of Shaveh (which is the King’s Dale) after his return from the slaughter of Chedorlaomer and of the kings who were with him. — the king of Sodom, who had fled, came down from the mountain whither he had escaped, came down to meet Abram;

— the Targum Onkelos says

The King of Sedom went out to meet him after his return from defeating Kedorlaomer and the kings that were with him, to the Valley of Shaveh which is the King’s Valley [to the barren plain, which is the place of the racetrack of the king].

18 And Melchizedek king of Salem brought forth bread and wine; and he was the priest of the Most High God. — and Melchizedek king of Salem; both the Targums of Jonathan and Jerusalem say, this is Shem, the son of Noah;

— though it is highly probable Shem was living at this time, yet it is not easy to account for it why his name should be changed, or that he should reign in a country in the possession of his brother’s son; or that he should meet Abram, and congratulate him on the slaughter of one of his own descendants;

— some have thought him to be more than a mere man, even the Son of God himself, but he is manifestly distinguished from him in Hebrews 7:

“For this Melchizedek, king of Salem, priest of the Most High God, met Abraham, who was returning from the slaughter of the kings, and blessed him.

To him also Abraham gave a tenth part of all, Melchizedek first being by interpretation “king of righteousness,” and after that also king of Salem, which means “king of peace.”

Without father, without mother and without descent, having neither beginning of days nor end of life, but made like unto the Son of God, he abideth a priest continually.” Hebrews 7:1-3

— the Targum Onkelos says

Malki Zedek, king of Shaleim [Yerushalayim], brought out bread and wine. He was a Kohein of [He was serving before] the Most High Almighty.

— the Targum of Jonathan identifies the mysterious priest-king Melchizedek

And Malka Zadika, who was Shem bar Noah, the king of Yerushalem, came forth to meet Abram, and brought forth to him bread and wine; and in that time he ministered before Eloha Ilaha.

“And the righteous king—he is Shem, the son of Noah, the king of Jerusalem—went out to meet Abram and brought out to him bread and wine; at that time, he was ministering before God Most High.”

19 And he blessed him and said, “Blessed be Abram of the Most High God, possessor of heaven and earth; — and Melchizedek blessed Abram, which was one part of his office as a priest; and said, blessed be Abram of the most high God;

— the Targum Onkelos says

He blessed him and said: Blessed be Avram to the Most High, Almighty Possessor of heaven and earth.

20 and blessed be the Most High God, who hath delivered thine enemies into thy hand.” And he gave him tithes of all. — and he gave him tithes of all; not Melchizedek to Abram, but Abram to Melchizedek, and these tithes were given not out of the goods that were recovered;

— the Targum Onkelos says

And blessed be the Most High Almighty Who has delivered your enemies into your hand. [Avram] gave him a tenth of everything.

21 And the king of Sodom said unto Abram, “Give me the persons, and take the goods for thyself.”

— Grive me the persons; to this day it is the custom among the people there, that, if a camp be plundered, his own subjects that had been taken and carried away by the four kings, anyone who recovers the booty gives up only the persons, and takes the rest for himself;

— the Targum Onkelos says

The King of Sedom said to Avram: Give me the people, and take the possessions for yourself.

22 And Abram said to the king of Sodom, “I have lifted up mine hand unto the Lord, the Most High God, the possessor of heaven and earth, — I have lifted up my hand; this is a serious matter with Abram, either before, or then and there, he made an oath before God, that he would not touch the property of Sodom;

— the Targum Onkelos says

Avram said to the King of Sedom: I have lifted my hand [in prayer] to [before] Adonoy [before] the Most High Almighty, Possessor of heaven and earth.

23 that I will not take from a thread even to a shoe strap, and that I will not take any thing that is thine, lest thou shouldest say,‘I have made Abram rich’” — even to a shoelatchet; that is, from a thread used in sewing garments to, a shoelatchet, or the string which fastens the shoes to the foot,

— the Targum Onkelos says

Neither a thread nor a shoelace! And I will not take anything of yours, so you will not [be able] to say, I have made Avram wealthy.

24 except only that which the young men have eaten and the portion of the men who went with me: Aner, Eshcol, and Mamre; let them take their portion.” — the young men have eaten; his three hundred and eighteen trained servants, and those of his confederates;

— who having recovered the victuals taken away from the inhabitants of Sodom and Gomorrah, had eaten of it for their refreshment, as it was but just and right;

— the Targum Onkelos says

I am excluding myself; only what the lads have eaten, and the portion of the men who went with me, Aneir, Eshkol and Mamrei, they may take their portion.

Iran’s IRGC attack US “economic centres and banks”

•March 18, 2026 • Leave a Comment

“We’re a bunch of fools,” University of Chicago Professor John Mearsheimer said.

An American political scientist in the social network X directly stated that the authorities of his country are absolutely incompetent.

“We are not defeating Iran. We are not winning. What is our message? We’re sending a signal that we’re a bunch of fools. That we started a war that we can’t win.

“We had no goals, no clear objectives, we did not have the necessary armed forces to achieve any goals, we did not even have a clear plan! The question you have to ask yourself is: “What does all this mean to the Chinese and what does it mean to the Russians?

“And this tells them about our incompetence. Of course, the Russians have dealt with Steve Witkoff and Jared Kushner often enough to fully understand how incompetent we are.”

~~~~

Iran’s Islamic Revolutionary Guard Corps (IRGC) has threatened to attack “economic centres and banks” related to US and Israeli entities in the region after an overnight attack on an Iranian bank, Bank Sepah, in Tehran, a financial institution reportedly connected to the country’s military establishment.

Immediately, Citibank has asked its employees to vacate its longtime regional headquarters in Dubai’s International Financial Center. Standard Chartered reissued its work-from-home advisory on Wednesday after first introducing it last week. Meanwhile, in neighbouring Qatar, HSBC temporarily shut down all three of its bank branches.

US Company, Microsoft, Office Building in Herzliya, near Tel Aviv, Israel

Economic centers named by the IRGC include companies such as Google, Microsoft, Palantir, IBM, Nvidia and Oracle, and the listed offices and infrastructure for cloud-based services located in multiple Israeli cities and the Gulf countries.

IRGC further warned that “people of the region should not be within a one-kilometre radius of banks, financial institutions, and other major economic centres.” Civilians should keep their distance from these locations because they could become the focus of future bombing operations.

“Stay at least one kilometer away from these locations,” the IRGC warned, referring to banks and economic hubs allegedly tied to the US and Israel. For residents across the Middle East, the warning has added a new layer of uncertainty as the standoff between Iran and Western powers continues to intensify.

In response, President Trump delivered a blunt message to the Iranian regime. “If Iran wants to fight, that will be the official end of Iran,” he said in a warning directed at Iranian leaders.

In view of our current turmoil in many cities, especially in the UK, the US and many Western cities, here’s a endtime Prophecy for reflection:

And to the others He said in mine hearing, “Go ye after him through the city and smite. Let not your eye spare, neither have ye pity.
Slay utterly old and young, both maids and little children and women; but come not near any man upon whom is the mark; and begin at My sanctuary.” Then they began with the elder men who were before the house.
And He said unto them, “Defile the house, and fill the courts with the slain. Go ye forth.” And they went forth and slew in the city.
 Ezekiel 9:5-7