What are the Oracles of God? (Part II)

•August 4, 2021 • 1 Comment
What are the components of the Oracles?

What are the Oracles of God? (Part II)

One minister says “the Bible doesn’t require extra-biblical interpretation and support.”

Is this true? Is it true we don’t need any extra-biblical interpretation to understand the true meaning of the Scriptures?

This is an unorthodox approach to studying the Oracles of God. But first, we ask what are the components of the Oracles?

For a change, we will start by reading just a portion of a chapter in the Bible that we are all familiar with  — Genesis 1 (21st Century King James Version).

And we’ll try to read it without the vowels. It’s possible, let’s try:

Gnss 1:1-10 (21st Cntry Kng Jms Vrsn)
n th bgnnng Gd crtd th hvn nd th rth.
nd th rth ws wtht frm nd vd, nd drknss ws pn th fc f th dp. nd th Sprt
~ f Gd mvd pn th fc f th wtrs.
nd Gd sd, “Lt thr b lght”; nd thr ws lght.
nd Gd sw th lght, tht t ws gd; nd Gd dvdd th lght frm th drknss.
nd Gd clld th lght Dy, nd th drknss H clld Nght. nd th vnng nd th
~ mrnng wr th frst dy.
nd Gd sd, “Lt thr b frmmnt n th mdst f th wtrs, nd lt t dvd th wtrs frm
~ th wtrs.”
nd Gd md th frmmnt, nd dvdd th wtrs whch wr ndr th frmmnt frm th
~ wtrs whch wr bv th frmmnt; nd t ws s.
nd Gd clld th frmmnt Hvn. nd th vnng nd th mrnng wr th scnd dy.
nd Gd sd, “Lt th wtrs ndr th hvn b gthrd tgthr nt n plc, nd lt th dry lnd
~ ppr”; nd t ws s.
nd Gd clld th dry lnd rth; nd th gthrng tgthr f th wtrs clld H Ss; nd Gd
~ sw tht t ws gd.

In the beginning of God’s creation of the heavens and the earth.
בְּרֵאשִׁ֖ית בָּרָ֣א אֱלֹהִ֑ים אֵ֥ת הַשָּׁמַ֖יִם וְאֵ֥ת הָאָֽרֶץ:
Hebrew text with vowels
בראשית ברא אלהים את השמים ואת הארץ
Hebrew text without vowels

Below is the same Genesis 1:1-10 — without vowels, without spaces and punctuations.

nthbgnnngGdcrtdthhvnndthrth
ndthrthwswthtfrmndvdnddrknsswspnthfcfthdpndthSprtfGdmvdpnthfc
~fthwtrs
ndGdsdLtthrblghtndthrwslght
ndGdswthlghtthttwsgdndGddvddthlghtfrmthdrknss
ndGdclldthlghtDyndthdrknssHclldNghtndthvnngndthmrnngwrthfrstdy
ndGdsdLtthrbfrmmntnthmdstfthwtrsndlttdvdthwtrsfrmthwtrs
ndGdmdthfrmmntnddvddthwtrswhchwrndrthfrmmntfrmthwtrswhchw
~rbvthfrmmntndtwss
ndGdclldthfrmmntHvnndthvnngndthmrnngwrthscnddy
ndGdsdLtthwtrsndrthhvnbgthrdtgthrntnplcndltthdrylndpprndtwss
ndGdclldthdrylndrthndthgthrngtgthrfthwtrsclldHSsndGdswthttwsgd

Below is the same Genesis 1:1-10 — without vowels, spaces, punctuations, or capitalization.

nthbgnnnggdcrtdthhvnndthrth
ndthrthwswthtfrmndvdnddrknsswspnthfcfthdpndthsprtfgdmvdpnthf
~cfthwtrs
ndgdsdltthrblghtndthrwslght
ndgdswthlghtthttwsgdndgddvddthlghtfrmthdrknss
ndgdclldthlghtdyndthdrknsshclldnghtndthvnngndthmrnngwrthfrstdy
ndgdsdltthrbfrmmntnthmdstfthwtrsndlttdvdthwtrsfrmthwtrs
ndgdmdthfrmmntnddvddthwtrswhchwrndrthfrmmntfrmthwtrswhchw
~rbvthfrmmntndtwss
ndgdclldthfrmmnthvnndthvnngndthmrnngwrthscnddy
ndgdsdltthwtrsndrthhvnbgthrdtgthrntnplcndltthdrylndpprndtwss
ndgdclldthdrylndrthndthgthrngtgthrfthwtrsclldhssndgdswthttwsgd

DREAM ABOUT THE WORD OF GOD (BIBLE) - Evangelist Joshua Orekhie
“For there shall arise false christs and false prophets and shall show great signs and wonders, insomuch that, if it were possible, they shall deceive the very elect” Matthew 24:24

Below is the same Genesis 1:1-10. And this is how Moses wrote the Torah — without vowels, spaces, punctuations, capitalization nor paragraph breaks.

nthbgnnnggdcrtdthhvnndthrthdthrthwswthtfrmndvdnddrknsswspnthfcfthdp
ndthsprtfgdmvdpnthfcfthwtrsndgdsdltthrblghtndthrwslghtndgdswthlghtthtt
wsgdndgddvddthlghtfrmthdrknssndgdclldthlghtdyndthdrknsshclldnghtndth
vnngndthmrnngwrthfrstdyndgdsdltthrbfrmmntnthmdstfthwtrsndlttdvdthwtr
sfrmthwtrsndgdmdthfrmmntnddvddthwtrswhchwrndrthfrmmntfrmthwtrswh
chwrbvthfrmmntndtwssndgdclldthfrmmnthvnndthvnngndthmrnngwrthscnd
dyndgdsdltthwtrsndrthhvnbgthrdtgthrntnplcndltthdrylndpprndtwssndgdclld
thdrylndrthndthgthrngtgthrfthwtrsclldhssndgdswthttwsgd

So when it is written that Moses wrote all the words of the LORD as stated in Exodus 24:4, his written texts (except of course, he wrote from right to left in paleo Hebrew scripts instead of the modern ‘square’ alphabets) were only making sense to himself, but to an outsider, they were just unreadable.  [Note: this Bible study is greatly simplified as cantillation and other numerous peculiar details of the Sacred Text are not discussed here]

For well over two thousand years until the appearance of the Aleppo Codex in the tenth Century, scribes, priests and Levites with the Scriptures would have to memorise where the vowels and other punctuations were located so that the Scriptures would make sense to those who hear them.

The vast majority, which would exceed 99.99 percent of today’s professing Christianity, make this fundamental error. This porous foundation differs greatly from the original Nazarenes where they understood what the Oracles as given to the Jews (Romans 3:1-4) would mean. Unless trained in Judaism, they wouldn’t be able to read the Sacred Text, which only had consonants written. This means our modern version of Christianity is basically built on sands, loose sands.

The written Torah, when originally written, were just the consonants but the Oral Knowledge were memorised. Torah means instructions, teachings and knowledge, and these accumulated knowledge is known as the Oral Law and is not necessarily the legalistic concept of law we know today.

What does this “nthbgnnnggdcrtdthhvnndthrth” mean? A learned scribe would know it was “In the beginning God created the heaven and the earth” by adding his Oral Torah to make the meaning clear. Thus when the Aleppo Codex was written in the tenth century, vowels were embedded. For the Hebrew Sacred text to be readable by the common people, it also means that the Oral Law were intrinsically embedded into the Written Torah.

Many hundred years later, in 1611, the English King James version of the Bible arrived. And like it or not, it had similarly incorporated the Oral Torah with the written Torah. For the churches to say that our Scriptures are the written Word of God and we don’t need the Oral Torah is just misguided, deceived. And being puffed up and deceived they go about deceiving others. 

“For I know this: that after my departing shall grievous wolves enter in among you, not sparing the flock” Acts 20:29.

The first Church after the apostolic age was the Roman Catholics and they are the most populous today. Others in the West, many sprang from the British Isles or the United States. Such deceptions are so deeply embedded and entrenched that this truth would sound strange, unorthodox and foreign.

What are the Oracles of God? (Part I)

“Ephraim compasseth me about with lies, and the house of Israel with deceit” Hosea 11:12 

Manasseh, Ephraim; and Ephraim, Manasseh; and they together shall be against Judah. For all this His anger is not turned away, but His hand is stretched out still” Isaiah 9:21

The US Empire is in Terminal Decline

•August 2, 2021 • 1 Comment

Chris Hedges: The return of the Taliban to power in Afghanistan will be one more signpost of the end of the American empire

RT / 26 Jul, 2021

The US empire is in terminal decline, and heading for a dystopian future. Yet no-one – not the generals, the politicians or the fawning MSM – will be held accountable for all the military follies that herald its imminent collapse.

The debacle in Afghanistan, which will unravel into chaos with lightning speed over the next few weeks and ensure the return of the Taliban to power, is one more signpost of the end of the American empire.

The two decades of combat, the one trillion dollars we spent, the 100,000 troops deployed to subdue Afghanistan, the high-tech gadgets, artificial intelligence, cyberwarfare, Reaper drones armed with Hellfire missiles and GBU-30 bombs, and the Global Hawk drones with high-resolution cameras, Special Operations Command composed of elite rangers, SEALs and air commandos, black sites, torture, electronic surveillance, satellites, attack aircraft, mercenary armies, infusions of millions of dollars to buy off and bribe the local elites and train an Afghan army of 350,000 that has never exhibited the will to fight, failed to defeat a guerrilla army of 60,000 that funded itself through opium production and extortion in one of the poorest countries on Earth.

Chris Hedges: The return of the Taliban to power in Afghanistan will be one more signpost of the end of the American empire

Like any empire in terminal decay, no one will be held accountable for the debacle, or for the other debacles in Iraq, Syria, Libya, Somalia, Yemen, or anywhere else. Not the generals. Not the politicians. Not the CIA and intelligence agencies. Not the diplomats. Not the obsequious courtiers in the press who serve as cheerleaders for war. Not the compliant academics and area specialists. Not the defense industry.

Empires at the end are collective suicide machines. The military in late empire becomes unmanageable, unaccountable, and endlessly self-perpetuating, no matter how many fiascos, blunders, and defeats it visits upon the carcass of the nation, or how much money it plunders, impoverishing the citizenry and leaving governing institutions and the physical infrastructure decayed.

Bloomberg’s America’s Worsening Homeless Crisis

The human tragedy – at least 801,000 people have been killed by direct war violence in Iraq, Afghanistan, Syria, Yemen, and Pakistan, and 37 million have been displaced in and from Afghanistan, Iraq, Pakistan, Yemen, Somalia, the Philippines, Libya, and Syria, according to the Watson Institute at Brown University – is reduced to a neglected footnote.

The 10 MOST HOMELESS CITIES in AMERICA

Nearly all the roughly 70 empires during the last four thousand years, including the Greek, Roman, Chinese, Ottoman, Habsburg, imperial German, imperial Japanese, British, French, Dutch, Portuguese, and Soviet empires, collapsed in the same orgy of military folly. The Roman Republic, at its height, only lasted two centuries. We are set to disintegrate in roughly the same time. This is why, at the start of World War I in Germany, Karl Liebknecht called the German military, which imprisoned and later assassinated him, “the enemy from within.”

HOMELESS IN SAN FRANCISCO

Mark Twain, who was a fierce opponent of the efforts to plant the seeds of empire in Cuba, the Philippines, Guam, Hawaii, and Puerto Rico, wrote an imagined history of America in the twentieth century in which its “lust for conquest” had destroyed “the Great Republic … [because] trampling upon the helpless abroad had taught her, by a natural process, to endure with apathy the like at home; multitudes who had applauded the crushing of other people’s liberties, lived to suffer for their mistake.” 

NEW YORK is DEAD

Twain knew that foreign occupations, designed to enrich the ruling elites, use occupied populations as laboratory rats to perfect techniques of control that soon migrate back to the homeland. It was the brutal colonial policing practices in the Philippines, which included a vast spy network along with routine beatings, torture, and executions, which became the model for centralized domestic policing and intelligence gathering in the United States. Israeli’s arms, surveillance and drone industries test their products on the Palestinians.

And I will destroy your high places, and cut down your images, and cast your carcasses upon the carcasses of your idols; and My soul shall abhor you. And I will make your cities waste and bring your sanctuaries unto desolation, and I will not smell the savor of your sweet odors. Leviticus 26:30-31

It is one of the dark ironies that it was the American empire, led by Jimmy Carter’s National Security Advisor Zbigniew Brzezinski, which spawned the mess in Afghanistan. Brzezinski oversaw a multibillion-dollar CIA covert operation to arm, train, and equip the Taliban to fight the Soviets. This clandestine effort sidelined the secular, democratic opposition and assured the ascendancy of the Taliban in Afghanistan, along with the spread of its radical Islam into Soviet Central Asia, once Soviet forces withdrew.

New York’s Homeless Epidemic 

The American empire would, years later, find itself desperately trying to destroy its own creation. In April 2017, in a classic example of this kind of absurd blowback, the United States dropped the “mother of all bombs” – the most powerful conventional bomb in the American arsenal – on an Islamic State cave complex in Afghanistan that the CIA had invested millions in building and fortifying.

And upon them that are left alive of you, I will send a faintness into their hearts in the lands of their enemies; and the sound of a shaken leaf shall chase them; and they shall flee as fleeing from a sword, and they shall fall when none pursueth. And they shall fall one upon another, as it were before a sword, when none pursueth; and ye shall have no power to stand before your enemies. And ye shall perish among the heathen, and the land of your enemies shall eat you up. And they that are left of you shall pine away in their iniquity in your enemies’ lands; and also in the iniquities of their fathers shall they pine away with them. Leviticus 26:36-39

Bad News for those Vaccinated!

•August 1, 2021 • Leave a Comment

Bad news for the vaxxed: The official vaccine narrative IMPLODING: CDC warns that virus is evading the vaccines; masks and quarantines now required for all

Natural News / July 29, 2021 / Lance D Johnson

For months, public health authorities told citizens that “life would not go back to normal” unless 90 percent of the population was vaccinated with experimental spike protein mRNA programs. Lockdowns were used to force people to comply with vaccine mandates.

Celebrities and politicians were recruited to promote the shots on social media as the vaccine-injured were censored. Vaccine lotteries and junk food freebies were handed out to the vaccinated. Illegal employer mandates are being used as threats and intimidation.

The Biden regime promised “100 days of masking” to end covid-19 once and for all, and they even bastardized “Independence Day” by telling Americans they won’t have their freedoms back until they collectively comply with a national 70 percent vaccination rate.

Image: Bad news for the vaxxed: The official vaccine narrative IMPLODING: CDC warns that virus is evading the vaccines; masks and quarantines now required for all

But after all the terror, bribery, segregation, intimidation, and abuse, the vaccinated are getting some very bad news.

Ken Dilanian for NBC News is shocking American viewers with “new data” on the failure of the mass covid-19 vaccination program. “New data suggests that fully vaccinated individuals are not just contracting COVID, but could be carrying higher levels of virus than previously understood, facilitating spread,” he reported.

The report was confirmed by Dr. Leana Wen, who appeared on CNN to call for universal indoor masking for the vaccinated and even declared that quarantines should be used on the vaccinated when they are exposed to another sick vaccinated person. Even the propaganda-pushing Andersen Cooper was bewildered by the new guidance. The CDC is currently promoting mask mandates for the unvaccinated, as the failure of the vaccines is openly admitted through policy.

CDC director warns that virus is evading the vaccines

CDC Director Walensky went on Fox News and implied that more doses of vaccine will be needed in order to keep people “fully vaccinated.” She warned about the failure of the vaccine program: “The largest concern that I think we in public health and science are worried about, is that virus and the potential mutations away, we are from a very transmissible virus that has the potential to evade our vaccine in terms of how it protects us from severe disease and death.”

This waning immunity is not new; it was demonstrated in the clinical studies that were originally ignored by the regulatory agencies. This waning immunity is already occurring in some of the most vaccinated countries, like Israel and Singapore. The vaccinated are coming down with sickness and are being hospitalized at a growing rate, as their so-called “immunity” wanes in less than six months.

While it’s no longer called “covid” for the vaccinated, they are coming down with sickness nonetheless. Israel has even demoted Pfizer’s vaccine effectiveness to an abysmal 39 percent. Whatever that means? The UK chief science advisor admits that 60% of people admitted to UK hospitals are “fully vaccinated.” In Singapore, 75 percent of new covid infections are from the vaccinated. In the US, cases in the vaccinated are so high, the CDC had to commit medical fraud by lowering the cycle threshold on the PCR test kits to artificially lower covid positives for the vaccinated.

And now the Center for Disease Control wants to push more mask mandates for the vaccinated, as the vaccinated become the “super spreaders” they once mocked. Not only are the vaccinated shedding spike protein bioweapons from their own cells, but they have also weakened their bodies with further inflammation from those spike proteins, making them more susceptible to coronavirus variants. Even worse, the vaccinated have become the vector for which coronaviruses mutate and spread.

Meanwhile, the vilified and socially ostracized (the unvaccinated) enjoy natural immunity or may soon have natural immunity that is proven to be 40 times more durable at preventing hospitalizations in Israel. What’s more, science shows natural immunity provides persisting antibody levels, including robust memory B and T cell immunity.

“Ephraim compasseth me with lies, and the house of Israel with deceit” (Hosea 11:12).

CNN Fake News

Biden LIES about surge in COVID-19 deaths

Image: It is mathematically impossible for covid vaccines to achieve anything useful for the population

It is mathematically impossible for covid vaccines to achieve anything useful / July 28, 2021 / Lance D Johnson

It’s bad enough that these vaccine efficacy studies use diagnostic fraud, but the studies are also grossly inadequate because they only aim to prove that the vaccine reduces the number of symptomatic cases of covid-19 in a given cohort of people. The studies do not in any way prove that the vaccine prevents SARS-CoV-2 infection, transmission, hospitalization, death or even less severe symptoms. 

A majority of vaccinated test subjects experience fever, chills, headaches and pain that requires further medical intervention. Because covid vaccines deliberately cause symptomatic illness, its insane to think they could achieve anything useful for science and health.

Yale doctor calls out CDC for committing large scale medical fraud and hiding covid cases among the vaccinated / July 23, 2021 / Lance D Johnson

(Natural News) The Centers for Disease Control (CDC) is engaged in one of the greatest medical frauds of our time, using disparate PCR cycle thresholds to artificially inflate covid-19 cases in the unvaccinated, while hiding covid cases in the fully vaccinated. This covid-19 testing fraud continues to obfuscate the American medical response, as the original aerosolized bioweapon evades detection, as the ongoing release of that spike protein continues through the “savior” vaccines.

In a recent interview with Fox News’ Laura Ingraham, Dr. Harvey Risch of the Yale School of Medicine called out the CDC for committing wide-scale medical fraud. When the covid-19 vaccines were launched under emergency authorization, the CDC changed the covid-19 testing guidelines for the fully vaccinated, lowering the cycle threshold count of the PCR test ONLY for the vaccinated.

Israel’s health ministry has found that 40 percent of new covid cases are in the vaccinated, while less than 1 percent of new cases are from people who were previously infected. People who recovered from a natural infection have immunity that is 40 times more durable at preventing hospitalization from future variants. In the UK, Sir Patrick Vallance said the vaccinated patients makeup 40-60 percent of new covid cases, proving the vaccines are an abysmal failure at preventing serious illness in the real world.

The Lord shall smite thee with madness, and blindness, and astonishment of heart; and thou shalt grope at noonday, as the blind gropeth in darkness, and thou shalt not prosper in thy ways. And thou shalt be only oppressed and despoiled evermore, and no man shall save thee. Deuteronomy 28:28-29.

A thousand shall fall at thy side, and ten thousand at thy right hand, Psalm 91:7

Why NIH’s Gain-of-Function Research at Wuhan?

•July 31, 2021 • Leave a Comment

Republicans argue Fauci emails show NIH funded gain-of-function research at Wuhan lab

Washington Examiner / Sarah Westwood / July 29, 2021

Five Republican senators are questioning why the Department of Health and Human Services redacted a portion of an email between Dr Anthony Fauci and Peter Daszak, the president of a research organization that worked with the Wuhan Institute of Virology on coronavirus studies before the pandemic.

Their inquiry is the latest attempt from the group to get public health agencies to turn over documents related to the way pandemic policies have been set behind the scenes.

Earlier this month, Sen. Rand Paul requested Attorney General Merrick Garland to start a criminal investigation of Fauci over his Senate testimony, during which he said the National Institutes of Health never funded gain-of-function research at the Wuhan lab. The Kentucky Republican says that is a lie, while Fauci insists the NIH grants did not fund gain-of-function research.

Dr Fauci pointing
Dr Fauci should have been led away in handcuffs long ago but he’s still there, holding the most important office. It shows how paralyzed and corrupt the System is, especially the Department of Justice. Already sedated? If so, by whom?

Rep. Jim Jordan of Ohio, the ranking member on the House Judiciary Committee, and Rep. James Comer of Kentucky, the top GOP member on the House Oversight Committee, sent a letter to Fauci this week, noting he hadn’t responded to a similar June letter from them about testimony in May and arguing that his July testimony only raised more questions. Jordan and Comer said, “New emails make this recurring testimony even more concerning and show a closer relationship between NIAID and the WIV than previously known.”

The one exception, according to the Republican lawmakers, was the email between Fauci and Daszak, which had been unredacted. The senators said it appeared HHS “may have forgotten” to redact the portion of the email that was previously hidden under the law enforcement standard.

“It’s been a very hard few months as these conspiracy theorists have gradually become politicized and hardened in their stance,” Daszak wrote to Fauci and others in the unredacted version of the email.

“Especially because the work we’ve been doing in collaboration with Chinese virologists has given us incredible insight into the risks that these viruses represent, so that we can directly help protect our nation from bat-origin coronaviruses,” Daszak continued. “We’re fighting to keep the communications open with our Chinese colleagues, so that we can better address future pandemics like COVID-19.”

The CDC and NIAID entered into trade among States (including, but not limited to working with University of North Carolina, Chapel Hill) and with foreign nations (specifically, the Wuhan Institute of Virology and the Chinese Academy of Sciences represented by Zhengli Shi) through U19AI109761 (Ralph S. Baric), U19AI107810 (Ralph S. Baric), and National Natural Science Foundation of China Award 81290341 (Zhengli Shi) et al. 2015-2016. These projects took place during a time when the work being performed was prohibited by the United States National Institutes of Health.

The public was clearly advised of the dangers being presented by NIAID-funded research by 2015 and 2016 when the Wuhan Institute of Virology material was being manipulated at UNC in Ralph Baric’s lab.

Jordan and Comer contended that the NIAID “funded gain-of-function research at the WIV and this research did not go through the proper oversight.” They told Fauci that “it is unclear why you would continue to testify otherwise.” They pointed to recently released emails to make their case.

Ralph Baric and his team @Baric_Lab – Researching #SARSCoV2, SARS-CoV, MERS-CoV, Dengue, Zika, and human norovirus at the University of North Carolina, Chapel Hill

The Republicans cited a Feb. 1, 2020, email from Fauci to the deputy director of the NIAID, Dr Hugh Auchincloss, which included an attached research article published in 2015 in Nature Medicine titled “A SARS-like cluster of circulating bat coronavirus shows potential for human emergence” that was “primarily authored” by Dr Ralph Baric of the University of North Carolina at Chapel Hill and Wuhan lab “bat lady” Dr Zhengli Shi, with the paper acknowledging the Key Laboratory of Special Pathogens and Biosafety at the Wuhan Institute of Virology.

Jordan and Comer noted that “the paper was funded by NIAID grant U19AI107810” and that both “Baric and Shi acknowledge this.”

Study: New Mutation Sped Up Spread of Coronavirus

“I have seen a horrible thing in the house of Israel; there is the whoredom of Ephraim, Israel is defiled” Hosea 6:10

COVID-19 TRAIL OF BLOOD!

•July 30, 2021 • Leave a Comment

“I have seen a horrible thing in the house of Israel; there is the whoredom of Ephraim, Israel is defiled” Hosea 6:10

There was a murder, and upon an initial investigation, there was a trail of blood . . . and they all lead to high places!

“A can of worms,” someone says, “better not to open such can.”

Dr David Martin, CEO of M-CAM International (risk management) has reviewed 4,000 Coronavirus patents. He appeared on Sitting #60 of the German Corona Committee on July 9 2021 to share his findings in a 90 minute discussion with lawyers.

Now Dr Martin is opening that can!

Dr David Martin – Spike Protein Patents Since 2002!

The gist of David Martin’s video was that wealthy philanthropists like Bill Gates, technology companies, pharmaceutical companies and global health organizations colluded to create a virus that would force governments to fund research and development of vaccines and therapies in order to enrich themselves.

Dr Peter Daszak of EcoHealth Alliance offered the following assessment [in March 2015]:

“Daszak reiterated that, until an infectious disease crisis is very real, present, and at an emergency threshold, it is often largely ignored. To sustain the funding base beyond the crisis, he said, we need to increase public understanding of the need for MCMs such as a pan-influenza or pan-coronavirus vaccine. A key driver is the media, and the economics follow the hype. We need to use that hype to our advantage to get to the real issues. Investors will respond if they see profit at the end of process.”

By doing so Dr Martin explains in detail the trails of blood related to SARS Cov2. It’s unbelievable and breathtaking to me, but please watch the video and decide for yourself.

This elitist crime information is a matter of PUBLIC RECORD and the information is of public interests. And please share around if you find it beneficial. Thanks.

EXCLUSIVE! Dr. David Martin Just Ended COVID, Fauci, DOJ, Politicians in ONE INTERVIEW.

By Stew Peters

FORT DETRICK – SOURCE of COVID-19?

“Ephraim shall be desolate in the day of rebuke; among the tribes of Israel have I made known that which shall surely be” Hosea 5:9

~~~~~

Below are smaller doses of the same video in which Dr David Martin explains in detail the patents related to SARS Cov2.

FORT DETRICK – SOURCE of COVID-19?

“Your country is desolate, your cities are burned with fire; your land, strangers devour it in your presence, and it is desolate, as overthrown by strangers” Isaiah 1:7.

Then said I, “LORD, how long?” And He answered, “Until the cities be wasted without inhabitant, and the houses without man, and the land be utterly desolate” Isaiah 6:11.

“In that day shall his strong cities be as a forsaken bough and an uppermost branch, which they left because of the children of Israel; and there shall be desolation” Isaiah 17:9.

Dr Fauci Should be Led Away in Handcuffs

•July 27, 2021 • Comments Off on Dr Fauci Should be Led Away in Handcuffs

Dr Fauci should have been led away in handcuffs long ago but he’s still there, holding the most important office. It shows how paralyzed and corrupt the System is, especially the Department of Justice. Already sedated? If so, by whom?

In 2014, the Obama administration imposed a moratorium on Gain of Function because it was seen as too risky on humanity, but this moratorium was overturned on December 19, 2017 by Dr Anthony Fauci who sees himself siting on a pedestal above the President.

SummitNews report: Fauci Declares Himself The Supreme Authority; “Attacking Me Is Attacking Science”

By Steve Watson / 10 June, 2021

As the scrutiny of Dr Fauci continues to increase following the release of his emails, it’s clear he’s feeling the strain. He declared, yet again, Wednesday that anyone attacking him should be seen as attacking science itself.

Fauci made the comments in part in response to Republicans in the House demanding he explain comments previously made that contradict sworn testimony that he gave to Congress.

During another softball interview on MSNBC, Fauci repeated his claim to being the supreme authority on the pandemic, suggesting that anyone who questions what he says is “painfully ridiculous”.

“If you are trying to get at me as a public health official and a scientist, you’re really attacking, not only Dr Anthony Fauci, you are attacking science,” Fauci proclaimed.

Fauci continued “Anybody that looks at what’s going on, clearly sees that. You have to be asleep not to see that. That is what’s going on. Science and the truth are being attacked.”

Many would argue that science and truth were attacked at the beginning of the pandemic when Fauci dismissed out of hand the notion of coronavirus leaking from the Wuhan Institute of Virology [[unless Fort Detrick is similarly investigated like WIV, WHO could never give an honest answer! More likely Fort Detrick is the nerve center of the original coronavirus/Covid-19 operation, with tentacles reaching out earlier to Barcelona in March 2019; France in December; and Italy in October 2019 and even in the United States itself in December 2019. The Latest: zero chance it leaked from WIV]] when leading virologists were telling him that the thing looked like it was engineered.

“It’s very dangerous, Chuck, because a lot of what you’re seeing as attacks on me quite frankly are attacks on science because all of the things that I have spoken about consistently from the very beginning have been fundamentally based on science.”

Science and truth was attacked when Fauci’s pal Peter Daszak, the Wuhan gain of function funder, the guy Fauci routed the money through, orchestrated a ‘bullying’ campaign and coerced top scientists into signing off on a letter to The Lancet aimed at removing blame for Covid-19 from the Wuhan lab he was funding with taxpayer dollars.

Fauci is repeating this ‘I am science’ talking point all over the place. Last week, again on MSNBC, he said basically the same thing.

A real scientist would point out that one should always beware anyone who says ‘the science is settled’ or criticises others for questioning science. That’s what science is, a series of questioning hypotheses.

And given Fauci’s record for flip flopping on what is and isn’t scientifically sound during this pandemic, and his shady involvement with funding the dangerous research in a lab where the virus magically appeared, he in particular should be the first to be questioned.

Dr Fauci should be led away in handcuffs

“The stranger that is within thee shall get up above thee very high, and thou shalt come down very low … He shall be the head, and thou shalt be the tail” Deuteronomy 28:43-44

Dr David Martin – Patents Review

•July 27, 2021 • Leave a Comment

A “novel” coronavirus (nCoV) is supposed to be “a new strain” that has not been previously identified in humans, but Dr David Martin – Patents Review shows SARS-CoV-2 is no novel Virus – July 9 2021

In this video Dr David E. Martin explains in detail,the trails of blood related to SARS Cov2.

NOT SURE HOW YOU FEEL BUT A CHILL RUN THROUGH MY SPINE WHEN I WATCH THIS VIDEO!!!

Dr David Martin, CEO of M-CAM International (risk management) has reviewed 4,000 Coronavirus patents. He appeared on Sitting #60 of the German Corona Committee on July 9 2021 to share his findings in a 90 minute discussion with lawyers of the Ausschuss and Dr Wolfgang Wodarg, Germany’s most experienced lung doctor.

Ralph Baric at a University of North Carolina lab | Photo: Christopher Janaro | Bloomberg
RALPH S. BARIC, described as “a science-maniac”and Professor of epidemiology at the UNC-Chapel Hill, also “one who has made a lot of money” — shouldn’t the world honor him the title FATHER of COVID-19?

Dr Martin’s clear and verifiable conclusion is that there is nothing at all novel about the SARS-CoV-2 gene sequence used as a basis for the Covid vaccines. Further from a patent standpoint, there seems to be no way of knowing what exact sequence is being used in the vaccines and therefore what people are being injected with. Drs Martin & Fuellmich consider this situation to be a RICO (Racketeer Influenced and Corrupt Organizations Act) legal case.

Odysee.com

“I have seen a horrible thing in the house of Israel; there is the whoredom of Ephraim, Israel is defiled” Hosea 6:10

By Stew Peters

July 21, 2021

FORT DETRICK – SOURCE of COVID-19?

Then said I, “LORD, how long?” And He answered, “Until the cities be wasted without inhabitant, and the houses without man, and the land be utterly desolate” Isaiah 6:11.

China to NUKE Japan?

•July 23, 2021 • Leave a Comment

CHINA is threatening to NUKE revisionist Japan on the eve of the Olympics if it intervenes in conflict with Taiwan, it has been revealed in a new video.

According to the Congressional Research Service, neo-Imperialist Nippon Kaigi believes that “Japan should be applauded for liberating much of East Asia” during WW2, that the “Tokyo War Crimes tribunals were illegitimate,” and that the rape of Nanking was either “exaggerated or fabricated.” It denies the forced prostitution of Chinese and Korean “comfort women” by the Imperial Japanese Army, believes Japan should have an army again — something outlawed by Japan’s current constitution — and believes that it should return to worshipping the emperor.

In 2013, at a Nippon Kaigi party celebrating Shinzo Abe’s new appointments to his cabinet — 15 of whose 18 members were Nippon Kaigi-niks — the old imperial “Rising Sun” flag was flown, pledges to “break away from the postwar regime” were made, and the (very short and controversial) imperial national anthem was sung. 

In response to these revisionist statements, elements in the Chinese Republic said in the video that it would declare “full-scale war” against neo-Imperialist JAPAN if the Taiwan disagreement escalates, stoking World War Three fears.

Atomic Bomb Dropped on Hiroshima - HISTORY
Even after this atomic bomb explosion in Hiroshima (and another in Nagasaki), JAPAN doesn’t know or pretends not to know what they had done to CHINA (and KOREA).

The Sun / Jul 19 2021 / Jamie Seidel, Adriana Elgueta

It comes after earlier this month, China vowed to invade Taiwan and explained how it would do it.

An article in a state-controlled publication offered a glimpse of a terrifying three-stage plan to pave the way for an invasion force to storm the breakaway island.

President Xi Jinping pledged a “complete reunification” with Taiwan as he delivered a speech to mark 100 years of the Chinese Communist party.

Any invasion would represent a serious escalation of hostilities and could drag in the US through its pact to defend Taiwan.

The video threatened to nuke Japan if they intervened in the Taiwan conflicts

Delinquent of duty, General MacArthur had left today the Western Pacific an unfinished business to solve. See Japan’s Imperial Conspiracy by David Bergamini

Washington’s regional allies such as South Korea, revisionist Japan and Australia could also be sucked into a conflict as would Nato forces such as the UK because the US is a member of the alliance.

But a video channel, allegedly approved by the Chinese Communist Party with close ties to the People’s Liberation Army (PLA), took the anger to the next level.

In the new video now deleted, a narrator said: “We will use nuclear bombs first. We will use nuclear bombs continuously.

“We will do this until Japan declares unconditional surrender for the second time.”

SOS, Save Our Sea. Graphic: Xiong Xiaoying/GT
Gen MacArthur’s Unfinished Business after WWII: Now China says to Japan, “We will use nuclear bombs continuously.” Japan, the only country to experience nuclear attacks, may experience them again?

“When we liberate Taiwan, if Japan dares to intervene by force – even if it only deploys one soldier, one plane or one ship – we will not only return fire but also wage full-scale war against Japan itself.”

Delinquent of his duty to execute fair and equitable justice for the crimes JAPAN had committed, General MacArthur had left today the Western Pacific an unfinished business to solve. By allowing JAPAN’s criminals to roam free the UNITED STATES is deemed as an accomplice in its crimes. Under the English common law, an accomplice is a person who actively participates in the commission of a crime, even if they take no part in the actual criminal offense but by allowing JAPAN’s criminals free, (even bringing in their “germ data” from Harbin, CHINA for the foundation of FORT DETRICK’s biochemical weapon program), the UNITED STATES would be sharing JAPAN’s culpability.

“I have seen a horrible thing in the house of Israel; there is the whoredom of Ephraim, Israel is defiled” Hosea 6:10

And, today, many of those criminals have their Nippon Kaigi great grand children in the DIET, JAPAN’S Parliament, ruling over their country. Hence today, the Japanese has mastered the art of giving apology without any contrition. See more of these deceits and deceptions in Japan’s Imperial Conspiracy by David Bergamini. Your local library would have a copy screaming for attention to be read.

For Japan's Shinzo Abe, Unfinished Family Business - WSJ
Shinzo Abe recalls sitting on his grandfather’s lap as a young boy 55 years ago. ABE’s duty was to rebuild Japan’s military for JAPAN’s “Manchukuo: Asia’s Unfinished War.” ABE’s grandfather Nobusuke Kishi was nicknamed the “Monster of Manchuria,” and Prime Minister of JAPAN (1957-1960) under the nose of the UNITED STATES.

And there is a prophecy to the house of Israel, “a rebellious nation” (Ezekiel 3:5). This house of Israel refers to 10 tribes of Israel that separated from Judah and set up their own kingdom. They were besieged and taken into captivity in 721 BC. Ezekiel was writing more than a hundred years later with fellow captives at Telabib (Ezekiel 3:15), so the message could only meant for those of the Northern Kingdom – the modern Israelites today from Prophet Ezekiel:

Ezekiel: Prophecy as Performance Art | My Jewish Learning
Ezekiel’s Vision of God for the Endtime rebellious House of Israel

Chapter 5

“And thou, son of man, take thee a sharp knife, take thee a barber’s razor and cause it to pass over thine head and upon thy beard. Then take thee balances to weigh and divide the hair.

Thou shalt burn with fire a third part in the midst of the city, when the days of the siege are fulfilled; and thou shalt take a third part and smite about it with a knife, and a third part thou shalt scatter in the wind; and I will draw out a sword after them.

Thou shalt also take thereof a few in number, and bind them in thy skirts.

Then take of them again, and cast them into the midst of the fire, and burn them in the fire; for thereof shall a fire come forth into all the house of Israel.

“Thus saith the Lord God: This is Jerusalem. I have set it in the midst of the nations and countries that are round about her.

And she hath changed My judgments into wickedness more than the nations, and My statutes more than the countries that are round about her; for they have refused My judgments and My statutes. They have not walked in them.

Therefore thus saith the LORD God: Because ye multiplied more than the nations that are round about you, and have not walked in My statutes, neither have kept My judgments, neither have done according to the judgments of the nations that are round about you,

therefore thus saith the LORD God: Behold I, even I, am against thee, and will execute judgments in the midst of thee in the sight of the nations.

And I will do in thee that which I have not done, and the like of which I will not do any more, because of all thine abominations.

10 Therefore the fathers shall eat the sons in the midst of thee, and the sons shall eat their fathers; and I will execute judgments in thee, and the whole remnant of thee will I scatter into all the winds.

11 “Therefore as I live, saith the LORD God, surely because thou hast defiled My sanctuary with all thy detestable things and with all thine abominations, therefore will I also diminish thee; neither shall Mine eye spare, neither will I have any pity.

12 A third part of thee shall die with the pestilence, and with famine shall they be consumed in the midst of thee; and a third part shall fall by the sword round about thee; and I will scatter a third part into all the winds, and I will draw out a sword after them.

13 Thus shall Mine anger be accomplished, and I will cause My fury to rest upon them, and I will be comforted; and they shall know that I, the LORD, have spoken it in My zeal when I have accomplished My fury upon them.

14 “Moreover I will make thee a waste and a reproach among the nations that are round about thee, in the sight of all that pass by.

15 So it shall be a reproach and a taunt, an instruction and an astonishment unto the nations that are round about thee, when I shall execute judgments upon thee in anger and in fury and in furious rebukes. I, the LORD, have spoken it.

16 When I shall send upon them the evil arrows of famine which shall be for their destruction, and which I will send to destroy you, and I will increase the famine upon you, and will break your staff of bread,

17 so will I send upon you famine and evil beasts, and they shall bereave thee; and pestilence and blood shall pass through thee, and I will bring the sword upon thee. I, the LORD, have spoken it.”

Ezekiel 5:1-17

What Happened on 9 Av?

•July 20, 2021 • Leave a Comment

What Happened on 9 Av?

The Siege of Jerusalem, AD 70, by Flavius Josephus
The Fall of Jerusalem began with a Siege in AD 70, wrote Flavius Josephus

Tisha B’Av, the 9th day of the month of Av (July 17-18, 2021), is the saddest day on the Jewish calendar, on which pious or Orthodox Jews, deprive themselves and pray. It is the culmination of the Three Weeks, a period of time during which they mark the destruction of the Holy Temple in Jerusalem.

“Thus saith the LORD of hosts: ‘The fast of the fourth month, and the fast of the fifth, and the fast of the seventh, and the fast of the tenth, shall be to the house of Judah joy and gladness and cheerful feasts. Therefore love the truth and peace.’ Zechariah 8:19

So what happened on the 9th of Av?

1313 BCE: The spies returned from the Promised Land with frightening reports, and the Israelites balked at the prospect of entering the land. God decreed that they would therefore wander in the desert for 40 years.

The Israelites are in the desert, recently having experienced the miraculous Exodus, and are now poised to enter the Promised Land. But first they dispatch a reconnaissance mission to assist in formulating a prudent battle strategy. The spies return on the eighth day of Av and report that the land is unconquerable.

That night, the 9th of Av, the people cry. They insist that they’d rather go back to Egypt than be slaughtered by the Canaanites. God is highly displeased by this public demonstration of distrust in His power, and consequently that generation of Israelites never enters the Holy Land. Only their children have that privilege, after wandering in the desert for another 38 years.

The Fall of Jerusalem in 70 CE: A Story of Roman Revenge

Both Holy Temples in Jerusalem were destroyed on this date – the 9th day of Av. The First Temple was burned by the Babylonians in 423 BCE.

And in the fifth month, on the seventh day of the month [which is Av], which is the nineteenth year of King Nebuchadnezzar king of Babylon, came Nebuzaradan, captain of the guard, a servant of the king of Babylon, unto Jerusalem.

And [two days later] he burned the house of the LORD, and the king’s house, and all the houses of Jerusalem, and every great man’s house burned he with fire. II King 25:8-9

— Western records designate the year as 586 BCE when this First Temple was destroyed by Nebuchadnezzar, which is 163 years earlier than Jewish reckoning. But why such differences? The Jews have a continuous record, but English has no written records until around 400 CE. And even if the Roman Empire had a continuous record, it could bring us back another 500 years at most, but nothing to bring us to 586 BCE. Hence Western narratives and its dating system are, unfortunately, full of suspects.

In 66 CE the Jewish population rebelled against the Roman Empire. Four years later, on 4 August 70 CE (the 9th Day of Av), the Second Temple fell to the Romans unleashing a period of suffering from which the Jewish nation has never fully recovered.

Siege of Jerusalem | Facts & Summary | Britannica

According to an inscription on the Colosseum, Emperor Vespasian built the Colosseum with Jewish slaves and war spoils – many from the spoils of the Second Temple.

Surely deemed not worthy of survival, the apostate Sadducees, the Boethusians and the Essenes all vanished without coming through the Consuming Fires. 

The Sadducees and Boethusians, following the heretic Samaritan way of observing Passover, kept it on the night of the fourteenth. The Essenes, after they had repudiated the calendar that was sanctioned by the Sanhedrin, then went about presumptuously making one of their own. They all perished by either the flaming Sword or the consuming Fire.

These unpleasant endings should give those in the Church serious thoughts to a coincidence that all serious believer would find troubling. But, alas, His ten endtime virgins are all naked, wretched and far asleep, as if they had all been tranquilized by Satan.

Shall a trumpet be blown in the city, and the people not be afraid? Shall there be evil in a city, and the LORD hath not done it? Amos 3:6

The Pharisees and the Nazarenes escaped; the former to Yavneh, the later to Pella. 

The Unspoken Will of God

•July 17, 2021 • Leave a Comment

Wow, is there such a thing as the Unspoken Will of God?

Yes, there is!

Some of God’s oracles were written with God’s fingers. And they are the Ten Commandments.

Unspoken - theway church
What Are the Unspoken Word of God?

Others are scattered all over the Books of Moses. Much of these were collated and for the Mishnah that form the 613 mitzvot. Many of the mitzvot cannot be observed now, following the destruction of the Second Temple, although they still retain religious significance.

And the LORD delivered unto me two tablets of stone written with the finger of God, and on them was written according to all the words which the LORD spoke with you on the mount out of the midst of the fire in the day of the assembly. Deuteronomy 9:10

Others were written when God told Moses to write them down:

And the LORD said unto Moses, “Write thou these words, for according to the tenor of these words I have made a covenant with thee and with Israel.” Exodus 34:27

But surprisingly, there were the unspoken Word of God! Like parents, they have their secret wishes for their children. So is God. But how do we know God’s unspoken will if they were unspoken? To be unspoken would also mean unwritten.

The answer is quite simple. Like parents they could be hinted at but not quite spoken of. So how could we understand the unspoken Word of God if there are any?

The answer lies in the Four fasts of Zechariah:

“Thus saith the LORD of hosts: ‘The fast of the fourth month, and the fast of the fifth, and the fast of the seventh, and the fast of the tenth, shall be to the house of Judah joy and gladness and cheerful feasts. Therefore love the truth and peace.’ Zechariah 8:19

The Scriptures do not give any details, but they are in the Oral Law:

Seventeenth of Tammuz (Shiva Asar B’Tammuz, minor fast) — the breaching of the walls of Jerusalem before the destruction of the Second Temple in 70 AD. – June 27, 2021

Ninth of Av (Tisha B’Av, full fast) — fall of Jerusalem on the same dates in 587 BC and 70 AD. – July 18, 2021

Fast of Gedalia (Tzom Gedalia, minor fast) — assassination of Gedaliah, the righteous governor of Judah (II Kings 25:22–26). – Sept 9, 2021

Tenth of Tevet (Asara B’Tevet, minor fast) — the siege of Jerusalem by Nebuchadnezzar II of Babylon. – Dec 14, 2021

Journal Archives - Leon Davey 'Art'

But notice, today these fasts mainly by Jews — the “house of Judah” — will turn to be a joy and into “gladness and cheerful feasts.” How so, you may ask? God must have accepted their fasts prayers and those who participate in them would be duly rewarded. Those who fast will turn into joy! These four fasts are all related to Jerusalem, God’s beloved city with its Temple where God initially told Moses to build a sanctuary for Him to dwell.

The final place for this sanctuary or Temple was and is to be in Jerusalem.

At that time they shall call Jerusalem the Throne of the LORD and all the nations shall be gathered unto it, to the name of the LORD, to Jerusalem. Jeremiah 3:17

“Thus saith the LORD God: This is Jerusalem. I have set it in the midst of the nations and countries that are round about her. Ezekiel 5:5

And many nations shall come and say, “Come, and let us go up to the mountain of the LORD, and to the house of the God of Jacob. And He will teach us of His ways, and we will walk in His paths.” For the law shall go forth from Zion, and the word of the LORD from Jerusalem. Micah 4:2