Jeremiah (Ch 49-50)

•November 24, 2021 • Leave a Comment

Chapter 49 contains prophecies concerning the judgments of God on several nations and kingdoms, chiefly bordering on the land of Israel; on the Ammonites; Edomites, Edom, which lay south to the land of Israel; the kingdom of Damascus, or the Syrians, the Kedarenes or Arabians, and on the Elamites or Persians.

Jeremiah 49

1 Concerning the Ammonites, thus saith the Lord: “Hath Israel no sons? Hath he no heir? Why then doth their king inherit Gad, and his people dwell in his cities? — hath Israel no sons? hath he no heir? certainly he has, and who ought to possess the land; this is not speaking of the ten tribes, sometimes called Israel, for these had been long ago carried captive, and left no heirs of their tribes; but of all Israel, including the tribes of Judah and Benjamin; who though their brethren and being next in blood were the lawful heirs of their lands and possessions;

— why then doth their king inherit Gad? that part of the land of Israel which belonged to the tribe of Gad; this, when the ten tribes were carried captive by the king of Assyria and the Gadites among the rest was seized on by the Ammonites with their king at the head of them;

1 Kings 11:5; the Ammonites having got possession of the land set up their idol in it where their temples were built for him and altars erected and sacrifices offered to him, so that he might be said to inherit it; and which must be very offensive to, and highly resented by, the God of Israel.

Therefore behold, the days come,” saith the Lord, “that I will cause an alarm of war to be heard in Rabbah of the Ammonites; and it shall be a desolate heap, and her daughters shall be burned with fire; then shall Israel be heir unto them that were his heirs,” saith the Lord. — therefore behold the days come, saith the Lord… Or, “are coming” as they did in a very little time after this prophecy;

— that I will cause an alarm of war to be heard in Rabbah of the Ammonites; the metropolis of the Ammonites; it was their royal city in the times of David; this the Lord threatens with the sound of the trumpet, the alarm of war or the noise of warriors as the Targum says; the Chaldean army under Nebuchadnezzar, who, about five years after the destruction of Jerusalem subdued the Ammonites;

— and it shall be a desolate heap; be utterly destroyed; its walls broken down, and houses demolished, and made a heap of rubbish:

— her daughters shall be burnt with fire: Rabbah was the mother city, and the other cities of the Ammonites were her daughters, which are threatened to be destroyed with fire by the enemy; or it may mean the villages round Rabbah, it being usual in Scripture for villages to be called the daughters of cities; so the Targum paraphrases it, “the inhabitants of her villages shall be burnt with fire,”

— then shall Israel be heirs unto them that were his heirs, saith the Lord: that is, shall inherit their land again which the Ammonites pretended to be the lawful heirs of; yea, not only possess their own land but the land of Ammon too: this was fulfilled not immediately upon the destruction of Ammon, but in part upon the return of the Jews from the Babylonish captivity when they repossessed their own country; and partly in the times of the Maccabees, when they subdued the Ammonites.

“Howl, O Heshbon, for Ai is despoiled! Cry, ye daughters of Rabbah; gird you with sackcloth! Lament, and run to and fro by the hedges; for their king shall go into captivity, and his priests and his princes together. — howl, O Heshbon, at that time occupied by the Ammonites; for Ai is spoiled, had already been subdued by the invaders; cry, ye daughters of Rabbah, the towns and villages near the capital, gird you with sackcloth, in token of deep mourning; 

— lament and run to and fro by the hedges in the fenced encampment, such as were quickly erected out in the open fields, since the cities no longer offered any protection; for their king shall go into captivity, in this case their idol Melchom with whom the heathen king was pleased to identify himself and his priests and princes together.

Why gloriest thou in the valleys, thy flowing valley, O backsliding daughter, that trusted in her treasures, saying, ‘Who shall come unto me?’ — wherefore gloriest thou in the valleys, thy flowing valley, flowing with abundance, with milk and honey, O backsliding daughter? so called because the children of Ammon had denied their descent from Lot and had turned to idolatry;

— that trusted in her treasures, in her wealth of resources and goods, saying, Who shall come unto me? namely, in a hostile attack. The Ammonites boasted that no enemy could successfully launch a campaign against their land.

Behold, I will bring a fear upon thee,” saith the Lord God of hosts, “from all those that be about thee; and ye shall be driven out, every man straight forth, and none shall gather up him that wandereth. — behold, I will bring a fear upon thee, saith the Lord God of hosts, from all those that be about thee, whose misfortune and overthrow would bring terror upon them; and ye shall be driven out, every man, right forth, straight ahead, without turning; 

— and none shall gather up him that wandereth, make any attempt to bring about so much as a semblance of order among the scattered fugitives. According to secular accounts the overthrow of Ammon took place in the fifth year after the destruction of Jerusalem, after King Baalis had executed the murder of Gedaliah, Jeremiah 40:14.

And afterward I will bring back the captives of the children of Ammon,” saith the Lord. — and afterwards I will bring again the captivity of the children of Ammon, saith the Lord. Perhaps by Cyrus; for, in the times of Judas Maccabeus, the children of Ammon were again a large and mighty people, “Afterward he passed over to the children of Ammon, where he found a mighty power and much people, with Timotheus their captain” (1 Maccabees 5:6).

Concerning Edom, thus saith the Lord of hosts: “Is wisdom no more in Teman? Is counsel perished from the prudent? Is their wisdom vanished? — concerning Edom, thus saith the Lord of hosts… Or, “unto Edom” thus saith the Lord; or “against Edom” all which is true, as observed on Jeremiah 49:1; meaning the Idumeans, the posterity of Esau, who was called Edom; Herod the Great, an Idumean, king over Judea; was a great example of the Idumean cruelty over the Jews; which could be as yet future, points at the destruction of Rome and the Romans, who with the Jews frequently go by the name of Edom; 

— is wisdom no more in Teman? a city in Edom which had its name from Teman, a grandson of Esau, Genesis 36:11; whose descendants were called Temanites; one of which was Eliphaz, a friend of Job’s, Job 2:11; it was a principal city, famous for men of wisdom; such an one was the person just mentioned: perhaps the grand senate of the country, or the chief counsellors, dwelt here; where schemes were formed for the good of the country in times of war or peace; or schools for the instruction of various arts and sciences; and which had continued to this time but now would be no more;

— the Targum says, “is there no more wisdom in the south?” but Rashi interprets it as Edom, which lay south to the land of Israel; “And your south side shall be from the desert of Zin close by the side of Edom” (Numbers 34:3).

— One other theory is that the Ottoman Turks (or today’s Turkey) are the sons of Teman. Perhaps they could be another branch.

Flee ye, turn back, dwell deep, O inhabitants of Dedan; for I will bring the calamity of Esau upon him, at the time that I will visit him. — flee ye, turn back, dwell deep, O inhabitants of Dedan… another city in Idumea; though some take it to be a country in Arabia, bordering on Edom, and subdued by the Edomites: the inhabitants of this place are advised to “flee” for their lives;

— since the enemy was just upon them; and “turn back” lest they should fall into his hands; and hide themselves in some deep caverns of the earth, in holes, and dens of rocks and such like places. It is a prophecy that they should flee from and turn their backs on their enemies and betake themselves to some very secret places for safety;

— for I will bring the calamity of Esau upon him; which was determined concerning him, threatened to him and was his just desert; even the utter destruction of the whole land:

— the time of his visitation; the time fixed to visit him in a way of wrath and punishment to come.

9 If grape-gatherers come to thee, would they not leave some gleaning grapes? If thieves by night, they will destroy till they have enough. — the Targum renders it, “if thy spoilers, as grape gatherers, should come to thee,” would not they leave some for the poor to glean? certainly they would and not take every cluster;

— if thieves by night, they will destroy till they have enough who break into houses by night, these will eat and drink as much as is sufficient, and carry off what serves their turn; but they seldom take away everything they find in a house; they leave some things behind them; but it is suggested that the Chaldeans should take away all from the Edomites and leave them nothing; see Obadiah 1:5.

10 But I have made Esau bare; I have uncovered his secret places, and he shall not be able to hide himself; his seed is despoiled, and his brethren and his neighbors, and he is no more. — but I have made Esau bare… by the hand of the Chaldeans; stripped him of everything that is valuable; of his cities, castles, villages, people, wealth and treasure:

— I have uncovered his secret places; where either his substance was hid, or his people; these were made known to their enemies, who seized on both:

— and he shall not be able to hide himself; even in his deep places in the caves and dens of the earth, but his enemy shall find him out:

— his seed is spoiled and his brethren and his neighbours, his children, as the Targum says; and his brethren, the Ammonites and Moabites; and his neighbours, the Philistines; or as many as were with him and belonged unto him:

— and he is not: his kingdom is not; he is no more a people and nation, but all destroyed by the sword or carried captive; or there should be none left of his brethren, and neighbours, and friends to say to him what follows: “leave thy fatherless children.”

11 Leave thy fatherless children; I will preserve them alive; and let thy widows trust in Me.” — the Targum takes them to be an address to the people of Israel, paraphrasing them thus: “you, O house of Israel, your orphans shall not be left, I will sustain them and your widows shall trust in my word.”

12 For thus saith the Lord: “Behold, they whose judgement was not to drink of the cup have assuredly drunk. And art thou he that shall altogether go unpunished? Thou shalt not go unpunished, but thou shalt surely drink of it. — behold, they whose judgement was not to drink of the cup have assuredly drunken; meaning some of the other nations, who had not dealt so ill with the Jews as the Edomites had, at least their sins were not so aggravated as theirs were in a comparative sense; for otherwise it was but just that they should be treated in the manner they were; since they were not so guilty as these were;

— and art thou he that shalt altogether go unpunished? if lesser sinners are not let go free, how should it be thought that greater ones should? and especially if judgement had begun at God’s own people, the wicked Edomite could not expect to escape;

— thou shalt not go unpunished, but thou shalt surely drink of it; the cup of wrath and vengeance; or have the just punishment inflicted on them threatened them.

13 For I have sworn by Myself,” saith the Lord, “that Bozrah shall become a desolation, a reproach, a waste, and a curse; and all the cities thereof shall be perpetual wastes.” — but Bozrah of Idumea is the royal city of Edom, Isaiah 63:1; shall become a desolation, a reproach, a waste and a curse.

14 I have heard a word from the Lord, and an ambassador is sent unto the heathen, saying, “Gather ye together, and come against her, and rise up to the battle!”

15 “For lo, I will make thee small among the heathen and despised among men. — for, lo, I will make thee small among the nations… Or “I have given thee” or “made thee” as if Edom was a people few in number, and their country not large, and which was the reason of gathering the Chaldeans against them, to reduce their number, weaken their strength, and destroy their substance and so make them a small, feeble and contemptible people;

— and despised among men: for the fewness of their men, the desolation of their country, the consumption of their wealth and riches, their poverty and meanness; see Obadiah 1:2 “Behold, I have made thee small among the nations; thou art greatly despised (2 “Behold, I have made thee small among the nations; thou art greatly despised. — thou art greatly despised; a parallel here in Jeremiah 49:15 “For lo, I will make thee small among the heathen and despised among men,” as the term beaners (Latinx or Latinos?) could allude to).

16 Thy terribleness hath deceived thee, and the pride of thine heart, O thou that dwellest in the clefts of the rock, that holdest the height of the hill; though thou shouldest make thy nest as high as the eagle, I will bring thee down from thence,” saith the Lord. — thy terribleness hath deceived thee, the fact that other nations seemed to stand in awe of Edom had caused him to think that he was really formidable, and the pride of thine heart, insolence usually having this influence upon the heart of the proud to deceive them, wherefore the Lord now calls out;

— O thou that dwellest in the clefts of the rock, that boldest the height of the hill, some of the forts of Idumea being situated on almost inaccessible cliffs, though thou shouldest make thy nest as high as the eagle, I will bring thee down from thence, saith the Lord, showing that before Him no stronghold is impregnable;

— one Report by McKinsey says of the 60 millions Latinos in US, they often live in ‘deserts’ where adequate housing, groceries are hard to find. “Nearly 9 in 10 of the Latino residents in such communities lived in five states: California, Florida, New Jersey, New York and Texas.”

McKinsey: Latinos are projected to make up 22.4 percent of the US labor force by 2030 and more than 30 percent by 2060 (Latinos population to 111.2 million by ’60).

17 “Also Edom shall be a desolation; every one that goeth by it shall be astonished and shall hiss at all the plagues thereof. — also Edom shall be a desolation; not only Bozrah, its principal city, before spoken of, but the whole country of Idumea should be laid waste; its fortified cities destroyed; its riches plundered; and its inhabitants slain with the sword; every one that goeth by it shall be astonished, filled with horrified surprise at the total overthrow of the country and shall hiss at all the plagues thereof with a sound expressing derision and mockery.

18 As in the overthrow of Sodom and Gomorrah and the neighbor cities thereof,” saith the Lord, “no man shall abide there, neither shall a son of man dwell in it. — as in the overthrow of Sodom and Gomorrah… which was so sudden and general, that nothing was left, or any spared; so should it be with Edom;

— no man shall abide there, neither shall a son of man dwell in it; it would be an uninhabited desert;

the Lord was asked to remember in Psalms 137 against the Edomites who had asked that Jerusalem be razed to its foundations:

Remember, O Lord, the children of Edom in the day of Jerusalem’s fall, who said, “Raze it, raze it, even to the foundation thereof!” Psalms 137:7

to call for the razing of the Temple of God “Raze it, raze it, even to the foundation thereof!” is a heavy crime against the God of the Most High. The Most High dwelled there and these Edomites cheered the Babylonians to burn it down? Madness! Just Madness!!!

19 Behold, he shall come up like a lion from the swelling of the Jordan against the habitation of the strong; but I will suddenly make him run away from her. And who is a chosen man, that I may appoint over her? For who is like Me? And who will appoint Me a time? And who is that shepherd that will stand before Me?” — behold, he shall come up like a lion from the swelling of Jordan… the Targum interprets it of a king and his army, paraphrasing the words thus, “behold, a king with his army shall come up against them, as a lion comes up from the height of Jordan” as Nebuchadnezzar and his army that should come up against the Edomites from the land of Judea, where Jordan was;

— against the habitation of the strong the land of Edom, a country well fortified in which mighty men dwelt; particularly Mount Seir, where their king was and which was “the fold of the mighty” either of the mighty shepherd as it may be rendered or of the strong place; but what is this to a lion?

— and who is that shepherd that will stand before me? or king, as the Targum says, any king, prince or potentate, who both in Scripture and in other writings, are often called shepherds; the king of Edom is particularly pointed at whose habitation or fold is before observed: alas! what could such a shepherd do? or how could he stand before the almighty God or any lion he should send?

20 Therefore hear the counsel of the Lord that He hath taken against Edom, and His purposes that He hath purposed against the inhabitants of Teman. Surely the least of the flock shall draw them out; surely He shall make their habitations desolate with them. — surely he shall make their habitations desolate with them; or “their folds” the sheep shall be destroyed and their folds shall be demolished; that is, the inhabitants of Edom shall be slain with the sword, and their cities, towns and villages, shall be laid waste;

— who is Edom/Esau today? The answer lies in the book of Obadiah; and Jonathan Targum identifies Esau (Sepharad of the Southland identified) as Spain! Obadiah 1:20; the Targums identified Sepharad with Spain, hence, Spanish Jews are called Sephardim;

Wikipedia: Sepharad (/sɛfəræd/or səˈfɛərəd/ Hebrew: סְפָרַד Sp̄āraḏ; also Sefarad, Sephared, Sfard) is the Hebrew name for Spain. A place called Sepharad, probably referring to Sardis in Lydia (‘Sfard’ in Lydian), in the Book of Obadiah (Obadiah 1:20, 6th century BC) of the Hebrew Bible. The name was later applied to Spain.

21 The earth is moved at the noise of their fall; at the cry the noise thereof was heard in the Red Sea. — the earth is moved at the noise of their fall, quaking with its intensity, at the cry the noise thereof was heard in the Red Sea, or “a crying the noise of it is heard at the Red Sea.”

22 Behold, He shall come up and fly as the eagle, and spread His wings over Bozrah; and at that day shall the heart of the mighty men of Edom be as the heart of a woman in her pangs. — behold, he, the conqueror, like Herod the Great, an Idumean, was a great eagle with his famed cruelty over the Jews as king over Judea; shall come up and fly and spread his wings as the eagle over Bozrah, to pounce down upon the whole country; and at that day shall the heart of the mighty men of Edom be as the heart of a woman in her pangs. No matter how impregnable the position of God’s enemies may seem in the eyes of human beings, they will quickly fall before the attack of the Lord.

23 Concerning Damascus: “Hamath is confounded, and Arpad, for they have heard evil tidings; they are fainthearted; there is sorrow on the sea; it cannot be quiet. — concerning Damascus. Hamath, a powerful city on the Orontes and formerly the capital of a country of the same name, is confounded, and Arpad, another mighty city, both of them now within the confines of Syria;

— for they have heard evil tidings; they are faint-hearted, full of concern on account of the reports which they have heard; there is sorrow on the sea, terror among the inhabitants along its shores; it cannot be quiet, there is no rest for worry over the outlook.

24 Damascus is waxed feeble and turneth herself to flee, and fear hath seized on her; anguish and sorrows have taken her, as a woman in travail. — Damascus is waxed feeble, utterly discouraged and enfeebled; and turneth herself to flee, and fear hath seized on her, anguish and sorrows have taken her as a woman in travail, the terror of utter despair.

25 How is the city of praise not left, the city of My joy! — how is the city of praise not left, the city of my joy? How was it that the place of delight as Damascus was called of old, was not abandoned by its inhabitants, so that they might have saved their lives by a speedy flight?

26 Therefore her young men shall fall in her streets, and all the men of war shall be cut off in that day,” saith the Lord of hosts. — therefore her young men shall fall in her streets, and all the men of war shall be cut off in that day, saith the Lord of hosts; so great had been their terror at the approach of the enemy that they had not even had recourse to flight and so were cut down in the very streets of their city.

27 “And I will kindle a fire in the wall of Damascus, and it shall consume the palaces of Benhadad.” — and I will kindle a fire in the wall of Damascus, and it shall consume the palaces of Benhadad, the royal dwellings and therewith at least a part, if not all, of the city.

28 Concerning Kedar and concerning the kingdoms of Hazor, which Nebuchadnezzar king of Babylon shall smite, thus saith the Lord: “Arise ye, go up to Kedar, and despoil the men of the East. — concerning Kedar, and concerning the kingdoms of Hazor… a new prophecy concerning the Arabians; for Kedar was a son of Ishmael;

— which Nebuchadnezzar king of Babylon shall smite, thus saith the Lord: that is, “thus saith the Lord concerning”, or “unto” or “against Kedar” as in Jeremiah 49:1 which the king of Babylon “hath smitten” the past for the future, common in prophetic language: or “is about to smite” would do it in a very little time; for the phrase, “thus saith the Lord” is not to be connected with what follows after, but with what goes before; though indeed the next words are the words of the Lord to the Chaldeans:

— and spoil the men of the east; the Arabians, which lay east of Judea and Babylon: or “the children of Kedem” the same with Kedemah, another son of Ishmael, Genesis 25:15; whose posterity dwelt still more to the east; the Targum renders it “the children of the east.”

29 Their tents and their flocks shall they take away; they shall take for themselves their curtains and all their vessels and their camels; and they shall cry unto them, ‘Fear is on every side!’ — their tents and their flocks, the chief possessions of nomads, shall they take away; they shall take to themselves their curtains, the costly woven goods and the hangings of their tents;

— and all their vessels, household utensils as well as such pieces of furniture and adornment as comprised their wealth and their camels; and they, the invading forces, shall cry unto them, in a shout of war, Fear is on every side.

30 Flee, get you far off! Dwell deep, O ye inhabitants of Hazor,” saith the Lord. “For Nebuchadnezzar king of Babylon hath taken counsel against you, and hath conceived a purpose against you. — flee, get you far off, run apace, dwell deep, hide themselves in remote places;

— O ye inhabitants of Hazor! saith the Lord; for Nebuchadnezzar, king of Babylon hath taken counsel against you, devised a plan to subdue them and hath conceived a design against you. This warning is addressed to the wilderness dwellers, since no conqueror would venture to follow them into the trackless wastes of the desert. In the next words the Lord once more turns to the enemies, bidding them continue their work of destruction.

31 “Arise, get you up unto the wealthy nation, that dwelleth without cares,” saith the Lord, “which have neither gates nor bars, which dwell alone. — arise, get you up unto the wealthy nation, a tranquil tribe, having no presentiment of evil that dwelleth without care in calm security, saith the Lord, which have neither gates nor bars, not dwelling in fenced and fortified cities;

— which dwell alone with little or no intercourse with other nations or tribes from which they might expect assistance in case of an attack.

32 And their camels shall be a booty, and the multitude of their cattle a spoil; and I will scatter into all winds them that are in the utmost corners; and I will bring their calamity from all sides thereof,” saith the Lord. — and their camels shall be a booty and the multitude of their cattle a spoil, a welcome bit of plunder for the enemies; 

— and I will scatter into all winds them that are in the utmost corners, those who have the edges of their hair trimmed; for these tribes had the custom of clipping the hair of head and beard in a peculiar angle; and I will bring their calamity from all sides thereof, saith the Lord.

33 “And Hazor shall be a dwelling for dragons, and a desolation for ever; there shall no man abide there, nor any son of man dwell in it.” — and Hazor shall be a dwelling for dragons, the habitation of jackals and a desolation forever; there shall no man abide there nor any son of man dwell in it. This prophecy was fulfilled when the Chaldeans on their way to the West and South, sent detachments of troops to bring these nomadic tribes into subjection.

34 The word of the Lord that came to Jeremiah the prophet against Elam, in the beginning of the reign of Zedekiah king of Judah, saying, — the word of the Lord that came unto Jeremiah the prophet against Elam… the Persians, as it is commonly understood, who descended from Elam the son of Shem, Genesis 10:22; according to Josephus; but rather the country of Elymais is here designed; which though in the times of Cyrus was added to and made a part of the Persian empire, yet was a country distinct both from Persia and Media; and as though as near unto Persia and bordering on Media, a country that belonged to the Assyrians; and so it seems that Elam served under Sennacherib, king of Assyria, when he besieged Jerusalem.

35 “Thus saith the Lord of hosts: “‘Behold, I will break the bow of Elam, the chief of their might. — thus saith the Lord of hosts, I will break the bow of Elam… the inhabitants of this country were famous for their skill in archery; this the Lord threatens to break so that it should be useless and of no more service to them to defend themselves or annoy others. Their strength, as the Targum says; that in which their great strength and security lay; in which they put their trust and confidence;

— the chief of their might; which may be interpreted by way of apposition of their bow, the chief instrument of their might and power; or may design their mighty men, the archers themselves, who should be destroyed, even Elam itself, and all the inhabitants of it especially their warriors, who should be slain or carried captive.

36 And upon Elam will I bring the four winds from the four quarters of heaven, and will scatter them toward all those winds; and there shall be no nation whither the outcasts of Elam shall not come. — and upon Elam will I bring the four winds from the four quarters of heaven… the Targum interprets it the four kingdoms; see Daniel 7:2. Some think this had its accomplishment in the times of Alexander; or else after his death in the times of his four successors; but rather in the times of Nebuchadnezzar, who should bring with him, in his army, people that dwelt in the several parts of the world, comparable to the winds for their swiftness and strength; whose blast would be so great as to drive the Elamites to every part of the world, as every light thing is by the wind:

— and will scatter them towards all those winds; those four winds, east, west, north and south:

— and there shall be no nation whither the outcasts of Elam shall not come; those that are driven out of it, forced to flee from it or are taken captive, should come into the several nations of the world; so that there would not be any in which an Elamite was not.

37 For I will cause Elam to be dismayed before their enemies and before them that seek their life; and I will bring evil upon them, even My fierce anger,’ saith the Lord; ‘and I will send the sword after them till I have consumed them. — for I will cause Elam to be dismayed before their enemies… frightened; thrown into the utmost consternation so that they shall have no heart nor spirit to go out against them and meet them and defend themselves; but make all haste imaginable to flee from them, such a panic would seize them;

— and before them that seek their life; a further description of their enemies; they being such, who, not content with their substance sought to take away their lives; nothing less would satisfy them; being cruel and blood thirsty:

— and I will bring evil upon them even my fierce anger, saith the Lord; and a greater evil than that cannot be; signifying that the destruction that should be made among them would be the effect of the wrath of God upon them for their sins:

— and I will send the sword after them till I have consumed them; that is, those that slay with the sword, as the Targum says; these should go after those that fled and destroy them till the greater part of them were consumed; for all of them that were taken were not destroyed; or otherwise there would have been none to return from captivity as is promised at the close of this prophecy.

38 And I will set My throne in Elam, and will destroy from thence the king and the princes,’ saith the Lord. — and I will set my throne in Elam… either when Alexander subdued it, or Cyrus, or rather Nebuchadnezzar, whose palace probably was, or his successors was, in Shushan in Elam, as before observed from Daniel 8:2. This is called the Lord’s throne, because he gave it to him; his conquest of Elam, and his dominion over it, were from him;

— and will destroy from thence the king and the princes, saith the Lord; so that there should be no more kings of Elam, and princes and nobles of their own after this time; and because mention is made of the kings of Elam in the times of Nebuchadnezzar, Jeremiah 25:25; though that is observed in the first year of his reign, some have thought that it is best to understand it or Cyrus, the Lord’s servant and anointed; and whose throne might well be called the throne of God, which he gave him and set him on in an eminent manner, not only there, but elsewhere; see Ezra 1:2; and when this country of Elam, or Elymais, became at part of the Persian empire, and never had any more kings to reign over it separately.

39 “‘But it shall come to pass in the latter days, that I will bring back the captives of Elam,’ saith the Lord.” — and will destroy from thence the king and the princes, saith the Lord; so that there should be no more kings of Elam, and princes and nobles of their own, after this time; and because mention is made of the kings of Elam in the times of Nebuchadnezzar, Jeremiah 25:25; though that is observed in the first year of his reign, some have thought that it is best to understand it or Cyrus, the Lord’s servant and anointed; and whose throne might well be called the throne of God, which he gave him, and set him on in an eminent manner, not only there, but elsewhere; see Ezra 1:2; and when this country of Elam, or Elymais, became at part of the Persian empire, and never had any more kings to reign over it separately. Some of the Jewish Rabbins interpret the king and princes of Vashti of Haman and his sons; but very wrongly.

— that I will bring again the captivity of Elam, saith the Lord.

Jeremiah 50

The Chaldeans, especially under Nebuchadnezzar their king, has been described by God as “the king of Babylon, My servant” in multiple places (Jeremiah 25:9, 27:6, 43:10). So this and the following chapter contain a long prophecy concerning the destruction of Babylon following their judgement as well.

1 The word that the Lord spoke against Babylon and against the land of the Chaldeans by Jeremiah the prophet: — the word that the Lord spoke against Babylon… Or the city of Babylon, the metropolis of the Chaldean empire; sometimes it signifies the whole country, here the city only as appears by what follows:

— and against the land of the Chaldeans; where the Jews were carried captive, for whose comfort this prophecy is delivered out; and which had subdued other nations, and was become an universal monarchy; these people are mentioned last, because the rest of the nations were to drink the cup of God’s wrath at their hands, and then they were to drink it after them; see Jeremiah 25:9; this is to be understood not only of Babylon and its empire, literally taken, but of mystical Babylon and its dependencies; of Rome and its jurisdiction; of antichrist, and the antichristian states, the last enemies of the church and people of God, who will be destroyed by the pouring out of the seven vials; see Revelation 15:1. This prophecy, which is called “the word that the Lord spoke” for it was from him the warning was decreed and declared.

“Declare ye among the nations, and proclaim and set up a standard; proclaim and conceal not. Say, ‘Babylon is taken, Bel is confounded, Merodach is broken in pieces! Her idols are confounded, her images are broken in pieces!’ — declare ye among the nations and publish and to call the attention of all men to the importance and the significance of this announcement; publish and conceal not; say, Babylon is taken; Bel, the chief deity of the Chaldeans, thought by some to be the same with Baal by contraction;

— is confounded; Merodach, another name for the same idol is broken in pieces. Her idols are confounded, covered with shame and confusion, her images are broken in pieces, powerless before the almighty power of Yehovah.

For out of the north there cometh up a nation against her, which shall make her land desolate, and none shall dwell therein; they shall be removed, they shall depart, both man and beast. — for out of the north there cometh up a nation against her… the Medes and Persians, under Cyrus were one nation; and not only lay north of Judea where this prophecy came, but of Babylon, against which they were to come; and might lay more north to it before the enlargement of their dominions; and besides, Cyrus came through Assyria to Babylon which lay north of it; see Isaiah 41:25

“In those days and in that time,” saith the Lord, “the children of Israel shall come, they and the children of Judah together, going and weeping; they shall go, and seek the Lord their God. — in those days, and at that time, saith the Lord… when Babylon shall be taken and destroyed, then what follows shall be accomplished; which, as it respects the conversion of the Jews, shows that this prophecy is not to be restrained to literal Babylon:

— the children of Israel shall come, they and the children of Judah together: this is prophetic, parallel to Ezekiel 37 where the whole house of Jacob will be joined together.

They shall ask the way to Zion with their faces turned thitherward, saying, ‘Come, and let us join ourselves to the Lord in a perpetual covenant that shall not be forgotten.’ — they shall ask the way to Zion, the habitation of Yehovah, their faces toward Jerusalem with steadfast purpose not to be daunted or to be turned aside by difficulties along the way;

— saying, Come and let us join ourselves to the Lord in a perpetual covenant that shall not be forgotten as the first covenant had been act aside by an apostate nation.

My people hath been lost sheep; their shepherds have caused them to go astray. They have turned them away on the mountains; they have gone from mountain to hill; they have forgotten their resting place. — My people hath been lost sheep; their shepherds have caused them to go astray, the very men who were entrusted with their care being guilty of this gross neglect; they have turned them away on the mountains, the places of idolatry;

— they have gone from mountain to hill, from one altar of idolatrous worship to the next; they have forgotten their resting-place, in the care of Yehovah where they could lie down in safety.

All who found them have devoured them; and their adversaries said, ‘We offend not, because they have sinned against the Lord, the habitation of justice, even the Lord, the hope of their fathers.’ — all that found them have devoured them… as lost and wandering sheep are liable to be found, and to be devoured, by every beast of prey, lions, wolves and bears; so the house of Jacobs were found by their neighbours, their enemies and especially by their endtime “Chaldeans” or “Assyrians” having forsaken God, and being forsaken by him; and which is their case now and are often found and seized upon by their enemies and made a prey of under one pretence or another.

“Depart out of the midst of Babylon, and go forth out of the land of the Chaldeans, and be as the hegoats before the flocks. — remove out of the midst of Babylon, so all Israelites in truth are now warned to go forth out of the land of the Chaldeans where they were as yet held in captivity and be as the he-goats before the flocks, the leaders of all oppressed nations as they now turned to flee.

For lo, I will raise and cause to come up against Babylon an assembly of great nations from the north country, and they shall set themselves in array against her. From thence she shall be taken. Their arrows shall be as of a mighty destroyer; none shall return in vain. — for, lo, I will raise and cause to come up, against Babylon an assembly of great nations from the North country, an army composed of many nations; and they shall set themselves in array against her with full equipment for warfare; 

— from thence, or “there,” she shall be taken, namely, where the hostile nations have assembled themselves; their arrows shall be as of a mighty expert man, one well versed in the art of warfare; none shall return in vain, none of them would fail to perform its deadly work.

10 And Chaldea shall be a spoil; all that despoil her shall be satisfied,” saith the Lord. — and Chaldea shall be a spoil, a prey ready for the invaders; all that spoil her shall be satisfied, saith the Lord, since they were getting all that their heart desired in the way of rich booty. In this sense the Lord now turns directly to Babylon in pronouncing sentence upon the Chaldean Empire.

11 “Because ye were glad, because ye rejoiced, O ye destroyers of Mine heritage, because ye are grown fat as the heifer at grass, and bellow as bulls, — because ye were glad, because ye rejoiced, O ye destroyers of Mine heritage, the Chaldeans called so on account of the pillage committed by them in destroying Judah, because ye are grown fat as the heifer at grass, skipping like a threshing calf or heifer, with proud insolence and bellow as bulls, or “neigh as steeds,” in overweening, challenging pride.

12 your mother shall be sore confounded; she that bore you shall be ashamed. Behold, the hindermost of the nations shall be a wilderness, a dry land and a desert. — your mother shall be sore confounded… the monarchy of the Chaldeans; so the Targum says, your congregation; or rather their metropolis, their mother city, the city of Babylon; which would be confounded when taken, none of her sons being able to defend her: the same will be true of mystical Babylon, the mother of harlots, Revelation 17:5.

13 Because of the wrath of the Lord it shall not be inhabited, but it shall be wholly desolate; every one that goeth by Babylon shall be astonished and hiss at all her plagues. — because of the wrath of the Lord, it shall not be inhabited… that is, Babylon; which the Targum expresses, “because thou, Babylon, hast provoked the Lord” by their idolatry, luxury, ill usage of his people and profanation of the vessels of the sanctuary; therefore it should be destroyed and left without an inhabitant in it.

14 Put yourselves in array against Babylon round about; all ye that bend the bow, shoot at her, spare no arrows, for she hath sinned against the Lord. — put yourselves in array against Babylon round about to surround the city and to attack her from all sides simultaneously; all ye that bend the bow, the archers representing the entire army of the enemy;

— shoot at her, spare no arrows; for she hath sinned against the Lord, she has fully deserved the punishment being meted out to her.

15 Shout against her round about; she hath given her hand. Her foundations are fallen, her walls are thrown down; for it is the vengeance of the Lord. Take vengeance upon her; as she hath done, do unto her. — shout against her round about, encouraging one another with loud and fierce battle-cries; she hath given her hand, thereby submitting to the conquerors; her foundations are fallen, the fortifications in which she trusted for safety;

— her walls are thrown down, so that she is now helpless before the invaders; for it is the vengeance of the Lord, the destruction of Babylon was a punishment determined by Him; take vengeance upon her, retaliation being permitted in this instance; as she hath done to others.

16 Cut off the sower from Babylon, and him that handleth the sickle in the time of harvest; for fear of the oppressing sword they shall turn every one to his people, and they shall flee every one to his own land. — cut off the sower from Babylon and him that handleth the sickle, or scythe in the time of harvest so that both sowers and reapers would be destroyed and there could be no harvesting in the entire country; 

— for fear of the oppressing sword they shall turn every one to his people and they shall flee every one to his own land, the strangers in the country getting ready to preserve their lives before the threatening catastrophe comes. Over against this fate of Babylon is placed the deliverance of Judah from oppression and exile.

17 “Israel is a scattered sheep; the lions have driven him away. First the king of Assyria hath devoured him, and last this Nebuchadnezzar king of Babylon hath broken his bones.” — Israel is a scattered sheep… Or like a sheep that is frightened and drove from the fold and is dispersed and wanders about here and there; Israel includes all the twelve tribes:

— the lions have driven him away; from his own land and carried him captive and scattered him among the nations; these lions are afterwards interpreted of the kings of Assyria and Babylon: so the Targum says. “kings have removed them” comparable to lions for their strength, fierceness and voraciousness;

— first the king of Assyria hath devoured him; eaten up his flesh; meaning Shalmaneser king of Assyria, who carried captive the ten tribes that never returned and therefore said to be devoured:

— and last this Nebuchadrezzar king of Babylon hath broken his bones; or “boned him” took out his bones, all his strength and substance; or took the flesh off of them, stripped him of all his wealth and riches, reduced him to his bones, made a mere skeleton of him:

18 Therefore thus saith the Lord of hosts, the God of Israel: “Behold, I will punish the king of Babylon and his land, as I have punished the king of Assyria. — as I have punished the king of Assyria; not Shalmaneser, that carried the tribes captive; but a successor of his, Chynilidanus, the last king of Assyria; who was killed when Nineveh was taken, the metropolis of Assyria and which was done before this prophecy was delivered; and the return to their own land; which is prophesied in Jeremiah 50:19.

19 And I will bring Israel again to his habitation; and he shall feed on Carmel and Bashan, and his soul shall be satisfied upon Mount Ephraim and Gilead. — and he shall feed on Carmel and Bashan, and his soul shall be satisfied upon Mount Ephraim and Gilead; and as they were all fruitful places and had good pasturage, so they belonged to the ten tribes; which shows that it respects the return of them and the fulness of blessings, both temporal and spiritual, they shall then enjoy.

20 In those days and in that time,” saith the Lord, “the iniquity of Israel shall be sought for, and there shall be none; and the sins of Judah and they shall not be found: for I will pardon them whom I reserve. — in those days and in that time, saith the Lord, the prophecy now again turning to the endtime, the iniquity of Israel shall be sought for, and there shall be none, no longer any guilt would be charged against it; 

— and the sins of Judah and they shall not be found; for I will pardon them whom I reserve, granting them forgiveness and pardon by virtue of the Messiah’s merits. If enemies of the Lord, whom He, for any reason whatever, has used as His instruments to carry out His plans, become overbearing and insolent as a consequence, He readily plunges them from the height of their pride to the depths of humiliation and confusion.

21 “Go up against the land of Merathaim, even against it and against the inhabitants of Pekod. Waste and utterly destroy after them,” saith the Lord, “and do according to all that I have commanded thee. — go up against the land of Merathaim… thought to be the country of the Mardi, which lay part of it in Assyria, and part of it in Armenia; Cyrus, with his army of Medes and Persians, who according to Herodotus, passed through Assyria to Babylon: and so it may be agreeably rendered, “go by the land of Merathaim” or the country of the Mardi; the Targum says, “the land of the rebellious people.”

22 A sound of battle is in the land, and of great destruction.

23 How the hammer of the whole earth is cut asunder and broken! How Babylon hath become a desolation among the nations! — how is the hammer of the whole earth cut asunder and broken!.. the Targum says, “how is the king cut down and broken that moved the whole earth!”

— the king of Babylon or the kingdom of Babylon, which was like a hammer for its hardness and strength; and being an instrument in the hand of God of beating to pieces and destroying kingdoms and nations; but is itself now destroyed. These are the words either of the prophet or rather of the people of other nations, wondering how this destruction came about and rejoicing at it;

— how is Babylon become a desolation among the nations! this explains who and what is meant by the hammer of the earth and by its being cut asunder and broken; even the utter destruction of the city and kingdom of Babylon.

24 I have laid a snare for thee, and thou art also taken, O Babylon, and thou wast not aware; thou art found and also caught, because thou hast striven against the Lord. — I have laid a snare for thee, and thou art also taken, O Babylon… retorting to the strategy that Cyrus used, in draining the river Euphrates, and marching his army up through it into the midst of the city of Babylon and took it by surprise while the inhabitants were feasting and revelling all night: this is said to be a snare laid by the Lord because it was according to the counsel of his will and through his directing and overruling providence:

— and thou wast not aware; of what the enemy had done of his march into the city and taking of it; for one part of the city was seized and taken before the other knew anything of it:

— thou art found, and also caught; as wild beasts in a net or birds in a snare. The Targum says, “thy sins are sought and are found and also thou art taken:”

— because thou hast striven against the Lord; as persons litigate a point with each other in courts of judicature or as warriors strive against each other in battle; she sinned against the Lord and offended him, not only by her idolatry and luxury, but by her oppression of his people and profaning the vessels of his house; as Belshazzar did, the night Babylon was taken. The Targum says, “for with the people of the Lord thou hast strove.”

25 The Lord hath opened His armory and hath brought forth the weapons of His indignation; for this is the work of the Lord God of hosts in the land of the Chaldeans. — and hath brought forth the weapons of his indignation; as a king, when he goes to war, opens his armoury and takes out armour of every kind, both offensive and defensive: swords, spears, shields, so the Lord would now bring the Medes and Persians, well armed, to be the instruments of his wrath and vengeance on Babylon: or, “the vessels of his indignation” having some view to the vessels of the sanctuary, the king of Babylon had taken away and profaned them; these may well be applied to the vials of wrath poured out on them by the angels, called forth out of the temple.

26 Come against her from the utmost border; open her storehouses. Cast her up as heaps and destroy her utterly; let nothing of her be left. — come against her from the utmost border, from the most remote corner of the earth, or “all men, down to the very last,” open her storehouses; cast her up as heaps, that is, all the plunder of the city and destroy her utterly; let nothing of her be left, the city with all its possessions and treasures was to be burned with fire.

27 Slay all her bullocks; let them go down to the slaughter. Woe unto them! For their day has come, the time of their visitation. — slay all her bullocks, her entire population; let them go down to the slaughter. Woe unto them! for their day is come, the time of their visitation, their punishment at the hands of Yehovah.

28 The voice of them that flee and escape out of the land of Babylon, to declare in Zion the vengeance of the Lord our God, the vengeance of His temple. — the voice of them that flee and escape out of the land of Babylon, the fugitives saving their lives in the midst of the general destruction to declare in Zion the vengeance of the Lord our God, the vengeance of His Temple, for by the destruction of Babylon the Lord punished the Chaldeans for their profanation of His Sanctuary on Zion.

29 “Call together the archers against Babylon. All ye that bend the bow, camp against it round about; let none thereof escape. Recompense her according to her work; according to all that she hath done, do unto her. For she hath been proud against the Lord, against the Holy One of Israel. — call together the archers against Babylon for the siege of the city; all ye that bend the bow, camp against it round about, leaving no loophole for escape; let none thereof escape. Recompense her according to her work;

— according to all that she hath done, do unto her, paying her back in her own coin; for she hath been proud against the Lord, against the Holy One of Israel, this pride being the fundamental transgression and fault of Babylon, a form of blasphemy challenging the Lord’s honor.

30 Therefore shall her young men fall in the streets, and all her men of war shall be cut off in that day,” saith the Lord. — therefore shall her young men fall in the streets… Or “surely” it is the form of an oath, according to Rashi, Cyrus, when he took Babylon, ordered proclamation to be made that the inhabitants should keep indoors; and that whoever were found in the streets should be put to death as doubtless many were: and all her men of war shall be cut off in that day, saith the Lord; as Belshazzar and his guards were; see Daniel 5:30.

31 “Behold, I am against thee, O thou most proud,” saith the Lord God of hosts; “for thy day is come, the time that I will visit thee. — behold, I am against thee, O thou most proud, saith the Lord God of hosts, coming to teach her humility; for thy day is come, the time that I will visit thee to bring His punishment upon her in full measure.

32 And the most proud shall stumble and fall, and none shall raise him up; and I will kindle a fire in his cities, and it shall devour all round about him.” — and the most proud shall stumble and fall, literally, “Then pride totters and falls,” the abstract being used to emphasize Babylon’s guilt, and none shall raise him up; and I will kindle a fire in his cities and it shall devour all round about him, the smaller cities sharing the fate of the metropolis.

33 Thus saith the Lord of hosts: “The children of Israel and the children of Judah were oppressed together, and all that took them captives held them fast; they refused to let them go. — thus saith the Lord of hosts, The children of Israel and the children of Judah were oppressed together in the captivity of the exile, and all that took them captives held them fast, were still holding them at the time when this prophecy was given; they refused to let them go so that it might seem as though deliverance were a matter far beyond any possibility. Over against this, however, stands the strong assurance of Yehovah.

34 Their Redeemer is strong; the Lord of hosts is His name. He shall thoroughly plead their cause, that He may give rest to the land, and disquiet the inhabitants of Babylon. — their Redeemer is strong, the Lord of hosts is His name, the Commander of all the heavenly armies; He shall thoroughly plead their cause, taking their part with all needed energy;

— that He may give rest to the land so that Judah would once more enjoy peace and security and, on the contrary, disquiet the inhabitants of Babylon who thought that they were altogether secure against all enemies. In order to take the part of His people with the proper zeal, the Lord now calls upon the sword to perform its work against the Chaldeans.

35 “A sword is upon the Chaldeans,” saith the Lord, “and upon the inhabitants of Babylon, and upon her princes, and upon her wise men! — a sword is upon the Chaldeans, saith the Lord… Or, “shall be” or “O sword, be thou on the Chaldeans” that is, the sword of the Medes and Persians; those that kill with the sword, as the Targum says;

— and upon the inhabitants of Babylon; the metropolis of Chaldea; the common people in it as distinguished from those of high rank and degree following: and upon her princes; Belshazzar and his nobles who were slain the night Babylon was taken;

— and upon her wise men; prime ministers, politicians, and counsellors of state; neither high birth nor great wisdom can secure from the sword of the enemy when it has a commission from God as it had here.

36 A sword is upon the liars, and they shall dote! A sword is upon her mighty men, and they shall be dismayed! — a sword is upon the liars… the Targum renders it “diviners” and so Rashi agrees of which there were many among the Chaldeans who were a lying set of men who imposed upon and deceived the people; these with their divinations and soothsayings could not save the land, nor themselves from the devouring sword; nay, their sorceries and divinations were the cause of their ruin.

37 A sword is upon their horses and upon their chariots, and upon all the mingled people that are in the midst of her, and they shall become as women! A sword is upon her treasures, and they shall be robbed! — a sword is upon their horses and upon their chariots which were her boast in warfare and upon all the mingled people that are in the midst of her, her mercenaries and allies;

— and they shall become as women, weak and utterly unable for effective resistance; a sword is upon her treasures, the wealth which she had accumulated in the course of her campaigns and they shall be robbed.

38 A drought is upon her waters, and they shall be dried up! For it is the land of graven images, and they are mad over their idols. — a drought is upon her waters, and they shall be dried up, the dams and irrigation canals being destroyed by the invading army; for it is the land of graven images and they are mad upon their idols, literally, “their objects of horror or terror,” for the images which are usually found in heathen sanctuaries are really more likely to frighten than to attract. They have indulged in gross and revolting idolatry and must therefore bear their iniquity.

39 Therefore the wild beasts of the desert with the wild beasts of the islands shall dwell there, and the owls shall dwell therein; and it shall be no more inhabited for ever, neither shall it be dwelt in from generation to generation. — therefore the wild beasts of the desert with the wild beasts of the islands, the jackals shall dwell there and the owls, literally, “daughters of crying,” that is, the female ostriches shall dwell therein and it shall be no more inhabited forever, neither shall it be dwelt in from generation to generation.

40 As God overthrew Sodom and Gomorrah and the neighbor cities thereof,” saith the Lord, “so shall no man abide there, neither shall any son of man dwell therein. — so shall no man abide there, neither shall any son of man dwell therein; the same is said concerning Edom.

41 “Behold, a people shall come from the north, and a great nation, and many kings shall be raised up from the borders of the earth. — behold, a people shall come from the north and a great nation… the Modes and Persians, whose country lay north of Babylon.

42 They shall hold the bow and the lance; they are cruel and will not show mercy; their voice shall roar like the sea, and they shall ride upon horses, every one put in array like a man to the battle, against thee, O daughter of Babylon. — they shall hold the bow and the lance… Or “spear” the Targum interprets it, “shields” as many in Cyrus’s army had them; the one an offensive, the other a defensive weapon; or if bow and lance, the one is used at a distance, the other when near. The Medes and Persians were well skilled in handling the bow, the armour with large bows and short spears; besides bows and arrows, they had two javelins or lances, one of which they cast, and the other they held and used in their hands as they found necessary; and so Cyrus in a speech of his, says that they had breast plates to cover their bodies and lances or javelins which they could use by throwing or holding, as they pleased:

— they are cruel, and will not show mercy: not even to infants but dash them against the stones.

43 The king of Babylon hath heard the report of them, and his hands waxed feeble; anguish took hold of him, and pangs as of a woman in travail. — the king of Babylon hath heard the report of them… Belshazzar had the report brought to him of an invasion of his land; of their approach to Babylon and design upon it and of their number, character and force:

— and his hands waxed feeble as they did when he saw the handwriting upon the wall, Daniel 5:6;

— anguish took hold of him, and pangs as of a woman in travail; a sudden panic seized him and he was quite dispirited at once as a woman in childbirth, when her pains come upon her and there is no avoiding them.

44 Behold, he shall come up like a lion from the swelling of the Jordan unto the habitation of the strong; but I will make them suddenly run away from her. And who is a chosen man that I may appoint over her? For who is like Me? And who will appoint Me the time? And who is that shepherd that will stand before Me?” — behold, he shall come up like a lion from the swelling of Jordan… what is said of Nebuchadnezzar coming up against Edom is here said of Cyrus coming up against Babylon; for of a king it is to be understood; as the Targum says, “behold, a king with his army shall come up against them, as a lion from the height of Jordan;”

— and who is that shepherd that will stand before me? or king? not Belshazzar, he could not stand before the Lord: so the Targum says “there is no king that hath strength before me” that is, to withstand him or hinder what he has appointed and ordered to be done.

45 Therefore hear ye the counsel of the Lord that He hath taken against Babylon, and His purposes that He hath purposed against the land of the Chaldeans. Surely the least of the flock shall draw them out; surely He shall make their habitation desolate with them. — surely the least of the flock shall draw them out; the weakest and most feeble in the army of Cyrus should be more than a match for any in Babylon and should draw them out and devour them as dogs and wolves the sheep out of the flock.

46 At the noise of the taking of Babylon the earth is moved, and the cry is heard among the nations. — at the noise of the taking of Babylon the earth is moved… it being so sudden and unexpected and so very astonishing:

— and the cry is heard among the nations that Babylon is fallen; which, as applied to mystical Babylon, will be matter of joy to some and of lamentation to others; see Revelation 14:8.

Jeremiah (Ch 47-48)

•November 23, 2021 • Leave a Comment

Chapter 47 contains a prophecy of the destruction of the Philistines chiefly; and also of the Tyrians and Zidonians; Chapter 48 is a prophecy about Moab. 

Jeremiah 47

1 The word of the Lord that came to Jeremiah the prophet against the Philistines, before Pharaoh smote Gaza. — before Pharaoh smote Gaza; one of the five cities of ancient Philistines, a very strong and fortified place, but now it is considered a region of the Philistines;

— before Pharaoh struck Gaza: Rashi: when Nebuchadnezzar besieged Jerusalem in the tenth year of Zedekiah, Pharaoh’s army came forth from Egypt, and the Chaldeans withdrew from Jerusalem. Pharaoh heard about the Chaldeans withdrawal and invaded Gaza, then returned to Egypt.

Thus saith the Lord: “Behold, waters rise up out of the north, and shall be an overflowing flood, and shall overflow the land, and all that is therein, the city, and them that dwell therein; then the men shall cry, and all the inhabitants of the land shall howl. — thus saith the Lord, behold, waters rise up out of the north… meaning an army of men which should come in great numbers and with great force and rapidity like an overflowing flood. So the Targum says, “behold, people shall come from the north” that is, from Chaldea, which lay north of Palestine.

At the noise of the stamping of the hoofs of his strong horses, at the rushing of his chariots and at the rumbling of his wheels, the fathers shall not look back to their children for feebleness of hands, — at the noise of the stamping of the hoofs of his strong horses… the noise of the cavalry of Nebuchadnezzar’s army as they came marching on towards the country of the Philistines; who, being mounted on strong prancing horses made a great noise as they came along and were heard at a distance:

— the fathers shall not look back to their children for feebleness of hands; they would be so frightened at the approach of the enemy and flee with much precipitancy to provide for their own safety that they should not think of their children or stay to deliver and save them; being so terrified as not to be able to lift up their hands to defend themselves and protect their children.

because of the day that cometh to despoil all the Philistines, and to cut off from Tyre and Sidon every helper that remaineth; for the Lord will despoil the Philistines, the remnant of the country of Caphtor. — to cut off from Tyrus and Zidon every helper that remaineth; these were cities in Phoenicia which bordered on the country of the Philistines who were their auxiliaries in time of distress; but now, being wasted themselves could give them no help when Nebuchadnezzar attacked them; as did Tyre in particular, which he besieged thirteen years, and at last destroyed it and Zidon with it.

Baldness is come upon Gaza; Ashkelon is cut off with the remnant of their valley. How long wilt thou cut thyself?” — baldness is come upon Gaza… the Targum says, “vengeance is come to the inhabitants of Gaza” it’s like a man whose hair is fallen from his head, or is clean shaved off; its houses were demolished; its inhabitants slain, and their wealth plundered; a pillaged and depopulated place. Some understand this of shaving or tearing off the hair for grief and mourning because of their calamities.

O thou sword of the Lord, how long will it be ere thou be quiet? Put up thyself into thy scabbard; rest and be still. — O thou sword of the Lord… for though it was the sword of the Chaldeans, yet being appointed and sent by the Lord, and having a commission from him and being ordered and directed in his providence to do his will, it is called his sword;

— and because, in multiple places (Jeremiah 25:9, Jeremiah 27:6, Jeremiah 43:10), God describes the one with his sword, Nebuchadnezzar, as “the king of Babylon, My servant.”

How can it be quiet, seeing the Lord hath given it a charge against Ashkelon and against the seashore? There hath He appointed it. — seeing the Lord hath given it a charge against Ashkelon and against the seashore? for it had a commission from the Lord to destroy the inhabitants of Ashkelon and other places, which lay still more towards the sea as Joppa and Jamne; and indeed all Palestine lay on the coast of the Mediterranean sea.

Jeremiah 48

Heshbon was the capital city of the Moabites: when the Chaldeans made themselves masters of Heshbon, a place of great importance, they consulted how to carry on their conquests over the rest of the country.

Ancient Heshbon was beyond, i.e. east of the Jordan. The city was where the Israelites passed by on their entry to the Promised Land and was assigned to the tribe of Reuben; afterwards it was given to the Tribe of Gad and became a Levitical city for the Merarites.

Heshbon is mentioned in the Tanakh in the Books of Numbers and Deuteronomy as the capital of Amorite king, Sihon (or Sehon). The biblical narrative records the story of the Israelite victory over Sihon during the time of Moses. Heshbon is highlighted due to its importance as the capital of Sihon, King of the Amorites: “For Heshbon was the city of Sihon, king of the Amorites, who had fought against the former king of Moab and had taken all his land out of his hand, as far as Arnon.”

Similar passages appear in Deuteronomy and Joshua, with the primary emphasis being the victory of the Israelites over King Sihon at the site of Heshbon. Moses died soon after the victory, after viewing the “promised land” from the top of Mount Nebo.

Following the death of Moses, Heshbon became a town at the border between the lands allocated to the Tribe of Reuben and the Tribe of Gad. Further biblical evidence suggests that the town later came under Moabite control, as mentioned by Isaiah and Jeremiah in their denunciations of Moab, and later under Ammonite occupation as Jeremiah 49:3 strongly suggests.

1 Against Moab, thus saith the Lord of hosts, the God of Israel: “Woe unto Nebo! For it is despoiled; Kiriathaim is confounded and taken; Misgab is confounded and dismayed. — against Moab; thus saith the Lord of hosts, the God of Israel, Woe unto Nebo! an important city in Southwestern Moabitis. For it is spoiled, laid waste by the enemies; Kiriathaim, another ancient city of the country, is confounded and taken; Misgab, literally, “the citadel,” probably Kir-Moab, the strongest fort of the Moabites, or a general expression denoting the overthrow of Moab’s power, is confounded and dismayed.

There shall be no more praise of Moab; in Heshbon they have devised evil against it; ‘Come, and let us cut it off from being a nation.’ Also thou shalt be cut down, O Madmen; the sword shall pursue thee. — come, and let us cut it off from being a nation: this is what the Babylonians consulted together against Heshbon; and not only against that, a principal city; but against the whole country of Moab, to make such an entire desolation of it, that it should be no more a nation: that which the Moabites with others devised against the people of Israel is now devised against them; a just retaliation perhaps; see Psalms 83:4.

“A voice of crying shall be from Horonaim: ‘Despoiling and great destruction!’ — a voice of crying shall be from Horonaim… another city of Moab. The word Horonaim is a dual number; as there were two Horons, the upper and the lower; of this place should also be destroyed; and so a cry of its inhabitants should be heard out of it.

Moab is destroyed; her little ones have caused a cry to be heard. — either the whole nation in general; so the Targum, “the kingdom of Moab is broken.”

For in the going up of Luhith continual weeping shall go up; for in the going down of Horonaim the enemies have heard a cry of destruction. — for in the going up of Luhith continual weeping shall go up… this is another city, which was built on a high hill which had a considerable ascent to it, where those that escaped from Horonaim might flee for safety; but as they went up the hill would weep bitterly and all the way they went, because of the loss of friends and sustenance, and the danger they themselves were still in. Of this place came the Chaldeans and they heard the cries of those that fled from Horonaim and went up from thence to Luhith, and the cries continues.

Flee, save your lives, and be like a naked tree in the wilderness. — flee, save your lives… these are either the words of the Moabites, their cry of destruction mentioned above, who seeing nothing but ruin before their eyes, advise one another to flee in all haste and save their lives if possible since nothing else could be saved.

For because thou hast trusted in thy works and in thy treasures, thou shalt also be taken; and Chemosh shall go forth into captivity with his priests and his princes together. — and Chemosh shall go forth in captivity with his priests and his princes together; this was the god of the Ammonites, Judges 11:24; and of the Moabites, 1 Kings 11:7; hence the Moabites are called the people of Chemosh, Numbers 21:29.

And the spoiler shall come upon every city, and no city shall escape; the valley also shall perish, and the plain shall be destroyed, as the Lord hath spoken. — and the spoiler shall come upon every city… that is, Nebuchadnezzar king of Babylon and his army. The Targum says, the spoilers, who came against and took every city of Moab and wasted them. Josephus makes particular mention of Nebuchadnezzar subduing the Ammonites and Moabites: and no city shall escape; the spoiler and destruction by him;

— the valley also shall perish and the plain destroyed, as the Lord hath spoken; not only the cities and their inhabitants; but the inhabitants of the valleys and plains as the Targum paraphrases it should be destroyed; and also the corn that grew upon them and the flocks and herds that grazed there, exactly as the Lord had foretold.

“Give wings unto Moab, that it may flee and get away; for the cities thereof shall be desolate, without any to dwell therein. — give wings unto Moab that it may flee and get away… that is, give wings to the inhabitants of Moab; signifying that they were in great danger and no probability of escape unless they had the wings of a swift bird; and passing away with wings may signify not their fleeing from danger and their attempt to escape; but their swift and sudden destruction;

— the Targum says, “take away the crown from Moab, for going it shall go away into captivity.”

10 “Cursed be he that doeth the work of the Lord deceitfully, and cursed be he that keepeth back his sword from blood. — cursed be he that doeth the work of the Lord deceitfully… which is said with respect to the Chaldeans, who were enjoined to destroy the Moabites; which is called the work of the Lord because he had given them a commission to do; and which was to be done by them, not by halves, or in a remiss and negligent manner, but fully and faithfully; they were not to spare them, as Saul did the Amalekites; all should be done in uprightness and sincerity with all faithfulness and integrity: it is done deceitfully when men play the hypocrite; and negligently when they are backward to it, lukewarm in it, and infrequent in its performance which brings upon them the curse of God;

— and cursed be he that keepeth back his sword from blood; from shedding the blood of the Moabites, when God had given command to do it. The curse is repeated to confirm the matter that it might be most assuredly expected; since it would certainly come if the Lord’s work was not done aright.

11 “Moab hath been at ease from his youth, and he hath settled on his lees, and hath not been emptied from vessel to vessel, neither hath he gone into captivity; therefore his taste remained in him, and his scent is not changed.

12 “Therefore, behold, the days come,” saith the Lord, “that I will send unto him wanderers, who shall cause him to wander, and shall empty his vessels and break their bottles. — a change would be made, and that in a very short time, as according to Josephus, it was about five years after the destruction of Jerusalem that the Moabites were subdued by the king of Babylon;

— but there is also a subtle change of theme, from immediate historic to prophetic; behold, the days are coming, indicating during the latter days; this being their case, this prophecy might be for the endtime;

— the Targum says, “I will send spoilers upon them, and they shall spoil them, and empty their substance, and consume the good of their land” whereas the Septuagint version is, “they shall cut in pieces his horns.”

13 And Moab shall be ashamed of Chemosh, as the house of Israel was ashamed of Bethel, their confidence. — and Moab shall be ashamed of Chemosh… Moab’s idol; Jeremiah 48:7; of his worship of him, prayers to him, and confidence in him; he not being able to save him from the destruction of the Chaldeans and being carried captive by them; he himself also going into captivity;

— as the house of Israel were ashamed of Bethel their confidence; that is, of the golden calf that was set up in Bethel by Jeroboam and which the ten tribes of Israel worshipped; but that could not save them from being carried captive by the Assyrians; and so were ashamed of their idolatrous worship.

14 “How say ye, ‘We are mighty and strong men for the war’? — how say ye, we are mighty and strong men for the war? the Moabites were proud, haughty and arrogant; boasted much of their strength and valour; of the strength of their bodies and fitness for war, and their fortified cities; and secure from all danger: so for their pride, vanity and self-confidence, they are reproved here since their destruction was at hand.

15 Moab is despoiled and gone up out of her cities, and his chosen young men are gone down to the slaughter,” saith the King, whose name is the Lord of hosts. — Moab is spoiled, the whole country is ruined; which is spoken of as present though a future scenario, too, after the manner of prophecy;

— and gone up out of her cities; the inhabitants of Moab were gone up out of their cities, either through fear and flight; or through force, being made to go out of them and were carried captive. The Targum says, “the Moabites are spoiled, and their cities are desolate.”

16 “The calamity of Moab is near to come, and his affliction hasteneth fast. — the calamity of Moab is near to come… as it did come within live years after the destruction of Jerusalem, as observed on Jeremiah 48:12; and from Josephus: and his affliction hasteth fast; or “his evil” the evil of punishment for his sin is utter destruction.

17 All ye that are about him, bemoan him; and all ye that know his name, say, ‘How is the strong staff broken, and the beautiful rod!’ — all ye that are about him, bemoan him… the neighbouring nations such as the Ammonites and others are called upon to condole the sad case of Moab; all upon the borders of the country of Moab, either within them or without them.

18 Thou daughter that dost inhabit Dibon, come down from thy glory, and sit in thirst; for the despoiler of Moab shall come upon thee, and he shall destroy thy strongholds. — thou daughter that inhabit Dibon… a city in Moab; the Targum says, “O kingdom of the congregation of Dibon” but this was not a kingdom of itself, though a principal city in the kingdom of Moab.

19 O inhabitant of Aroer, stand by the way and espy; ask him that fleeth and her that escapeth, and say, ‘What is done?’ — O inhabitant of Aroer, another city that belonged to Moab situated on the border towards Ammon, near the river Arnon.

20 Moab is confounded, for it is broken down. Howl and cry! Tell ye it in Arnon that Moab is despoiled! — tell ye it in Arnon, that Moab is spoiled; the country of Arnon, so called from a river of that name, on the banks of which Aroer was situated; the inhabitants of which are desired to spread it all over that part of the country that Moab was utterly ruined by the Chaldean army.

21 “And judgement has come upon the plain country: upon Holon, and upon Jahazah, and upon Mephaath, — and judgement has come upon the plain country, upon the plateau; north of the Arnon, cities which had been in the possession of the tribe of Reuben for some centuries after the conquest, upon Holon, and upon Jahazah, and upon Mephaath,

22 and upon Dibon, and upon Nebo, and upon Bethdiblathaim,

23 and upon Kiriathaim, and upon Bethgamul, and upon Bethmeon,

24 and upon Kerioth, and upon Bozrah, and upon all the cities of the land of Moab, far or near.

25 The horn of Moab is cut off, and his arm is broken,” saith the Lord. — the horn of Moab, emblem of strength and sovereignty, is cut off, and his arm is broken, saith the Lord, he has lost all his former great power, his mighty position is shattered. All this, as the prophet now points out, is the result of Moab’s pride.

26 “Make ye him drunken, for he magnified himself against the Lord. Moab also shall wallow in his vomit, and he also shall be in derision. — make ye him drunken… not with wine, but with the cup of divine wrath; with the vengeance of God; with sore judgements, afflictions and calamities; give him his fill of them till he is quite intoxicated and has lost his senses and is brought to madness and distraction and reels, staggers and falls to the ground like a drunken man; and his state and kingdom ruined: this is said to the enemies of Moab, the king of Babylon and his army;

— the Targum interprets it of the people of God, paraphrasing; “bring distress upon them, that they may be like to drunken men; for against the people of the Lord have they magnified themselves.”

27 For was not Israel a derision unto thee? Was he found among thieves? For since thou spokest of him, thou skipped for joy. — for was not Israel a derision unto thee? in the time of his calamity when the ten tribes were carried captive by the Assyrians some years ago; and of late the two tribes of Judah and Benjamin by the Chaldeans; the Moabites rejoiced at this, which they ought not to have done;

— for since thou spoke of him, thou skipped for joy; or, “shookedst thyself” whenever the Moabites spoke of the distresses and calamities of Israel and of their captivity they laughed till they shook themselves; not only shook their heads but their whole bodies. The Targum says, “and because ye have multiplied words against them, therefore ye shall go into captivity.”

28 “O ye that dwell in Moab, leave the cities and dwell in the rock, and be like the dove that maketh her nest in the sides of the hole’s mouth.

29 We have heard the pride of Moab (he is exceeding proud)— his loftiness, and his arrogancy, and his pride, and the haughtiness of his heart.

30 I know his wrath,” saith the Lord, “but it shall not be so; his lies shall not so effect it. — I know his wrath, saith the Lord… against the Jews and other nations; what he has threatened to do unto them and would do if not restrained.

31 Therefore will I howl for Moab, and I will cry out for all Moab; Mine heart shall mourn for the men of Kirheres.

32 O vine of Sibmah, I will weep for thee with the weeping of Jazer; thy plants are gone over the sea, they reach even to the sea of Jazer. The spoiler is fallen upon thy summer fruits and upon thy vintage, — O vine of Sibmah, I will weep for thee with the weeping of Jazer… Sibmah was a city in the land of Moab abounding with vines, but now should be destroyed; and Jazer another city in the same country, which was destroyed before the other; and therefore its destruction should be lamented and wept over, as that had been: or “from” or “after the weeping of Jazer,” 

— the spoiler is fallen upon thy summer fruits and upon thy vintage: the king of Babylon, who came upon them with his army in the summer season and at the time of their vintage and devoured the fruits of their vines and fig trees with which this country abounded; and so impoverished and ruined them;

— the Targum of the whole says, “therefore as I have brought an army against Jazer, so I will bring slayers against Sibmah; they that carry them captive have waded; they have passed through the sea; they are come to the sea of Jazer; upon thy harvest, and upon thy vintage, the spoilers are fallen.”

33 and joy and gladness is taken from the plentiful field and from the land of Moab. And I have caused wine to fail from the wine presses; none shall tread with shouting; their shouting shall be no shouting. — the land of Moab, where there were good pasture, corn and fruit bearing trees, which produced great plenty of good things and caused joy to the owners of them: but now all being destroyed by the enemy, joy and gladness would cease.

34 “From the cry of Heshbon even unto Elealeh, and even unto Jahaz have they uttered their voice, from Zoar even unto Horonaim, as a heifer of three years old; for the waters also of Nimrim shall be desolate. — from the cry of Heshbon even unto Elealeh… two cities in the land of Moab; also see Isaiah 15:4. Heshbon being destroyed, a cry was made by its inhabitants which either reached Elealeh; or the destruction being carried on to that city, the cry continued there.

35 Moreover I will cause to cease in Moab,” saith the Lord, “him that offereth in the high places and him that burneth incense to his gods. — moreover I will cause to cease in Moab, saith the Lord, him that offereth in the high places… a burnt offering there; that is, the priest, who shall be taken and carried captive, Jeremiah 48:7; even everyone of them so that there will not be one left to offer sacrifice:

— and him that burneth incense to his gods: Chemosh, and others, the Moabites worshipped: this suggests that idolatry was one of the sins for which they were punished; and as all places and all sorts of persons should suffer in this calamity, so likewise idolatrous places, priests and worshippers.

36 Therefore Mine heart shall sound for Moab like pipes, and Mine heart shall sound like pipes for the men of Kirheres, because the riches that he hath gotten have perished. — therefore my heart shall sound for Moab like pipes… that are sounded on mournful occasions, as at funerals; this the prophet said, the inhabitants of Moab, whose hearts would yearn and sound for the calamities of their country like the doleful sound of minstrels. So the Targum says, “therefore the Moabites shall sound in their hearts like a harp;”

— because the riches that he hath gotten is perished; either Moab or Kirheres; the abundance of goods they had got together were now lost, falling into the hands of the enemy; and which was matter of lamentation. The Targum says, “for the rest of their substance they had got were spoiled.”

37 “For every head shall be bald and every beard clipped; upon all the hands shall be cuts and upon the loins sackcloth. — for every head shall be bald and every beard clipped… men, in times of mourning, used to pluck off the hairs of their head till they made them bald and shaved their beards which were the glory of their faces; see Isaiah 15:2;

— upon all the hands shall be cuttings: it was usual with the heathens to make incisions in several parts of their bodies, particularly in their hands and arms with their nails or with knives, in token of mourning; which are forbidden by the Israelites, Deuteronomy 14:1;

— and upon the loins sackcloth; this is a well known custom for mourners to put off their clothes and put on sackcloth; all these things are mentioned to show how great was the mourning of Moab for its calamities.

38 There shall be lamentation generally upon all the housetops of Moab and in the streets thereof; for I have broken Moab like a vessel wherein is no pleasure,” saith the Lord. — for I have broken Moab like a vessel wherein is no pleasure, saith the Lord; as an earthen vessel which the potter does not like and which is useless and unprofitable to any, and which he takes and dashes into pieces; into a thousand shivers and can never be put together again; or as a filthy unclean vessel a man cannot bear in his sight: Moab is by the Lord called his wash pot, Psalms 60:8. The Moabites were vessels of wrath, fitted for destruction by their own this; and now its time has come.

39 “They shall howl, saying, ‘How it is broken down! How hath Moab turned the back with shame!’ So shall Moab be a derision and a dismaying to all those about him.” — they shall howl, saying, how is it broken down?… Or, “how is it broken” or “thrown into consternation? they howl” that is, they howl out these words, or while they are howling, say, how is Kirheres or Moab broken all to pieces; their strength, power and glory; their cities and their mighty men; and are in the utmost fright and confusion? Rashi takes it to be an imperative and paraphrases it, “howl ye over her, and say, how is it broken!”

40 For thus saith the Lord: “Behold, he shall fly as an eagle, and shall spread his wings over Moab. — for thus saith the Lord, behold, he shall fly as an eagle… the enemy, Nebuchadnezzar king of Babylon, with his army; who is compared to an eagle for his strength, swiftness and greediness after the prey:

— and shall spread his wings over Moab as an eagle spreads its wings, which are very large over the little birds it seizes upon as its prey; so the king of Babylon would bring a numerous army against Moab and spread it over his country.

— the Targum says ,”behold, as all eagle which flies, so a king shall come up with his army, and encamp against Moab.”

41 Kerioth is taken, and the strongholds are surprised; and the mighty men’s hearts in Moab at that day shall be as the heart of a woman in her pangs. — and the mighty men’s hearts in Moab at that day shall be as the heart of a woman in her pangs; even the hearts of the soldiers and the most courageous generals shall sink within them; and they be not only as timorous as women in common but as low spirited as a woman when she finds her pains are coming upon her and the time of her delivery is at hand.

42 And Moab shall be destroyed from being a people, because he hath magnified himself against the Lord. — and Moab shall be destroyed from being a people… for some time, not always; since the captivity of Moab is promised to be returned, Jeremiah 48:47; or from being such a people as they had been, enjoying so much ease, wealth, power and prosperity. Some Rabbi take it to be a comparative and renders it, “more than a people”; that is, shall be destroyed more than any other people;

— because he hath magnified himself against the Lord; the Targum says, against the people of the Lord; this is the cause of his destruction.

43 Fear and the pit and the snare shall be upon thee, O inhabitant of Moab,” saith the Lord. — fear and the pit, and the snare, shall be upon thee… a proverbial expression, showing, that if they escaped one danger or sore judgement, they should fall into another and greater: the words seem to be taken from Isaiah 24:17.

44 “He that fleeth from the fear shall fall into the pit, and he that getteth up out of the pit shall be taken in the snare: for I will bring upon it, even upon Moab, the year of their visitation,” saith the Lord. — he that fleeth from fear, trying to escape the general horror, shall fall into the pit, and he that getteth up out of the pit shall be taken in the snare, one or the other of the calamities will be sure to catch him; for I will bring upon it, even upon Moab, the year of his visitation, saith the Lord.

45 “They that fled stood under the shadow of Heshbon because of the force; but a fire shall come forth out of Heshbon and a flame from the midst of Sihon, and shall devour the corner of Moab and the crown of the head of the tumultuous ones. — they that fled, the fugitives who escaped the slaughter, stood under the shadow of Heshbon because of the force, powerless in the face of the danger confronting them; but a fire shall come forth out of Heshbon, the city in which they hoped to find refuge and a flame from the midst of Sihon, the ancient king of the Amorites, and shall devour the corner of Moab so that it would be totally destroyed and the crown of the head of the tumultuous ones, of the sons of warlike confusion.

46 Woe be unto thee, O Moab! The people of Chemosh perisheth! For thy sons are taken captive and thy daughters captive. — woe be unto thee, O Moab! the people of Chemosh perisheth… the inhabitants of Moab, who worshipped the idol Chemosh; Jeremiah 48:7; and so called his people, as Israel were called the people of the Lord; now these, notwithstanding their idol, whom they worshipped and in whom they trusted, should perish; and sad and deplorable would be their condition and circumstances;

— for thy sons and daughters are taken captives; this explains the woe that should come upon them and in what sense they should perish; since their sons and daughters who they hoped would have continued their name and nation, were taken and would be carried captives into Babylon; Numbers 21:29.

47 “Yet will I bring back the captives of Moab in the latter days,” saith the Lord. Thus far is the judgement of Moab. — yet will I bring again the captivity of Moab in the latter day, saith the Lord… some think this is added, not so much for the sake of Moab as of the Jews to assure them of their return from captivity as had been promised them, since this would be the case even of Moab. It had a literal accomplishment under Cyrus, as is thought, when they were restored to their land; and certain it is they were a people in the times of Alexander who subdued them, as Josephus relates.

Jeremiah (Ch 45-46)

•November 22, 2021 • Leave a Comment

The list of kings of Judah towards the end; in successive reigns, as Josiah (reign 640–609), Jehoahaz (reign 609), Jehoiakim (reign 609–598), Jehoiachin or Jechonias (reign 598–597), and Zedekiah (reign 597–586)

Jeremiah 45

1 The word that Jeremiah the prophet spoke unto Baruch the son of Neriah, when he had written these words in a book out of the mouth of Jeremiah, in the fourth year of Jehoiakim the son of Josiah, king of Judah, saying, — the fourth year of Jehoiakim would be perhaps 606 BC or whereabout (that was the first year of Nebuchadnezzar king of Babylon); having the same beginning as chapter 25;

— in the fourth year of Jehoiakim; which was eighteen years before the destruction of Jerusalem; which would more properly have followed the 36th chapter; where we have an account of what Baruch wrote from the mouth of Jeremiah in a roll, and read to the people, and after that to the princes; which exposed him to danger, and caused the grief expressed by him in this chapter is postponed to this place.

“Thus saith the Lord, the God of Israel, unto thee, O Baruch:

Thou didst say, ‘Woe is me now! For the Lord hath added grief to my sorrow; I fainted in my sighing, and I find no rest.’ — thou didst say, woe is me now!… what will become of me? I am ruined; this he said in his heart, if not with his lips, perhaps both ways; and when the king gave orders to apprehend him and the prophet, being provoked at the roll which he had wrote and read, Jeremiah 36:26;

— for the Lord hath added grief to my sorrow; caused him grief upon grief, sorrow upon sorrow; for there was a variety of things which occasioned grief and sorrow; the trouble of his office as a scribe to the prophet; the grievous things contained in the prophecies he transcribed, concerning the ruin of his people and nation; the king’s displeasure at the roll and his burning it;

— I fainted in my sighing; he sighed and groaned at what he saw coming upon his country, which overcame his spirits; he sunk and swooned away: or “I laboured in my sighing” amidst his sighs and groans, he prayed to the Lord, and laboured in prayer, that he might be delivered from the evils he feared were coming upon him.

Thus shalt thou say unto him, ‘The Lord saith thus: Behold, that which I have built will I break down, and that which I have planted I will pluck up, even this whole land. — the Lord saith thus, behold, that which I have built will I break down, and that which I have planted I will pluck up; even the Jewish nation which the Lord had built up as a spacious and beautiful house to dwell in, and had planted as a vineyard and set it with pleasant plants; but now would demolish this building and destroy his estate:

— even this whole land; not a few cities only, or only Jerusalem the metropolis but the whole land of Judea; no part of it but what should be left desolate. The Targum says, “even the whole land of Israel, is mine.”

And seekest thou great things for thyself? Seek them not; for behold, I will bring evil upon all flesh, saith the Lord, but thy life will I give unto thee for a prey in all places whither thou goest.’” — seekest thou great things for thyself? seek them not… riches and wealth honour and esteem, peace and prosperity; these were not to be sought after and expected, when the whole nation would be involved in such a general calamity. Baruch perhaps expected that his reading the roll to princes would have been a means of honouring him at court, of advancing him to some office, in which he might have acquired wealth and got applause and lived in peace and plenty all his days; but this was not to be expected; when the very roll he wrote and read contained in it prophecies of the general ruin of the nation;

— for, behold, I will bring evil upon all flesh; not upon every individual person in the world; but upon all the inhabitants of Judea, who should either die by the sword or by famine, by pestilence or be carried as captives;

— but thy life will I give unto thee for a prey in all places wherever thou goest; suggesting that he should be obliged to quit his native place and country, and go from place to place; as he did, after the destruction of Jerusalem, along with the prophet; and even into Egypt with the Jews that went there; where his life would be in danger, and yet the Scriptures are silent here, that he and Jeremiah and the king’s daughters should be taken by another great eagle to Ireland, see Ezekiel 17.

Jeremiah 46

1 The word of the Lord which came to Jeremiah the prophet against the nations. — the word of the Lord which came to Jeremiah the prophet against the nations; distinguished from the Jews; not all the nations of the world, but some hereafter mentioned: the Egyptians, Philistines, Moabites, Ammonites, Edomites, Syrians, Arabians, Persians, and Chaldeans: or “concerning the nations” mentioned above; though the prophecies delivered are all against them, none favourable.

Against Egypt, against the army of Pharaohnecho king of Egypt, which was by the River Euphrates in Carchemish, which Nebuchadnezzar king of Babylon smote in the fourth year of Jehoiakim the son of Josiah, king of Judah: — against Egypt… this is the title of the first prophecy against Egypt; which is first mentioned because the Jews were most familiar with and have placed great confidence in and much relied on the Egyptians for help:

Wiki: Carchemish was the location of an important battle, about 605 BC, between the Babylonians  and Egyptians, mentioned in the Bible (Jeremiah 46:2). 

“Order ye the buckler and shield, and draw near to battle!

Harness the horses; and get up, ye horsemen, and stand forth with your helmets; furbish the spears, and put on the brigandines!

Why have I seen them dismayed and turned away back? And their mighty ones are beaten down, and are fled apace and look not back, for fear was round about,” saith the Lord. — wherefore have I seen them dismayed and turned away back?… the Egyptians, after all this preparation for war and seeming ardent to engage in battle; yet when they came to it, were seized with a panic, and thrown into the utmost consternation and turned their backs upon their enemy: these are either the words of the prophet, who are led by a spirit of prophecy, foreseeing the consternation, confusion and flight of the Egyptian army; or of the Lord, who foresaw all this:

— and their mighty ones are beaten down and fled apace, and look not back; or, “their mighty ones are broken” their valiant soldiers and officers, their best troops were broken to pieces, their ranks and files, and thrown into the utmost disorder; and therefore made all the haste they could to escape the fury of the enemy, and fled with the utmost horror and never stopped to look back upon their pursuers;

— for fear was round about, saith the Lord; their enemies surrounded them, and that was the reason fright was all around them, and both were from the Lord; or as he had determined and foretold it.

“Let not the swift flee away, nor the mighty man escape; they shall stumble and fall toward the north by the River Euphrates. — let not the swift flee away, nor the mighty men escape… those that were swift of foot, or carried but light armour, let not such trust to their swiftness; nor let the mighty man think to escape by reason of his great strength, to make his way through the enemy, and get out of his hands. Or this may be rendered as future, “the swift shall not flee away” so the Targum says neither one nor the other shall escape by the nimbleness of their heels, or the stoutness of their hearts:

— they shall stumble and fall toward the north, by the river Euphrates; which lay north of Judea, and also was to the north of Egypt, whose destruction is threatened: the place where this route and slaughter would be made was Carchemish, which was situated by that great river Euphrates.

“Who is this that cometh up as a flood, whose waters are moved as the rivers? — who is this that cometh up as a flood… these are either the words of the prophet, who having a vision in prophecy of the march of the Egyptian army from the south to the north, which he compares to a flood; in allusion to the river Nile, which used to overflow its banks; or they are the words of God, who puts this question in order to give an answer to it and thereby upbraid the Egyptians with their arrogance, pride and vanity; which would all come to nothing:

— whose waters are moved as the rivers? whose numerous armies came with a great noise and force, like the openings of the Nile, the seven gates of it; which were very boisterous, especially in hard gales of wind: it is no unusual thing for large armies to be compared to floods and rivers, which move forcibly and swiftly, and make a large spread; Isaiah 8:7. The Targum says, “who is this that comes up with his army as a cloud, and covers the earth, and as a fountain of water, whose waters are moved?”

Egypt riseth up like a flood, and his waters are moved like the rivers; and he saith, ‘I will go up, and will cover the earth; I will destroy the city and the inhabitants thereof.’ — and he saith, I will go up; Pharaohnecho king of Egypt said, I will go up from my own land to the north to meet the king of Babylon:

— and will cover the earth with his Egyptian army: even all toward the north country, including the Babylonish empire;

— I will destroy the city, and the inhabitants thereof; which restrains to the city Carchemish, where his army was smitten: but it is better to interpret, the singular by the plural, as the Targum does, “I will destroy cities” since it was not a single city he came up to take, nor would this satisfy his ambition and temper.

Come up, ye horses, and rage, ye chariots! And let the mighty men come forth: the Ethiopians and the Libyans that handle the shield, and the Lydians that handle and bend the bow. — come up, ye horses; and rage, ye chariots… these are either the words of Pharaoh, giving orders to his cavalry and charioteers to make haste and come up to battle, not doubting of victory: or rather of the Lord by the prophet, ironically calling upon the horsemen in the Egyptian army to come on and engage with the enemy, and behave gallantly; and those in the chariots to drive;

— the Ethiopians and the Libyans, that handle the shield; or Cush and Phut, both sons of Ham, and brethren of Mizraim, from whence Egypt had its name, Genesis 10:6; the posterity of these are meant. The Cushites or Ethiopians were near neighbours of the Egyptians, and their allies and confederates.

10 For this is the day of the Lord God of hosts, a day of vengeance, that He may avenge Him of His adversaries. And the sword shall devour, and it shall be sated and made drunk with their blood; for the Lord God of hosts hath a sacrifice in the north country by the River Euphrates. — and the sword shall devour, and it shall be satiate and made drunk with their blood; that is, the sword of the Chaldeans shall destroy the Egyptians in such vast numbers, that there shall be no more to be slain; or there shall be no desire in the enemy to slay any more; they shall be glutted with their blood;

— for the Lord God of hosts hath a sacrifice in the north country by the river Euphrates near Carchemish, which lay north of Egypt; an allusion to the sacrifices of great warriors, which are many; the Lord of hosts had a sacrifice, or a great slaughter of men, his enemies; inflicted punishment on them, wherein his power and justice were displayed.

11 Go up into Gilead and take balm, O virgin, the daughter of Egypt; in vain shalt thou use many medicines; for thou shalt not be cured. — and take balm, O virgin, daughter of Egypt; the kingdom of Egypt, as the Targum says; so called because of its glory and excellency; and because as yet it had not been conquered and brought under the power of another.

12 The nations have heard of thy shame, and thy cry hath filled the land; for the mighty man hath stumbled against the mighty, and they are fallen both together.” — the nations have heard of thy shame… their shameful defeat and overthrow by the Chaldean army; so, after the manner of prophecy uttered, the warning fulfilled; the battle fought, and the victory obtained; and the rumour and fame spread among the nations, to the great mortification of this proud people:

— and thy cry hath filled the land; the shrieks of the wounded; the cry of the pursued and taken; the lamentation of friends and relations for their dead; with one thing or another of this kind the whole land of Egypt was filled; yea, all the countries round about them, in confederacy with them, were filled with distress for the loss of their own; the calamity was large and spreading:

— for the mighty man hath stumbled against the mighty, and they are fallen both together; either the mighty Egyptians against the mighty Chaldeans; and though the latter were the conquerors, yet lost abundance of men; so that there were mighty ones fell on both sides. The Targum says both were slain.

13 The word that the Lord spoke to Jeremiah the prophet, how Nebuchadnezzar king of Babylon should come and smite the land of Egypt: — the word that the Lord spoke to Jeremiah the prophet… this is a new and distinct prophecy from the former, though concerning Egypt as that; but in this they differ; the former prophecy respects only the overthrow of the Egyptian army at a certain place; this latter the general destruction of the land; and was fulfilled some years after the other;

— to smite the land of Egypt; who was to come, and did come, out of his country, into the land of Egypt, to smite the inhabitants of it with the sword, take their cities, plunder them of their substance, and make them tributary to him; Rashi says, according to their chronicles, this was a second blow, in the twenty seventh year of Nebuchadnezzar’s reign; around 579 BC.

14 “Declare ye in Egypt and publish in Migdol, and publish in Noph and in Tahpanhes; say ye, ‘Stand fast and prepare thee, for the sword shall devour round about thee.’ — declare ye in Egypt… the coming of the king of Babylon, and his intention to invade the land and subdue it:

— say ye, stand fast and prepare thee; O Egypt, and the several cities mentioned and all others; prepare for war and to meet the enemy, resist and repel him; present yourselves on the frontiers of your country; put yourselves in proper places and keep your ground:

— for the sword shall devour round about thee; the sword of the Chaldeans, into whose hands fell Jerusalem, Judea, Syria and other neighbouring countries; and therefore it was high time for them to bestir themselves and provide for their defence and safety.

15 Why are thy valiant [showing courage] men swept away? They stood not, because the Lord did drive them. — why are thy valiant men swept away?… as with a mighty torrent, or a sweeping rain; to which the Chaldean army may be compared; which came with such irresistible force as to drive the Egyptians from their posts, so that they could not stand their ground;

— the Septuagint renders it, “why does Apis flee from thee? thy choice ox does not continue,” which was the god of the Egyptians, they worshipped in the form of an ox; this could not protect them, thought by them to be very mighty and powerful; their choice ox, Apis, of the Egyptians is believed to be a most powerful deity; yet could not save them;

— because the Lord did drive them; by means of the Chaldeans; he dispirited them; he put them into a panic and they fled from their posts; there is no standing against the Lord.

16 He made many to fall, yea, one fell upon another; and they said, ‘Arise, and let us go again to our own people and to the land of our nativity, from the oppressing sword.’ — and they said, arise: not those that fell, which may seem at first sight; but either the strangers in the land of Egypt, such as the Jews were; who, perceiving the destruction that was coming on Egypt, exhort one another to arise, and get out of it; or rather the auxiliaries of the Egyptians, as the Ethiopians, Libyans and Lydians,

— and let us go again to our own people, and to the land of our own country, where we were born, and where our friends and relations lived; so that we might be safe;

— from the oppressing sword; the sword of the Chaldeans.

17 They did cry there, ‘Pharaoh king of Egypt is but a noise! He hath passed the time appointed.’ — Pharaoh king of Egypt is but a noise; he boasted and bragged of great things he would do, but does nothing; he promised to bring a large army into the field, and talked big of attacking the enemy with great ardour and fury, and hectored and blustered as if he feared nothing, and was sure of victory; but when it came to the push, his courage failed him; and it may be said of him what the man said of his nightingale, “vox et praeterea nihil” a voice and nothing else. This was not Pharaohnecho, as the Septuagint have wrongly inserted, but Pharaohhophra, Jeremiah 44:30; or it may be supplied thus, “Pharaoh king of Egypt is a king of noise” a noisy, big and blusterous king in words, but in deeds nothing.

18 “As I live,” saith the King, whose name is the Lord of hosts, “surely as Tabor is among the mountains and as Carmel by the sea, so shall he come. — Tabor, a mountain in Galilee; and Carmel is by the sea of Galilee.

19 O thou daughter dwelling in Egypt, furnish thyself to go into captivity; for Noph shall be waste and desolate, without an inhabitant. — furnish thyself to go into captivity; or “make”, or “prepare for thyself vessels of captivity” or such things as are proper for captives, as suitable clothes to travel in, shoes to walk in, scrip and staff and the like; expect captivity and be prepared for it;

— for Noph shall be waste and desolate without an inhabitant; the city Memphis as the Targum says: this is particularly mentioned, because it was a royal city, and though a very populous one, its destruction should be so general, that not an inhabitant should be left in it: the devastation of this city is put for that of all the rest, and as a sure token of it and the whole nation going into captivity.

20 “Egypt is like a very fair heifer, but destruction cometh; it cometh out of the north. — the Targum says, “Egypt was a beautiful kingdom.”

— but destruction cometh, it cometh from the north; that is, the destruction of Egypt, which should come from Chaldea, which lay north of Egypt; and this threat is repeated.

21 Also her hired men are in the midst of her like fatted bullocks; for they also are turned back, and have fled away together. They did not stand, because the day of their calamity had come upon them, and the time of their visitation. — all her hired men are in the midst of her like fatted bullocks… or “bullocks of the stall” soldiers of other countries that were hired into the service of Egypt and lived so deliciously there, that they were unfit for war and were like fatted beasts prepared for the slaughter.

— the Targum interprets it, her princes; who had the care of this heifer and of the feeding of this princeling; these themselves were like that, nourished for the day of slaughter.

22 The voice thereof shall go like a serpent; for they shall march with an army and come against her with axes, as hewers of wood. — the voice thereof shall go like a serpent… that is, the voice of Egypt before compared to a heifer when in its glory; but now it shall not bellow like a heifer in fat pasture, bat hiss like a serpent when drove and pursued out of its hole; signifying, that their voice should be low and submissive and should not speak one big or murmuring word to their conquerors;

— for they shall march with an army; the Targum adds, against you; the meaning is, that the Chaldeans should come with a great army, and march against the Egyptians with great strength, force and fury:

— and come against her with axes, as hewers of wood; with battle axes as if they came to cut down trees; nor would they spare the Egyptians any more than such hewers do the trees; nor would they be able any more to resist them than trees can resist hewers of wood.

23 They shall cut down her forest,” saith the Lord, “though it cannot be searched, because they are more than the grasshoppers, and are innumerable. — they shall cut down her forest, saith the Lord… the land of Egypt compared to a forest for the multitude of its cities, towns and their inhabitants; which should be destroyed by the Chaldeans as a forest is cut down by hewers of wood;

— the metaphor is continued with the Targum interpreting this as the princes of Egypt and their destruction;

— because they are more than grasshoppers, are innumerable; which creatures come in large numbers, and eat up every green tree and herb; and so the Chaldean army, being alike numerous, would easily cut down the trees of this forest, because they were so many.

24 The daughter of Egypt shall be confounded; she shall be delivered into the hand of the people of the north.” — the daughter of Egypt shall be confounded… brought to shame before all the nations of the earth, being conquered by the Chaldeans; that is, the kingdom of Egypt, as the Targum says; or the inhabitants of it, being subdued and carried captive:

— she shall be delivered into the hand of the people of the north; the Chaldeans, who dwelt northward of Egypt, as is manifest from what follows.

25 The Lord of hosts, the God of Israel, saith: “Behold, I will punish the multitude of No, and Pharaoh, and Egypt, with their gods and their kings, even Pharaoh and all them that trust in him. — behold, I will punish the multitude of No; the inhabitants of it, which were many, called “populous No” in Nahum 3:8; a famous city in Egypt. Some take it to be Diospolis or Thebes; and others the same that is now called Alexandria; and so the Targum renders it;

— and Pharaoh and Egypt, with their gods and their kings; Pharaoh, their present king of Egypt, who was Pharaohhophra, and all the land of Egypt; and all their numerous idols, which were many indeed; and the several governors of the nomes or provinces into which the land was distributed; these should be punished and suffer in the general calamity.

26 And I will deliver them into the hand of those that seek their lives, and into the hand of Nebuchadnezzar king of Babylon and into the hand of his servants; and afterward it shall be inhabited as in the days of old,” saith the Lord. — and afterwards it shall be inhabited as in the days of old, saith the Lord; after forty years, as Ezekiel prophesied, Ezekiel 29:11-13; not that it should rise to the same glory and dignity as before, for it would be but a base kingdom; but whereas it was desolate and uninhabited after this destruction, it should now be inhabited again.

27 “But fear not thou, O My servant Jacob, and be not dismayed, O Israel; for, behold, I will save thee from afar off, and thy seed from the land of their captivity; and Jacob shall return, and be in rest and at ease, and none shall make him afraid. — I will save thee from afar off; these maybe the righteous in Egypt, who were carried there by Johanan against their will; and these small remnant should escape, Jeremiah 44:28; and these words are intended to comfort those in captivity, with a promise of their return, lest they should be discouraged, in hearing that the Egyptians should inhabit their own land again, and they not theirs;

— and Jacob shall return, and be in rest, and at ease, and none shall make him afraid: this will have its full accomplishment hereafter in the latter day; as Jacob includes the other ten tribes when all Israelites return to their own land, and never be disturbed any more.

28 Fear thou not, O Jacob My servant,” saith the Lord, “for I am with thee. For I will make a full end of all the nations whither I have driven thee, but I will not make a full end of thee, but correct thee in measure. Yet will I not leave thee wholly unpunished.” — fear thou not, O Jacob, my servant, saith the Lord, for I am with thee… though afar off in foreign lands and in captivity: this exhortation is repeated to strengthen their consolation and against their fears of being cast off by the Lord;

— but correct thee in measure; with judgement and in mercy for the full house of Jacob: yet will I not leave thee wholly unpunished.

Jeremiah (Ch 43-44)

•November 21, 2021 • Leave a Comment

Chapter 43 sets the background that lead to Chapter 44, where the impudent and impious contempt which the remnants of the Jews put upon this admonition, and their declared resolution to persist in their allegiance to the Queen of heaven and other idolatries, in despite both warnings from God and his prophet Jeremiah.

God’s judgement upon them for their obstinacy are shift; that they should all be cut off and perish in Egypt, except a still smaller number of which will escape; because the Pharaoh of Egypt should shortly fall into the hands of Nebuchadnezzar king of Babylon, and be unable to protect them any longer.

Jeremiah 43

1 And it came to pass that when Jeremiah had made an end of speaking unto all the people all the words of the Lord their God, for which the Lord their God had sent him to them, even all these words,

then spoke Azariah the son of Hoshaiah, and Johanan the son of Kareah, and all the proud men, saying unto Jeremiah, “Thou speakest falsely. The Lord our God hath not sent thee to say, ‘Go not into Egypt to sojourn there.’ — and Johanan and all the proud men; the great men among them, who are commonly proud of their greatness; of their descent, their family and blood; of their wealth and riches, and posts of honour; perhaps the captains of the forces are meant, who elsewhere are mentioned along with Johanan, Jeremiah 40:13;

— these were men full of themselves, had a high opinion of their own wisdom, and were prudent in their own eyes; and could not bear to be contradicted or advised by the prophet, nor even by the Lord himself; and are justly, by the Targum, called wicked men; their pride was the cause of their rebellion against God and disobedience to him and of their ungenteel and insolent behaviour to the prophet;

— saying unto Jeremiah, thou speakest falsely: or, “a lie” it being contrary to their minds: so the prophets of the Lord and even the word of God itself are charged with falsehoods;

— the Lord our God hath not sent thee to say, go not into Egypt to sojourn there; they did not care to own it was the word of the Lord; whatever convictions of it they had in their minds; because they would not openly appear to be opponents against God; but deny that the prophet was sent by him.

But Baruch the son of Neriah setteth thee against us, to deliver us into the hand of the Chaldeans, that they might put us to death and carry us away captives into Babylon.” — but Baruch the son of Neriah sets you against us to deliver us into the hand of the Chaldeans, that they might put us to death and carry us away captives into Babylon; upon this suspicion and accusation, these men based their opposition to Jeremiah’s counsel which conveyed to them the warnings of the Lord.

So Johanan the son of Kareah, and all the captains of the forces, and all the people obeyed not the voice of the Lord to dwell in the land of Judah. — so Johanan, the son of Kareah, and all the captains of the forces and all the people, in accordance with the idea which they had had in mind, obeyed not the voice of the Lord to dwell in the land of Judah.

But Johanan the son of Kareah and all the captains of the forces took all the remnant of Judah, who had returned from all nations whither they had been driven, to dwell in the land of Judah— these are those who upon the invasion of the land and siege of Jerusalem had fled to other countries, but now were returned from thence, in order to settle in the land of Judah; having heard that a governor from among the Jews was appointed over it; as from Moab, Ammon, Edom, and other countries; see Jeremiah 40:11;

even men, and women, and children, and the king’s daughters, and every person whom Nebuzaradan the captain of the guard had left with Gedaliah the son of Ahikam, the son of Shaphan, and Jeremiah the prophet, and Baruch the son of Neriah. — even men, and women, and children, and the king’s daughters, the princesses of the royal household, Jeremiah 41:10, and every person that Nebuzaradan, the captain of the guard had left with Gedaliah, the son of Ahikam, the son of Shaphan, and Jeremiah the prophet, and Baruch the son of Neriah. All of these people were obliged to join the caravan of refugees, but the Q is, why didn’t Jeremiah and Baruch resist? And go their own way?

So they came into the land of Egypt, for they obeyed not the voice of the Lord; thus came they even to Tahpanhes. — so them Jews and the king’s daughters came into the land of Egypt, for they obeyed not the voice of the Lord, as made known by the mouth of Jeremiah; thus came they even to Tahpanhes, the city of Daphne on one of the eastern delta-arms of the Nile.

Then came the word of the Lord unto Jeremiah in Tahpanhes, saying,

“Take great stones in thine hand, and hide them in the clay in the brickkiln, which is at the entry of Pharaoh’s house in Tahpanhes, in the sight of the men of Judah; — take great stones in thine hand and hide them in the clay in the brick-kiln which is at the entry of Pharaoh’s house in Tahpanhes, in the sight of the men of Judah, so that he would have trustworthy witnesses of his act. The palace of Pharaoh included not only the buildings proper, but their entire enclosure as well, which usually was surrounded by a high wall. Opposite the entrance of this enclosure the bricks for the building or for the repairing of the royal palace were made, and it was in the clay of this kiln that the stones carried by Jeremiah were to be hidden;

— Tahpanhes is the same with “Hanes” in Jeremiah 2:16 and Tahpanhes, Jeremiah 43:7 as the Targum calls it; it is thought to be the same with Daphnae Pelusiae; here Pharaoh had a house or palace; see Jeremiah 43:9 and this is the reason that the entourage from Judah and the king’s daughters had good refuge to go there for protection.

10 and say unto them, ‘Thus saith the Lord of hosts, the God of Israel: Behold, I will send and take Nebuchadnezzar the king of Babylon, My servant, and will set his throne upon these stones that I have hid; and he shall spread his royal pavilion over them. — and say unto them, the witnesses of his symbolical act, Thus saith the Lord of hosts, the God of Israel, Behold, I will send and take Nebuchadnezzar, the king of Babylon, for as such he acted as My servant in this instance, in carrying out the Lord’s purpose upon Egypt, and will set his throne upon these stones that I have hidden; and he shall spread his royal pavilion over them, namely, the rich tapestry which formed the curtains of the throne.

11 And when he cometh, he shall smite the land of Egypt, and deliver such as are for death to death, and such as are for captivity to captivity, and such as are for the sword to the sword. — and when he cometh, in extending his campaign of conquest to Africa, he shall smite the land of Egypt and deliver such as are for death, principally by famine and pestilence, to death, and such as are for captivity to captivity, and such as are for the sword, that is, death in battle, to the sword. In this way, as the scourge of the Lord, he would also act as the servant of Yehovah. Both the act of laying the stones and the material spoken of are significant; for the stones of the throne’s foundation are symbolical of the power and firmness of Nebuchadnezzar’s rule, while the clay of Pharaoh’s palace signifies the weakness of his power.

12 And I will kindle a fire in the houses of the gods of Egypt, and he shall burn them and carry them away captives; and he shall array himself with the land of Egypt, as a shepherd putteth on his garment; and he shall go forth from thence in peace. — and I will kindle a fire in the houses of the gods of Egypt, to show the helplessness of their idols in the country whose security the Jews seeked; including the Queen of heaven, Astarte; and he, Nebuchadnezzar, shall burn them and carry them away captives, the very gods of Egypt who they serve; and he shall array himself in the land of Egypt as a shepherd putteth on his garment, and he shall go forth from thence in peace. The point of comparison is the freedom and the ease of the act; for just as easily and quickly as a shepherd takes up his mantle, practically his garment and wraps it about him, so easily will Nebuchadnezzar take hold upon Egypt and the whole country in his hand, leave without hindrance and none opposing him.

13 He shall break also the images of Bethshemesh [the House of the Sun] that are in the land of Egypt; and the houses of the gods of the Egyptians shall he burn with fire.’” — he shall break also the images of Bethshemesh that is in the land of Egypt, the renowned Temple of the Sun at Heliopolis, one of the greatest sanctuaries of the country; and the houses of the gods of the Egyptians shall he burn with fire. “The images of Bethshemesh are, above all, the obelisks, of which there was an unlimited number in the city. Of the oldest, however, were not the largest, one still remains in its place.” In this manner would all the representatives of Egyptian idol-worship fall before the power of Nebuchadnezzar, and the hope and trust of the Jews who fled to Egypt would find themselves worshipping these gods of woods and stones in vain.

— the images of the Bethshemesh; that is, the “city of the sun” as the Septuagint says; and so “Bethshemesh” signifies the “house of the sun” either it designs the temple of the sun, or the city where it was worshipped; as Heliopolis was famous for the worship of the sun, and for a magnificent temple in it, built for that purpose, and where abundance of persons resorted on that account, as Herodotus l observes; here were many images of the sun; and these now should be broke to pieces, when this city should become the city of destruction, as is foretold it should by Isaiah, Isaiah 19:18; where the Targum expressly calls it the city Bethshemesh, that is to be destroyed.

~~~

Another parallel on Sun worship in Ezekiel 8 by the house of Judah with comments embedded below

15 Then said He unto me, “Hast thou seen this, O son of man? Turn thee yet again, and thou shalt see greater abominations than these.”

16 And He brought me into the inner court of the Lord’S house, and behold, at the door of the temple of the Lord, between the porch and the altar, were about five and twenty men with their backs toward the temple of the Lord and their faces toward the east; and they worshiped the sun toward the east. — the heads of the twenty-four courses of the priesthood, led by the high priest, making up the “twenty five men” were not only worshipping the sun: they were doing so in the very temple of God, with their backs turned upon the presence of God!

— the worship of heavenly bodies was against God’s will which Moses had warned the people (Deuteronomy 4:19, 17:3, whose penalty is to be stoned to death, Deuteronomy 17:5 ’till they die). These 25 men corrupted themselves by worshipping the sun; and so the Targum renders it, “and, lo, they corrupted themselves, worshipping facing the east the sun; their backs toward the temple of the Lord” — turned their backs to the most holy place; which is an aggravation of their impiety; casting the utmost contempt for God:

Moses’ warnings in Deuteronomy 17

3 And [if you] hath gone and served other gods and worshiped them, either the sun or moon or any of the host of heaven, which I have not commanded, 4 and it be told thee, and thou hast heard of it and inquired diligently, and behold, it be true and the thing certain that such abomination is wrought in Israel, 5 then shalt thou bring forth that man or that woman who has committed that wicked thing unto thy gates, even that man or that woman, and shalt stone them with stones till they die. Deuteronomy 17:3-5

— today, more than 98.5 percent of Christians are honoring the SUN by observing SUNday worship. They have “their backs toward the temple of the Lord and their faces toward the east; and they worshiped the SUN toward the east; whose penalty is to be stoned to death – ’till they die.

— also, following the SUN-worshipping Samaritans, most Church of God Communities are showing their contempt for God by having their “wavesheaf offering” and Pentecost on a SUNday; always on a SUNday. And these are supposedly in God’s Sanctuary, but God says He is a jealous God, so these pretentious Christians could be spewed out of His mouth! A death penalty – ’till they die!

Jeremiah 44

1 The word that came to Jeremiah concerning all the Jews who dwell in the land of Egypt, who dwell at Migdol, and at Tahpanhes, and at Noph, and in the country of Pathros, saying, — the word that came to Jeremiah concerning all the Jews which dwell in the land of Egypt, where they had settled in spite of the earnest remonstrances of Jeremiah, which dwell at Migdol, on the northeastern boundary of Egypt, and at Tahpanhes, in the delta of the Nile, and at Noph, or Memphis, the capital of Lower Egypt, and in the country of Pathros, that is, Upper Egypt, for in the intervening years the Jews had selected different parts of Egypt for temporary omes, but if Jeremiah and Baruch were faithful servants of God WHY did they allowed themselves to come to Egypt with Johanan the son of Kareah? Jeremiah and Baruch were not in chains so why didn’t they remain in Judah?

— the Jews who dwell in the land of Egypt; This Note Is From The Companion Bible.

Recent discoveries of Papyri in the ruins of Elephantine (an
island in the Nile, opposite Assouan), dating from the fifth century B.
C., bear witness to two great facts:-
(1) That Jews were then dwelling there (in 424-405 B.C.).
(2) That they were observing the Feast of the Passover, “as it
is written in the law of Moses”.

“Thus saith the Lord of hosts, the God of Israel: Ye have seen all the evil that I have brought upon Jerusalem and upon all the cities of Judah; and behold, this day they are a desolation, and no man dwelleth therein, — thus saith the Lord of hosts, the God of Israel, Ye have seen all the evil that I have brought upon Jerusalem and upon all the cities of Judah, most of the Jews addressed having been witnesses of the terrible catastrophe which brought destruction to the southern kingdom; and behold this day they are a desolation and no man dwelleth therein, the entire land, formerly so rich, fruitful and populous had become an uninhabited desert,

because of their wickedness which they have committed to provoke Me to anger, in that they went to burn incense and to serve other gods whom they knew not, neither they, ye, nor your fathers. — because of their wickedness which they have committed to provoke Me to anger in that they went leaving the path of right and duty set before them by the Word of God, to burn incense and to serve other gods, by such act of worship, whom they knew not, neither they, ye, nor your fathers. That was the first cause of the calamity which came upon Jerusalem.

Nevertheless, I sent unto you all My servants the prophets, rising early and sending them, saying, ‘Oh, do not this abominable thing that I hate.’ — however, I sent unto you all My servants the prophets, rising early and sending them, full of merciful eagerness to prevent the threatened catastrophe, saying, Oh, do not this abominable thing that I hate, which filled Him with loathing.

But they hearkened not, nor inclined their ear to turn from their wickedness, to burn no incense unto other gods. — but they hearkened not nor inclined their ear to turn from their wickedness, they paid not the slightest attention to Yehovah’s admonitions and warnings, and not to burn incense to other gods.

Therefore My fury and Mine anger was poured forth and was kindled in the cities of Judah and in the streets of Jerusalem; and they are wasted and desolate, as at this day. — wherefore My fury and Mine anger was poured forth, like an overturned vessel spilling all its contents at once, and was kindled in the cities of Judah and in the streets of Jerusalem, for the fire of destruction was a manifestation of the divine anger; and they are wasted and desolate, as at this day, their ruin being entirely the fault of the stubbornness of the rebellious Jews and the consequences were still evident.

“Therefore, now thus saith the Lord, the God of hosts, the God of Israel: Why commit ye this great evil against your souls to cut off from you man and woman, child and suckling, out of Judah to leave you none to remain, — therefore, now thus saith the Lord, the God of hosts, the God of Israel, Wherefore commit ye this great evil against your souls, to the destruction of their own lives, for they were not injuring the Lord, but merely themselves, to cut off from you man and woman, child and suckling, out of Judah, in a judgement of complete extermination, to leave you none to remain,

in that ye provoke Me unto wrath with the works of your hands, burning incense unto other gods in the land of Egypt whither ye have gone to dwell, that ye might cut yourselves off and that ye might be a curse and a reproach among all the nations of the earth? — provoking Me to wrath with the works of your hands, burning incense unto other gods in the land of Egypt, where you have gone to dwell, having profited nothing by the example of Jerusalem’s destruction, that you might cut yourselves off, and that you might be a curse and a reproach among all the nations of the earth?

that they were looked upon as an accursed people of God, and their names were taken up for a proverb and a reproach everywhere; because of their dwelling there, Egypt was invaded; for if they hadn’t gone there, Egypt would have been left alone.

Have ye forgotten the wickedness of your fathers, and the wickedness of the kings of Judah, and the wickedness of their wives, and your own wickedness, and the wickedness of your wives which they have committed in the land of Judah and in the streets of Jerusalem? — have ye forgotten the wickedness of your fathers, their manifold evil doings, and the wickedness of the kings of Judah, and the wickedness of their wives, and their own wickedness, and the wickedness of their wives, which they have committed in the land of Judah and in the streets of Jerusalem? The queens of Judah, together with the women throughout the country, had been the chief promoters of idolatry; for just as women may be the chief upholders of virtue, they may also be the chief agents for the spreading of wickedness.

10 They are not humbled even unto this day, neither have they feared, nor walked in My law, nor in My statutes that I set before you and before your fathers. — they are not humbled even unto this day, they had not yet learned to turn to the Lord with contrite hearts, neither have they feared nor walked in My Law nor in My statutes that I set before them and before their fathers. They had deliberately ignored the norm and rule which the Lord had given them to follow, and the Lord speaks of them partly in the third person to give expression to the supreme disgust which filled His heart at their behavior.

— the Targum says, “they cease not unto this day;” that is, from committing the same things; which shows they had no true humiliation and contrition for them. This is to be understood not of the Jews in Babylon only, but chiefly of those in Egypt.

11 “Therefore thus saith the Lord of hosts, the God of Israel: Behold, I will set My face against you for evil, and to cut off all Judah. — and to cut off all Judah; not the whole tribe of Judah; not those that were in Babylon, which were by far the greatest number of that tribe; but those that were in Egypt.

12 And I will take the remnant of Judah who have set their faces to go into the land of Egypt to sojourn there, and they shall all be consumed and fall in the land of Egypt; they shall even be consumed by the sword and by the famine. They shall die, from the least even unto the greatest, by the sword and by the famine; and they shall be an execration and an astonishment, and a curse and a reproach. — that have set their faces to go into the land of Egypt, despites all the remonstrances made to them to the contrary; and were now actually sojourners there: this describes such persons who wilfully go against God’s will and of their own accord;

— and they shall all be consumed and fall in the land of Egypt; not by natural death, one after another; but by the judgements of God, as follows:

— they shall even be consumed by the sword and by famine; by a foreign army and sieges; by the sword of the king of Babylon;

— they shall die; from the least even unto the greatest, by the sword and by the famine; which is repeated for the confirmation of it, to persons of every age, state and condition, rank and degree, young and old, high and low, rich and poor: and they shall be an execration, an astonishment and a curse.

— that they were looked upon as an accursed people of God, and their names were taken up for a proverb and a reproach everywhere; because of their dwelling there, Egypt was invaded; for if they hadn’t gone there, Egypt would have been left alone.

13 For I will punish them that dwell in the land of Egypt, as I have punished Jerusalem by the sword, by the famine, and by the pestilence,

14 so that none of the remnant of Judah who have gone into the land of Egypt to sojourn there shall escape or remain, that they should return into the land of Judah to which they have a desire to return to dwell there; for none shall return but such as shall escape.” — so that none of the remnant of Judah which are gone into the land of Egypt to sojourn there shall escape or remain that they should return into the land of Judah, to the which they have a desire to return to dwell there, they were literally, “lifting up their souls with eagerness” and hoped to make Judea their home once more; for none shall return but such as shall escape. Since the Lord was speaking in general terms. He pictured the destruction as so universal that practically no one would escape, and the heaping of similar expressions heightens the impression of grim determination on His part. He is a jealous God, who visits the iniquity of sinners upon them with all the sternness which His justice demands;

— for none shall return but such as shall escape; out of the hands of Johanan and the rest of the captains; and should get out of the land of Egypt before the Chaldeans came into it. — perhaps Jeremiah and Baruch did escaped, together with the king’s daughters, whose mission to to build up and to plant; another commission of Jeremiah taken up by Ezekiel 17; of bringing down the high tree and exalting the low tree.

15 Then all the men who knew that their wives had burned incense unto other gods, and all the women who stood by, a great multitude, even all the people who dwelt in the land of Egypt, in Pathros, answered Jeremiah, saying, — then all the men which knew that their wives had burned incense unto other gods and all the women that stood by, a great multitude, the female contingent apparently being in the majority, from which many have concluded that the festival was one in honor of the Queen of Heaven herself, in whose service the women were very zealous, even all the people that dwelt in the land of Egypt, in Pathros, where this meeting was held, answered Jeremiah, saying,

16 “As for the word that thou hast spoken unto us in the name of the Lord, we will not hearken unto thee.

17 But we will certainly do whatsoever thing goeth forth out of our own mouth, to burn incense unto the queen of heaven and to pour out drink offerings unto her, as we have done, we, and our fathers, our kings, and our princes in the cities of Judah and in the streets of Jerusalem; for then had we plenty of bread, and were well and saw no evil. — but we will certainly do whatsoever thing goeth forth out of our own mouth, the vows which they had made when they embraced idolatry, to burn incense unto the Queen of heaven, that is, Ashtaroth, or Astarte, and to pour out drink-offerings unto her, as we have done, we and our fathers, our kings and our princes, in the cities of Judah and in the streets of Jerusalem, this statement amounts to revolting boastfulness; for then had we plenty of victuals, literally, “we were satisfied with bread,” having food of every kind in sufficient amounts, and were well and saw no evil, they enjoyed good fortune and happiness, as they believed. Fools attribute what they consider prosperity to the fact that God connives at their sin, so that they finally deny His very existence.

18 But since we left off burning incense to the queen of heaven and pouring out drink offerings unto her, we have been wanting in all things, and have been consumed by the sword and by the famine.”

19 “And when we burned incense to the queen of heaven and poured out drink offerings unto her, did we make her cakes to worship her, and pour out drink offerings unto her without our men?”

— the Queen of heaven: Geneva Study Bible: Read Jeremiah 7:18 it seems that the papists gathered of this place Salbe Regina and Regina caeli latare calling the virgin Mary Queen of heaven and so out of the blessed virgin and mother of Jesus Christ, made an idol; for here the prophet condemns their idolatry. (the Queen of heaven, that is, Ashtaroth or Astarte: more at the end)

20 Then Jeremiah said unto all the people — to the men, and to the women, and to all the people who had given him that answer, saying,

21 “The incense that ye burned in the cities of Judah and in the streets of Jerusalem, ye and your fathers, your kings and your princes, and the people of the land, did not the Lord remember them, and came it not into His mind? — the incense that ye burned in the cities of Judah and in the streets of Jerusalem, ye and your fathers, your kings and your princes, and the people of the land, of which they in their wickedness, now presumed to boast, did not the Lord remember them and came it not into His mind? Did not the present desolation of their homeland testify to the fact that the Lord was very well aware of their wickedness and that He had repaid their evil-doing?

22 So the Lord could no longer bear it, because of the evil of your doings and because of the abominations which ye have committed. Therefore your land is a desolation, and an astonishment and a curse, without an inhabitant, as at this day. — so that the Lord could no longer bear because of the evil of your doing’s and because of the abominations which ye have committed, with all His long-suffering He could no longer endure it; therefore is your land a desolation and an astonishment and a curse, without an inhabitant, as at this day. The evidences of His wrath upon the Land of Promise were still evident and all on account of their idolatry, as the prophet now repeats once more, for the sake of emphasis.

23 Because ye have burned incense, and because ye have sinned against the Lord and have not obeyed the voice of the Lord, nor walked in His law nor in His statutes nor in His testimonies, therefore this evil has happened unto you, as at this day.”

24 Moreover Jeremiah said unto all the people and to all the women, “Hear the word of the Lord, all Judah who are in the land of Egypt.

25 Thus saith the Lord of hosts, the God of Israel, saying: Ye and your wives have both spoken with your mouths and fulfilled with your hands, saying, ‘We will surely perform our vows that we have vowed to burn incense to the queen of heaven and to pour out drink offerings unto her.’ Ye will surely accomplish your vows and surely perform your vows! — thus saith the Lord of hosts, the God of Israel, saying, Ye and your wives have both spoken with your mouths and fulfilled with your hand, saying, We will surely perform our vows that we have vowed to burn incense to the Queen of heaven, and to pour out drink-offerings unto her; ye will surely accomplish your vows and perform your vows. Here is a bit of holy irony; for, as Jeremiah states, no one could accuse them of unsteadiness in keeping their idolatrous promises. If they had only been as steadfast toward Yehovah, the God of the covenant!

26 Therefore hear ye the word of the Lord, all Judah who dwell in the land of Egypt: ‘Behold, I have sworn by My great name,’ saith the Lord, ‘that My name shall no more be named in the mouth of any man of Judah in all the land of Egypt, saying, “The Lord God liveth.” — that my name shall no more be named in the mouth of any man of Judah in all the land of Egypt, saying, the Lord God liveth: this cannot be understood of the name of the Lord being called upon them, or of their being called by his name, and reckoned his people, since this respects not a name by which they should be named, but which they should name; and intends their use of the divine name in an oath, of which this is a form, “the Lord God liveth”:

or as sure as the Lord lives, or by the living God, it is so and so; and especially as used in their vows to burn incense to the Queen of heaven, they vowing by the living God that they would do so, which must be very abominable to him; and therefore he solemnly swears there should not be a Jew in all Egypt that should use it; the reason is, because everyone of them that did should be cut off.

27 Behold, I will watch over them for evil and not for good; and all the men of Judah who are in the land of Egypt shall be consumed by the sword and by the famine, until there be an end of them. — and all the men of Judah that are in the land of Egypt shall be consumed by the sword, and by the famine, until there be an end of them; that is, the greatest part of them, excepting a few that shall escape, hereafter mentioned, particularly Jeremiah, Baruch and the king’s daughters; but as for the main body of such, who went of their own accord to Egypt, and settled, and fell: into the idolatry of the country; these should all perish one after another, till there were none of them left; either by the sword of the king of Babylon; or by famine, which his army and sieges would produce; or by pestilence, though not here mentioned, yet is in Jeremiah 44:13.

28 Yet a small number that escape the sword shall return out of the land of Egypt into the land of Judah, and all the remnant of Judah that are gone into the land of Egypt to sojourn there shall know whose words shall stand, Mine, or theirs. — yet a small number that escaped the sword shall return out of the land of Egypt into the land of Judah; they shall make their escape out of the land of Egypt, where they did not go willingly; and, by one providence or another, shall come back to their native country, the land of Judea, When the rest will not; which must be a distinguishing factor among the groups:

— and all the remnant of Judah, that are gone into the land of Egypt to sojourn there, shall know what words shall stand, mine or theirs; those that are left of the sword, famine and pestilence, shall know by facts before them, whose words have their effect and accomplishment; whether theirs, that promised impunity and safety, peace and prosperity, in their idolatrous practices; or the Lord’s, which threatened with ruin and destruction. The Lord is true, and every man a liar; whatever devices are in a man’s heart, the counsel of the Lord, that shall stand.

29 And this shall be a sign unto you,’ saith the Lord, ‘that I will punish you in this place, that ye may know that My words shall surely stand against you for evil.’ — and this shall be a sign unto you, saith the Lord, that I will punish you in this place… in Egypt, as before threatened; and what follows is a confirming sign that so it would be; and which, when observed by some, gave the hint to them to make their escape; though others, being hardened in their idolatry, impenitence and unbelief, continued and perished.

30 Thus saith the Lord: ‘Behold, I will give Pharaoh Hophra king of Egypt into the hand of his enemies and into the hand of them that seek his life, as I gave Zedekiah king of Judah into the hand of Nebuchadnezzar king of Babylon, his enemy who sought his life.’” — as I gave Zedekiah king of Judah into the hand of Nebuchadnezzar king of Babylon that sought his life; in like manner, and as sure as God had done to one, he would do the other; and God puts the Jews in mind of what they had done to him; and might from hence conclude that this as a sign of their own ruin; and which they might know that it was indeed, the king of Egypt, in whom they trusted, being taken by his enemies, and his country wasted, they must in course fall prey to the conqueror.

~~~

More on the Queen of heaven: Astarte, Easter

Easter (which is how you pronounce Ishtar) is originally the celebration of Ishtar, the Assyrian and Babylonian goddess of fertility and sex. Vine’s Complete Expository Dictionary of Old and New Testament Words, in its entry “Easter,” states:

“The term ‘Easter’ is not of Christian origin. It is another form of Astarte, one of the titles of the Chaldean goddess, the queen of heaven. The festival of Pasch [Passover] held by Christians in post-apostolic times was a continuation of the Jewish feast . . . From this Pasch the pagan festival of ‘Easter’ was quite distinct and was introduced into the apostate Western religion, as part of the attempt to adapt pagan festivals to Christianity” (W.E. Vine, 1985).

Ishtar was an ancient Mesopotamian goddess of war, fertility, and sex. She is featured in the Epic of Gilgamesh, and the “Ishtar Gate” was part of Nebuchadnezzar’s Babylon. Her worship involved animal sacrifices; objects made of her sacred stone, lapis lazuli; and temple prostitution.

Superimposed over an image of Ishtar are these words: “This is Ishtar: pronounced ‘Easter.’ From Ishtar the name Easter was derived. It’s well known that Easter was originally the celebration of Ishtar, the Assyrian and Babylonian goddess of fertility and sex. Her symbols (like the egg and the bunny) were and still are fertility and sex symbols.

Back at the Council of Nicaea in 325 AD, Constantine read out the letter that he would subsequently send to churches everywhere: “When the question arose concerning the most holy day of Easter it was decreed by common consent to be expedient, that this festival should be celebrated on the same day by all, in every place… Let us then have nothing in common with … the Jews” sums up one of the key movement for the establishment of Easter to be cerebrated in the Church today.

After Constantine decided to Christianize the Empire, Easter was changed to represent Jesus. And everything Jewish were understood to be totally incompatible with Christianity. But at its roots, Easter is outwardly all about celebrating fertility and sex but inwardly it’s paying homage to a Mesopotamian goddess, the Queen of heaven, Ishtar.

Jeremiah (Ch 41-42)

•November 20, 2021 • Leave a Comment

The list of kings of Judah towards the end; in successive reigns, as Josiah (reign 640–609), Jehoahaz (reign 609), Jehoiakim (reign 609–598), Jehoiachin or Jechonias (reign 598–597), and Zedekiah (reign 597–586)

Jeremiah 41

1 Now it came to pass in the seventh month, that Ishmael the son of Nethaniah, the son of Elishama, of the royal seed and the princes of the king, came with ten men unto Gedaliah the son of Ahikam to Mizpah; and there they ate bread together in Mizpah. — now it came to pass in the seventh month…. the month Tisri, which answers to part of our September, and part of October; according to the Jewish chronicle, it was on the third day of this month, fifty two days after the destruction of the temple, that Gedaliah was slain; on which day a fast was kept by the Jews, after their return from captivity, on this occasion, called the fast of the seventh month, Zechariah 7:5;

— this event happened on the first day of the month, the beginning of the new year; but the fast was kept the day following, because the first day was a festival. Josephus says it was thirty days after Johanan had departed from Gedaliah, having given him information of the conspiracy against him.

Then arose Ishmael the son of Nethaniah and the ten men who were with him, and smote Gedaliah the son of Ahikam, the son of Shaphan, with the sword and slew him whom the king of Babylon had made governor over the land. — and slew him; they all drew their swords and thrust at him; though it is probable that Ishmael gave him the mortal wound, since the phrase, “and slew him”, is singular. Josephus says that Gedaliah prepared a splendid table, and made a sumptuous entertainment for them, and being drunk himself, which they observed, took the opportunity and slew him, and all at table with him;

— whom the king Babylon had made governor over the land; which mentioned; both to aggravate the crime they were guilty of, and to observe the reason of it, and what it was that prompted them to it; for so the words may be rendered, “because the king of Babylon had made him governor over the land.”

Ishmael also slew all the Jews who were with him, even with Gedaliah at Mizpah, and the Chaldeans who were found there and the men of war. — Ishmael also slew all the Jews that were with him, even with Gedaliah at Mizpah… not only those that were at table, but that were in the city also. Josephus says, that having slain those that were at the feast with him, he went out in the night, and slew all the Jews in the city, and the soldiers that were left by the Babylonians in it; but this cannot be understood of all the individuals there, or of the main body of the people, for they were carried captive by him.

And it came to pass the second day after he had slain Gedaliah, and no man knew it.

that there came certain ones from Shechem, from Shiloh and from Samaria, even fourscore men, having their beards shaven and their clothes rent and having cut themselves, with offerings and incense in their hand to bring them to the house of the Lord. — that there came certain from Shechem from Shiloh and from Samaria… places in the ten tribes, and which belonged to the house of Israel; so that it seems even at this distance of time, though the body of the ten tribes had been many years ago carried captive, yet there were still remnants (these could be of the house of Israel or from the house of Judah; or even colonies of the Samaritans) remaining and who had some regards to the temple at Jerusalem.

And Ishmael the son of Nethaniah went forth from Mizpah to meet them, weeping all along as he went; and it came to pass as he met them, he said unto them, “Come to Gedaliah the son of Ahikam.” — weeping all along as he go; pretending equal concern for the destruction of the land, city and temple as they had;

— he said unto them, come to Gedaliah the son of Ahikam; as if he was alive, and for whom he had a great respect, and whose character was well known to these men; and thought that this would be an inducement to come along with him: this he said either to try them, whether they had heard anything upon the road of the death of him; or as an argument to come into the city, suggesting the governor would gladly receive, and liberally entertain them. This looks as if their design was not to come to Mizpah, but to go on their way to Jerusalem, had they not been met with by him, and had he not thus solicited them.

And it was so when they came into the midst of the city, that Ishmael the son of Nethaniah slew them and cast them into the midst of the pit, he and the men who were with him. — and it was so, when they came into the midst of the city… there Gedaliah’s house was, to which he invited them; and as they went in, he shut up the court, as Josephus h says, and slew them, as it here follows:

— that Ishmael the son of Nethaniah slew them, and cast them into the midst of the pit; when he had slain them, the fourscore men he had enticed into the city, except ten of them, he cast their dead bodies into a pit near at hand:

— he, and the men that were with him; Ishmael and the ten princes, with what servants they brought with them; these were all concerned in the death of these men.

But ten men were found among them who said unto Ishmael, “Slay us not; for we have treasures in the field of wheat, and of barley, and of oil, and of honey.” So he forbore, and slew them not among their brethren.

Now the pit wherein Ishmael had cast all the dead bodies of the men, whom he had slain because of Gedaliah, was that which Asa the king had made for fear of Baasha king of Israel; and Ishmael the son of Nethaniah filled it with those who were slain. — now, the pit wherein Ishmael had cast all the dead bodies of the men whom he had slain because of Gedaliah, literally, “at the hand of Gedaliah,” that is, next to Gedaliah, whom he had first cast into this trench or cistern, was it which Asa, the king, had made for fear of Baasha, king of Israel,  and Ishmael, the son of Nethaniah filled it with them that were slain, a gruesome heap of his victims.

10 Then Ishmael carried away captive all the residue of the people who were in Mizpah, even the king’s daughters and all the people that remained in Mizpah, whom Nebuzaradan the captain of the guard had committed to Gedaliah the son of Ahikam; and Ishmael the son of Nethaniah carried them away captive, and departed to go over to the Ammonites. — then Ishmael carried away captive all the residue of the people that were in Mizpah, even the king’s daughters, all the princesses of the royal household, including the daughters of Zedekiah;

— and all the people that remained in Mizpah, whom Nebuzaradan, the captain of the guard, had committed to Gedaliah, the son of Ahikam, putting them into his care as people who had professed their loyalty to the Babylonian rule; and Ishmael, the son of Nethaniah, carried them away captive and departed to go over to the Ammonites, his intention being either to have his captives settle in the territory of the Ammonites, in the service of whose king he seems to have placed himself, or to sell them outright as slaves. Such is the way of men who yield to a life of sin: one crime leads to another, until they are fairly steeped in sins;

— even the king’s daughters; whether they were the daughters of Zedekiah, Jehoiakim, or Jehoiakim, we know not; but it is most likely that they were the daughters of Zedekiah the last king, and who was just taken and carried captive; and so Josephus expressly calls them; these the king of Babylon regarded not, because they could neither fight, nor claim the kingdom; only the sons of the king, whom he slew before his eyes; though it may be these were not his daughters by his lawful wife, but by his concubines and so were not properly of the royal family and less regarded.

11 But when Johanan the son of Kareah, and all the captains of the forces that were with him, heard of all the evil that Ishmael the son of Nethaniah had done,

12 then they took all the men and went to fight with Ishmael the son of Nethaniah, and found him by the great waters that are in Gibeon. — and found him by the great waters that are in Gibeon; taking this road to the country of Ammon, though it was not quite the direct road; either to avoid the forces of Johanan or rather for the sake of the hidden treasure at Shechem or Shiloh or Samaria, the ten men had promised him for their lives. 

13 Now it came to pass, that when all the people who were with Ishmael saw Johanan the son of Kareah and all the captains of the forces that were with him, then they were glad. — saw Johanan the son of Kareah, and all the captains of the forces that were with him, they were glad; looking upon them as their deliverers; hoping by their means to be preserved from being carried captives to the king of Ammon.

14 So all the people whom Ishmael had carried away captive from Mizpah turned about and returned, and went unto Johanan the son of Kareah. — so all the people that Ishmael had carried away captive from Mizpah cast about… or turned about, and wheeled off from Ishmael and deserted him at once; not at all regarding his authority nor fearing his menaces or his power; being in sight of the captains and their forces, they were determined to join and put themselves under their protection, knowing them to be their friends and that they came to deliver them;

— and returned and went unto Johanan the son of Kareah; turned their backs on Ishmael and marched directly to Johanan and the captains of the forces under them.

15 But Ishmael the son of Nethaniah escaped from Johanan with eight men, and went to the Ammonites.

16 Then Johanan the son of Kareah, and all the captains of the forces that were with him, took from Mizpah all the remnant of the people whom he had recovered from Ishmael the son of Nethaniah after he had slain Gedaliah the son of Ahikam — even mighty men of war, and the women, and the children, and the eunuchs whom he had brought again from Gibeon. — then took Johanan the son of Kareah, and all the captains of the forces that were with him… after Ishmael had made his escape, whom they did not think fit to pursue, and the people had committed themselves to their care and protection; and having brought them to Mizpah again, they took them from thence;

— all the remnant of the people whom he had recovered from Ishmael the son of Nethaniah from Mizpah, after that he had slain Gedaliah the son of Ahikam: those whom he had rescued from Ishmael and had returned to Mizpah be persuaded to go with him from thence;

— even mighty men of war and the women and the children and the eunuchs, whom he had brought again from Gibeon; or “men, [even] men of war” warlike men, soldiers; by which it appears that Ishmael must have more than ten men with him when he came to Mizpah, to do what he did there, to carry away such a number of captives, among which were mighty men, men of war, some of whom he had slain besides women and children, to which are added eunuchs not mentioned before, such as the king of Judah had in his court.

17 And they departed and dwelt in the habitation of Chimham, which is by Bethlehem, to go to enter into Egypt, — and dwelt in the habitation of Chimham, which is by Bethlehem: so called perhaps from Chimham, the son of Barzillai the Gileadite, to whom David or Solomon might give this place to dwell in, 2 Samuel 19:37;

— the Targum is express for the former, calling it “the habitation which David gave to Chimham, the son of Barzillai the Gileadite;” as it was near Bethlehem;

— to go to enter into Egypt; where they had an inclination to go; having still a friendly regard to that people, and a confidence in them, as appears by some following chapters; and that they might be ready and at hand to flee thither, should the Chaldeans come against them, which they feared.

18 because of the Chaldeans; for they were afraid of them, because Ishmael the son of Nethaniah had slain Gedaliah the son of Ahikam, whom the king of Babylon made governor in the land. — because of the Chaldeans… which clause some think should have been joined to Jeremiah 41:17. This is a reason given why they departed from Mizpah, and dwelt at the habitation of Chimham in the way to Egypt;;

— for they were afraid of them; at least this they pretended that the Chaldeans would come upon them and cut them off;

— because Ishmael the son of Nethaniah had slain Gedaliah the son of Ahikam whom the king of Babylon made governor in the land; no doubt it was provoking to them to hear that the governor of the king of Babylon was slain in this manner; and still more so as there were many Chaldeans slain with him; but there was no reason to believe that the king of Babylon would carry his resentment against the Jews with Johanan or take vengeance on them, who had so bravely appeared against the murderers, and had rescued the captives out of their hands: this seems only a pretence for their going into Egypt; for though they were promised safety in Judah by the Prophet Jeremiah, yet they were still for going into Egypt as the following chapters show.

Jeremiah 42

1 Then all the captains of the forces, and Johanan the son of Kareah, and Jezaniah the son of Hoshaiah, and all the people from the least even unto the greatest, came near — then all the captains of the forces… having taken up their residence at Chimham on their way to Egypt, where they were desirous of going, and being afraid of the Chaldeans, as they pretended.

and said unto Jeremiah the prophet, “Let, we beseech thee, our supplication be accepted before thee, and pray for us unto the Lord thy God, even for all this remnant (for we are left but a few of many, as thine eyes do behold us), — for we are left but a few as thine eyes do behold us; the number of the people had been very large, but by the judgements of the sword, famine, and pestilence and captivity, they were greatly reduced; here was their whole number before the prophet; his eyes beheld them, and the condition they were in: this they said move his compassion, and very likely to suggest to him how improbable it was that they should ever be able to continue in their own land; but that it would be better to put themselves under the protection of a neighbouring nation, Egypt, whither they were inclined to go; and hoped to have a word from the Lord by the prophet, to direct them thither.

that the Lord thy God may show us the way wherein we may walk and the thing that we may do.”

Then Jeremiah the prophet said unto them, “I have heard you; behold, I will pray unto the Lord your God according to your words, and it shall come to pass that whatsoever thing the Lord shall answer you, I will declare it unto you; I will keep nothing back from you.” — behold, I will pray unto the Lord your God, according to your words; be an intercessor for them; use his connection with his God and their God; and on account of relation, might expect to be heard; whom he would humbly entreat to direct what they should do as they desired.

Then they said to Jeremiah, “The Lord be a true and faithful witness between us, if we do not do even according to all things for which the Lord thy God shall send thee to us. — if we do not according to all things for the which the Lord thy God shall send thee to us; they promise to do everything the Lord should signify by the prophet as his will; and if they did not, wish the severest judgements of God might fall upon them.

Whether it be good or whether it be evil, we will obey the voice of the Lord our God to whom we send thee, that it may be well with us when we obey the voice of the Lord our God.” — that it may be well with us when we obey the voice of the Lord our God; they spoke as if they knew their own interest; for so it was, that it was well or ill with those people as they obeyed or disobeyed the voice of the Lord; and yet they acted not according to it; and what was worse, did not intend to. What a wretched scene of hypocrisy here!

And it came to pass after ten days that the word of the Lord came unto Jeremiah.

Then called he Johanan the son of Kareah, and all the captains of the forces who were with him, and all the people from the least even to the greatest, — all the captains of the forces which were with him and all the people from the least even unto the greatest; they were all convened together as it was proper they should to hear the word of the Lord; since they all joined in a request to the prophet, Jeremiah 42:1.

and said unto them, “Thus saith the Lord, the God of Israel, unto whom ye sent me to present your supplication before Him:

10 ‘If ye will still abide in this land, then will I build you and not pull you down, and I will plant you and not pluck you up; for I repent of the evil that I have done unto you. — if ye will still abide in this land… in the land of Judea, their native country where they had always lived; and yet they thought of going out of it, which the Lord knew; and therefore to encourage them to abide in it and not think of departing into Egypt;

— and not pluck you up; that is, they should be firm and stable, happy and prosperous; and abound with all kind of blessings and increase in numbers, wealth and riches. The metaphors are taken from building houses and planting fields and vineyards:

— for I repent me of the evil that I have done unto you; not that he had done any unjust thing to them; or that he changed his mind concerning them; but that he had compassion on them and would change his way and course of providence towards them according to his unchangeable will.

11 Be not afraid of the king of Babylon, of whom ye are afraid; be not afraid of him, saith the Lord, for I am with you to save you and to deliver you from his hand. — be not afraid of the king of Babylon of whom ye are afraid… lest he should revenge the death of Gedaliah upon them, which was a groundless fear; Jeremiah 41:18; or that they should be dealt hardly with by him and be cruelly oppressed and not able to live in subjection to him; Jeremiah 40:9;

— be not afraid of him, saith the Lord: who being omniscient knew they were and being omnipotent a greater King than the king of Babylon, the King of king? they had no reason to fear anything from him since they were under his protection;

— for I am with you to save you and to deliver you from his hand; from his avenging and oppressing hand; though they were not to be delivered as yet from subjection to him, or being tributaries to him; which they might be and yet dwell in peace and safety.

12 And I will show mercies unto you, that he may have mercy upon you and cause you to return to your own land.’ — and I will show mercies unto you, literally, “I will give you to experience mercies,” that he, the king of Babylon may have mercy upon you and cause you to return to your own land which they were now leaving in abject flight.

13 “But if ye say, ‘We will not dwell in this land,’ neither obey the voice of the Lord your God, — but if ye say, We will not dwell in this land, neither obey the voice of the Lord your God, thereby once more becoming guilty of open rebellion against God;

14 saying, ‘No, but we will go into the land of Egypt where we shall see no war, nor hear the sound of the trumpet, nor have hunger for bread, and there will we dwell’ — saying, No, but we will go into the land of Egypt, a plan which they had at least been discussing, if they had not yet decided upon it, where we will see no war nor hear the sound of the trumpet as it called the soldiers to the battle, nor have hunger of bread in the various unfortunate conditions accompanying war with which they had become so familiar in the last year and there will we dwell.

15 and now therefore hear the word of the Lord, ye remnant of Judah! Thus saith the Lord of hosts, the God of Israel: ‘If ye wholly set your faces to enter into Egypt, and go to sojourn there, — and now therefore hear the word of the Lord, ye remnant of Judah… a small remnant indeed, a few that were left in the land who ought therefore to have admired the distinguishing goodness of Providence in preserving them; where they should have continued and made use of their privilege to the glory of God and their mutual good:

— if you wholly set your faces to enter into Egypt: are resolved upon it and are actually engaged in it; turning their faces from Judea towards Egypt and obstinately pursuing it; their posture expresses their resolution, impudence and obstinacy;

— and go to sojourn there: to be sojourners and strangers there as their fathers had been before; the remembrance of which should be enough to set them against going into Egypt any more.

16 then it shall come to pass that the sword which ye feared shall overtake you there in the land of Egypt, and the famine whereof ye were afraid shall follow close after you there in Egypt; and there ye shall die. — then it shall come to pass that the sword which ye feared, contrary to the assurance of Yehovah, shall overtake you there in the land of Egypt, and the famine whereof ye were afraid shall follow close after you there in Egypt, pursuing you with unrelenting fierceness; and there ye shall die.

17 So shall it be with all the men that set their faces to go into Egypt to sojourn there. They shall die by the sword, by the famine, and by the pestilence; and none of them shall remain or escape from the evil that I will bring upon them.’ — so shall it be with all the men that set their faces to go into Egypt to sojourn there, having definitely made up their mind to that effect: they shall die by the sword, by the famine and by the pestilence, which by God’s punishment, could strike them in Egypt as well as in Judea; and none of them shall remain or escape from the evil that I will bring upon them.

18 For thus saith the Lord of hosts, the God of Israel: ‘As Mine anger and My fury hath been poured forth upon the inhabitants of Jerusalem, so shall My fury be poured forth upon you when ye shall enter into Egypt. And ye shall be an execration and an astonishment, and a curse and a reproach; and ye shall see this place no more.’ — as mine anger and my fury hath been poured upon the inhabitants of Jerusalem; like a large hasty shower of rain; or rather like melted metal which suddenly and swiftly runs, and spreads itself and burns and consumes with a violent heat; such was the wrath of God on Jerusalem in its destruction by the Chaldeans:

— so shall my fury be poured forth upon you when ye shall enter into Egypt; as soon as they had well got there, quickly after they were settled there; for it was in the time of the then present king of Egypt, Pharaohhophra, and by the then present king of Babylon, Nebuchadnezzar, that the destruction of Egypt was, in which these Jews suffered;

— and ye shall be an execration and an astonishment, a curse and a reproach; men should be astonished at the hand of God upon them;

— and ye shall see this place no more; and so their case would be worse than their brethren in Babylon; who after a term of years were expired, would return to their own land, but these they would never see any more.

19 “The Lord hath said concerning you, O ye remnant of Judah: ‘Go ye not into Egypt!’ Know certainly that I have admonished you this day. — the Lord hath said concerning you, O ye remnant of Judah, so the prophet now elaborates upon the direct prophecy of Yehovah, Go ye not into Egypt; know certainly that I have admonished you this day, testifying against you and warning you.

20 For ye dissembled in your hearts when ye sent me unto the Lord your God, saying, ‘Pray for us unto the Lord our God; and according unto all that the Lord our God shall say, so declare unto us, and we will do it.’ — and according to all that the Lord our God shall say, so declare unto us and we will do it; they pressed him to a faithful declaration of the will of God to them, and promised they would act according to it. Now he had done all this; prayed unto him as they requested, and had brought them his mind and will, and yet they did not appreciate it; so that the deceit was greatly magnified.

21 And now I have this day declared it to you, but ye have not obeyed the voice of the Lord your God, nor any thing for which He hath sent me unto you. — and now I have this day declared it to you; that ye have not obeyed the voice of the Lord, your God, nor anything for the which He hath sent me unto you.

22 Now therefore know certainly that ye shall die by the sword, by the famine, and by the pestilence in the place whither ye desire to go and to sojourn.” — that ye shall die by the sword, by the famine and by the pestilence; by one or another, or all of them; some by one, and some by another, as before threatened; evils they thought to escape by going thither, but which should surely follow them and overtake them;

— in the place whither ye desire to go and to sojourn; that is, in Egypt, to which they had a strong inclination where they greatly desired to be, pleased themselves with the thoughts of it and which they chose of their own will and pleasure for their own destruction.

Jeremiah (Ch 39-40)

•November 19, 2021 • 1 Comment

The list of kings of Judah towards the end; in successive reigns, as Josiah (reign 640–609), Jehoahaz (reign 609), Jehoiakim (reign 609–598), Jehoiachin or Jechonias (reign 598–597), and Zedekiah (reign 597–586)

Jeremiah 39

1 In the ninth year of Zedekiah king of Judah in the tenth month, came Nebuchadnezzar king of Babylon and all his army against Jerusalem, and they besieged it. — in the ninth year of Zedekiah king of Judah; that would be around 588 BC; in the tenth month… the month Tebet, which is part of December and part of January; so that it was in the winter season the siege of Jerusalem began:

— and they besieged it, provoked by Zedekiah’s breaking the covenant with him, and rebelled against him, who had set him upon his throne, so Nebuchadnezzar was determined to revenge; and came even in winter for a long march and a siege.

— the king of Babylon came in person at first; but having begun the siege, and given proper orders to his generals for the carrying of it on, and supposing it would be a long one, retired to Riblah in Syria, either for pleasure or for other issues. The time of beginning the siege exactly agrees with the account in II Kings 25:1; but there are more details given, expressing the day of the month, which was the tenth of it; and so in.

And in the eleventh year of Zedekiah in the fourth month, the ninth day of the month, the city was broken into. — and in the eleventh year of Zedekiah, in the fourth month… the month Tammuz, which answers to part of June, and part of July: the ninth day of the month, the city was broken up; or taken by storm; the walls of it were broken by engines and battering rams, so that the Chaldeans could enter and take it. This was just a year and a half after it had been besieged, which would be around 586 BC; not being able to hold out any longer, because of the famine; Jeremiah 52:6.

And all the princes of the king of Babylon came in and sat in the Middle Gate: even Nergalsharezer, Samgarnebo, Sarsechim, Rabsaris, Nergalsharezer, Rabmag, with all the residue of the princes of the king of Babylon.

And it came to pass that when Zedekiah the king of Judah saw them and all the men of war, then they fled and went forth out of the city by night, by the way of the king’s garden, by the gate betwixt the two walls; and he went out the way of the plain.

But the Chaldeans’ army pursued after them, and overtook Zedekiah in the plains of Jericho; and when they had taken him, they brought him up to Nebuchadnezzar king of Babylon, to Riblah in the land of Hamath, where he gave judgement upon him. — but the Chaldean army pursued after them… being informed of the flight by those surrendered to them, as Josephus says; or not finding the king, his family, nobles and guards at the palace, where they expected them, and knowing which way they must take, pursued after them; not the whole army, only a part of it; for some must remain at Jerusalem to demolish the city and take the spoil of it:

— and overtook Zedekiah in the plains of Jericho; not far from it, as Josephus says; that when his friends and generals saw the enemy near, they deserted him and fled and only a few were with him when being surrounded:

— and when they had taken him they brought him to Nebuchadnezzar king of Babylon to Riblah in the land of Hamath: which is generally thought to be Antioch in Syria; whither he had retired from the siege of Jerusalem, having left it to his generals to refresh himself in this pleasant place, as it seems it was; or that he might be nearer in his own kingdom; however, here he was, and here the army brought Zedekiah to him, and those they took with him;

— where he passed sentence on him, which was to have his eyes put out: he severely chide him and upbraided him for the perfidy he had been guilty of in breaking his oath;

— so Josephus says, “after he came to him, Nebuchadnezzar began to call him a wicked man and a covenant breaker, unmindful of promises he had made to preserve the country for him; he reproached him with ingratitude, in receiving the kingdom from him he had taken from Jehoiakim, and given to him, who had used his power against the giver; but, says he, the great God that hates thy manners has put thee into our hands.”

Then the king of Babylon slew the sons of Zedekiah before his eyes in Riblah; also the king of Babylon slew all the nobles of Judah. — all his sons were killed but nothing said about the daughters; these must be very young, at least some of them; since Zedekiah at this time was only thirty two years of age. This must be a dreadful spectacle for him and the pains must be cutting, that it was owing to his own obstinacy in not taking the advice of the prophet Jeremiah to surrender to the Chaldeans, whereby he and his family would have been saved, Jeremiah 38:17;

— also the king of Babylon slew all the nobles of Judah; who did not come over to the Chaldean army and surrender themselves; such who advised the king to stand out to the last and who fled and were taken with him; as many of them as fell into the hands of the king of Babylon. Rashi says those “the nobles of Judah” were members of the Sanhedrin, who advised Zedekiah from his oath to Nebuchadnezzar.

Moreover he put out Zedekiah’s eyes, and bound him with chains to carry him to Babylon. — moreover he put out Zedekiah’s eyes… by what means is not certain; however, hereby the prophecy of Jeremiah was fulfilled, that his eyes should see the king of Babylon, as they did, before they were put out, and that he should not die by the sword, Jeremiah 34:3;

— and also the prophecy of Ezekiel, Ezekiel 12:13; that he should be brought to Babylon, and yet should not see it; for his eyes were put out before he was carried there: a full proof of the prescience of God; of his foreknowledge of future and contingent events; of the truth and certainty of prophecy, and of the authority of divine revelation;

— and bound him with two brass or iron chains, or fetters, for both his legs; and thus bound and was carried to Babylon, where he remained to the day of his death.

And the Chaldeans burned the king’s house and the houses of the people with fire, and broke down the walls of Jerusalem. — and the houses of the people, with fire; the houses of the common people, as distinct from the king’s palace and the houses of the nobles, Jeremiah 52:13; but a den of thieves;

— and broke down the walls of Jerusalem; all the fortifications were entirely dismantled, that it might be no more a city of force and strength as it had been.

Then Nebuzaradan the captain of the guard carried away captive into Babylon the remnant of the people that remained in the city and those who fell away, who fell to him, with the rest of the people who remained. — carried away into Babylon the remnant of the people that remained in the city; that were left of the pestilence, famine and sword; and who were found in it when it was taken.

10 But Nebuzaradan the captain of the guard left the poor of the people, who had nothing, in the land of Judah, and gave them vineyards and fields at the same time. — but Nebuzaradan the captain of the guard left of the poor of the people, which had nothing, in the land of Judah… because they would have been of no service to the Chaldeans, but a burden to them; and because they had nothing to fear from them; they had no arms to rebel against them, nor money to purchase any; and because it would be to their interest to have the land manured, and not lie waste, that they might have some tribute from it;

— and gave them vineyards and fields at the same time; as their own property to dress and cultivate, and receive the advantage of them; though a tax was laid upon them; or they were to pay tribute to the king of Babylon; or, however, contribute out of them to the support of the government that was placed over them; and this was a happy incident in their favour; they, who before had nothing, are now proprietors of vineyards and fields, when the former owners were carried away as captives: there might be much of the justice of God conspicuous in this affair; such who had been oppressed and ill used by the rich are now retaliated with their possessions.

11 Now Nebuchadnezzar king of Babylon gave charge concerning Jeremiah to Nebuzaradan the captain of the guard, saying,

12 “Take him and look well to him, and do him no harm; but do unto him even as he shall say unto thee.” — take him and look well to him… take him out of prison; take him under his immediate care; receive him kindly and use him humanely; provide everything necessary for him and let him not want for anything: or, “set thine eyes upon him” look pleasantly at him, and let him be always under your view and inspection; treat him not with neglect and contempt, but see to it that nothing is wanting to him;

— and do him no harm; no injury to his person by beating, imprisoning or starving him; nor suffer any to be done to him by the common soldiers or by his own people: let him have whatever he asks for: this was great favour from a heathen prince indeed and more than he met with from his own countrymen.

13 So Nebuzaradan the captain of the guard sent Nebushasban, Rabsaris, and Nergalsharezer, Rabmag, and all the king of Babylon’s princes.

14 even they sent and took Jeremiah out of the court of the prison and committed him unto Gedaliah the son of Ahikam the son of Shaphan, that he should carry him home. So he dwelt among the people. — even they sent and took Jeremiah out of the court of the prison… where he was, when Jerusalem was taken, Jeremiah 38:28; and where he remained until this order came;

— and committed him unto Gedaliah the son of Ahikam the son of Shaphan; the father of this person seems to be the same who saved Jeremiah from being delivered into the hand of the people to be put to death by them in Jehoiakim’s reign, Jeremiah 26:24; and he himself was doubtless a prince of Judah that deserted to the Chaldeans during the siege and was in esteem with them, and appointed a governor over those that were left in the land.

15 Now the word of the Lord came unto Jeremiah while he was shut up in the court of the prison, saying,

16 “Go and speak to Ebedmelech the Ethiopian, saying, ‘Thus saith the Lord of hosts, the God of Israel: Behold, I will bring My words upon this city for evil and not for good; and they shall be accomplished in that day before thee.

17 But I will deliver thee in that day, saith the Lord; and thou shalt not be given into the hand of the men of whom thou art afraid.

18 For I will surely deliver thee, and thou shalt not fall by the sword; but thy life shall be as a prize unto thee, because thou hast put thy trust in Me, saith the Lord.’” — because thou hast put thy trust in me, saith the Lord; what he had done in serving the prophet and other good actions sprung from a principle of faith and confidence in the Lord and his prophet; and this the Lord had a respect unto; without which works are not right; and without which it is impossible to please God with them; and which faith may be and be true where fears are.

Jeremiah 40

1 The word that came to Jeremiah from the Lord after Nebuzaradan, the captain of the guard, had let him go from Ramah, when he had taken him bound in chains among all who were carried away captive of Jerusalem and Judah, who were carried away captive unto Babylon. — here Nebuzaradan had further duty to do with his captives as they fell into his hands, among whom were Jeremiah, when he was taken out of prison and out of Jerusalem and brought him to Ramah:

— still bound in chains Jeremiah was not set free yet; but without the knowledge of Nebuzaradan, and through the inadvertency of inferior officers, he was taken and bound, and with other prisoners brought to Ramah, in order to be transported to Babylon, for Ramah was to the north of Jerusalem as Babylon was.

And the captain of the guard took Jeremiah and said unto him, “The Lord thy God hath pronounced this evil upon this place. — and said unto him, the Lord thy God hath pronounced this evil on this place; the city of Jerusalem; and now in ruins; the houses burnt; the walls broken down and the inhabitants spoiled and carried captive. This was the evil which the Lord, he says, had “decreed” as the Targum renders it.

Now the Lord hath brought it, and done according as He hath said: because ye have sinned against the Lord and have not obeyed His voice, therefore this thing has come upon you. — this heathen captain acknowledges the hand of the Lord in all this; and suggests, that his master, the king of Babylon himself, and the rest of the generals, were only instruments the Lord made use of; which is very piously as well as wisely said; and more is here acknowledged by him than by the Jews themselves.

And now behold, I loose thee this day from the chains which were upon thine hand. If it seem good unto thee to come with me into Babylon, come, and I will look well after thee; but if it seem ill unto thee to come with me into Babylon, forbear. Behold, all the land is before thee. Wherever it seemeth good and convenient for thee to go, thither go.” — and now, behold, I loose thee this day from the chains which were upon thine hands… Or rather are; for, when he said these words, it is highly probable they were on him, though now ordered to be taken off;

— whither it seemeth good and convenient for thee to go, thither go; he left him to take his own way and do as he thought fit; and this agrees with his master’s orders to him, Jeremiah 39:12.

Now while he had not yet gone back, he said, “Go back also to Gedaliah the son of Ahikam, the son of Shaphan, whom the king of Babylon hath made governor over the cities of Judah, and dwell with him among the people; or go wheresoever it seemeth convenient unto thee to go.” So the captain of the guard gave him victuals and a reward and let him go. — according to the Targum, these are the words of Nebuzaradan, which paraphrases them thus; “if thou wilt not return (that is, with him to Babylon, or rather to Jerusalem, or best to his own native place), or if thou wilt not dwell (that is, in this place), go back to Gedaliah.”

— or go wherever it seemeth convenient unto thee to go; though he gave him his advice, he did not press it, but left him at full liberty to take his own way and go into what part of the land he pleased and settle in it:

— so the captain of the guard gave him victuals (food or provisions), and a reward, and let him go; the prophet was just out of prison and destitute for the necessaries of life, and the land was laid waste by the enemy; and therefore he could not have subsisted without a supply, which was liberally given by the captain; not only food for sustenance sufficient for his journey, which way soever he took, but a present of money or clothes or both; which was very kind treatment of a prophet by a heathen victor.

Then went Jeremiah unto Gedaliah, the son of Ahikam, to Mizpah, and dwelt with him among the people who were left in the land.

Now when all the captains of the forces which were in the fields, even they and their men, heard that the king of Babylon had made Gedaliah the son of Ahikam governor in the land, and had committed unto him men and women and children, and the poor of the land of those who were not carried away captive to Babylon,

then they came to Gedaliah at Mizpah — even Ishmael the son of Nethaniah, and Johanan and Jonathan the sons of Kareah, and Seraiah the son of Tanhumeth, and the sons of Ephai the Netophathite, and Jezaniah the son of a Maachathite, they and their men; — then they came to Gedaliah to Mizpah… having heard that the Chaldean army was gone, and so were in no fear of that; and also that Gedaliah was made deputy governor, one of their own nation, a pious, prudent man, a man of integrity under which was much preferable to captivity in a foreign country, though tributary to Babylon.

And Gedaliah the son of Ahikam, the son of Shaphan, swore unto them and to their men, saying, “Fear not to serve the Chaldeans. Dwell in the land and serve the king of Babylon, and it shall be well with you. — saying, fear not to serve the Chaldeans, as if it was an evil to do it; or as if their yoke was hard and intolerable; or they should be always in danger of their lives:

— dwell in the land and serve the king of Babylon; pay your tributes and and it shall he well with you; settle in the land and do not rove about from place to place like fugitives; nor go out of the land through fear of the king of Babylon, but continue in it and live in subjection to him and depend upon it you will live comfortably and safely.

10 As for me, behold, I will dwell at Mizpah to serve the Chaldeans, who will come unto us; but ye, gather ye wine and summer fruits and oil, and put them in your vessels, and dwell in your cities that ye have taken.”

11 Likewise when all the Jews who were in Moab, and among the Ammonites and in Edom, and who were in all the countries, heard that the king of Babylon had left a remnant of Judah, and that he had set over them Gedaliah the son of Ahikam, the son of Shaphan,

12 even all the Jews returned out of all places whither they were driven and came to the land of Judah, to Gedaliah at Mizpah, and gathered wine and summer fruits in abundance.

13 Moreover Johanan the son of Kareah and all the captains of the forces that were in the fields came to Gedaliah at Mizpah

14 and said unto him, “Dost thou certainly know that Baalis the king of the Ammonites hath sent Ishmael the son of Nethaniah to slay thee?” But Gedaliah the son of Ahikam believed them not. — that Baalis the king of the Ammonites hath sent Ishmael the son of Nethaniah to slay thee? very probably Ishmael, with the forces under him, fled to the king of the Ammonites when Jerusalem was captured; who, out of ill will to the Jews, always bore them by the Ammonites, envying their reestablishment under Gedaliah, and hoping to make a prey of them if their governor was removed, moved it to this young prince to dispatch him; and who might be forward enough to undertake it, being displeased that Gedaliah should be governor, which he might think was an office he had a better right to, being of the seed royal; and therefore readily agreed to be sent to take away the governor’s life;

— but Gedaliah believed them not; being a good man, and knowing he had done nothing to disoblige him, could not believe a person of such birth and dignity would ever be guilty of such an action: and being of the seed royal, it is highly probable Gedaliah had shown a distinguished regard to him, which he might think was the reason of this charge being brought against him, out of envy; yet he ought to have inquired into it, and provided for his own safety, against the worst that might happen.

15 Then Johanan the son of Kareah spoke to Gedaliah in Mizpah secretly, saying, “Let me go, I pray thee, and I will slay Ishmael the son of Nethaniah, and no man shall know it. Why should he slay thee, that all the Jews who are gathered unto thee should be scattered and the remnant in Judah perish?”

16 But Gedaliah the son of Ahikam said unto Johanan the son of Kareah, “Thou shalt not do this thing, for thou speakest falsely of Ishmael.” — but Gedaliah the son of Ahikam said unto Johanan the son of Kareah… in answer to his request, and the motion made by him: thou shalt not do this thing; or, “do not do this thing” dissuading him from it, as being unlawful to take away a man’s life in such a secret manner, without any legal process against him; though it seems to carry more in it, that he laid his commands upon him not to do it, and threatened him if he did:

— for thou speakest falsely of Ishmael; or “a lie” a false accusation or a slander; which isn’t describing Johanan well, who had expressed such a concern for him. The events in the following chapter shows that the information was good and that it was no lie or speakest falsely that was told; and it would have been well for Gedaliah and the people of Judah if they had taken the warning seriously; but the time was not right for Judah to be restored; and things were thus to suffer more and further punishment of the people resulted.

Jeremiah (Ch 37-38)

•November 18, 2021 • Leave a Comment

The list of kings of Judah towards the end; in successive reigns, as Josiah (reign 640–609), Jehoahaz (reign 609), Jehoiakim (reign 609–598), Jehoiachin or Jechonias (reign 598–597), and Zedekiah (reign 597–586)

Jeremiah 37

1 And King Zedekiah the son of Josiah reigned instead of Coniah the son of Jehoiakim, whom Nebuchadnezzar king of Babylon made king in the land of Judah. — and King Zedekiah the son of Josiah reigned… the brother of Jehoiakim, whose untimely death, and want of burial, are prophesied of in the preceding chapter. The name of Zedekiah was Mattaniah before he was king; his name was changed by the king of Babylon, who made him king, II Kings 24:17.

But neither he nor his servants, nor the people of the land hearkened unto the words of the Lord, which He spoke by the prophet Jeremiah. — but neither he, nor his servants, nor the people of the land… the king, his courtiers and subjects the royal family, nobility, and common people; they were all degenerate and corrupt; that Jehoiakim was wicked, and so with all his people wicked but Zedekiah seems to possess one single righteous action of taking Jeremiah out of prison; and according to this account, king and people were all wicked.

And Zedekiah the king sent Jehucal the son of Shelemiah, and Zephaniah the son of Maaseiah the priest to the prophet Jeremiah, saying, “Pray now unto the Lord our God for us.” — to the Prophet Jeremiah, saying, pray now unto the Lord our God for us. This message was sent either upon the rumour of the Chaldeans coming against Jerusalem, as some think; or rather when it had departed from the city, and was gone to meet the army of the king of Egypt; so that this petition to the prophet was to pray that the king of Egypt alight get the victory over the Chaldean army, and that that might not return unto them. Thus wicked men will desire the prayers of good men in times of distress, when their words, their cautions, admonitions, exhortations, and prayers too, are despised by them at another time.

Now Jeremiah came in and went out among the people, for they had not put him into prison. — now Jeremiah came in and went out among the people… was free to go in and out of the city whenever he pleased; or go to any part of it, and converse with the people and prophesy to them; which he could not do in the latter part of Jehoiakim’s reign, who sent officials after him and Baruch to take them, and they hide themselves, yea, the Lord hid them,Jeremiah 36:19; but now he was under no restraint, as least as yet:

— for they had not put him into prison; not yet; they afterwards did, Jeremiah 37:15.

Then Pharaoh’s army came forth out of Egypt; and when the Chaldeans who besieged Jerusalem heard tidings of them, they departed from Jerusalem. — then Pharaoh’s army was come forth out of Egypt… at the time the above message was sent to Jeremiah. Zedekiah, though he had took an oath of homage to the king of Babylon, rebelled against him, and entered into a league with the king of Egypt, to whom he sent for succours in his distress; and who, according to agreement, sent his army out of Egypt to break up the siege of Jerusalem; for though the king of Egypt came no more in person out of his land, after his defeat at Carchemish by Nebuchadnezzar, in the fourth year of Jehoiakim, Jeremiah 46:2; yet he sent his army to the relief of Jerusalem.

Then came the word of the Lord unto the prophet Jeremiah, saying,

“Thus saith the Lord, the God of Israel: Thus shall ye say to the king of Judah, who sent you unto Me to inquire of Me: ‘Behold, Pharaoh’s army, which has come forth to help you, shall return to Egypt into their own land. — thus shall ye say to the king of Judah, that sent you unto me, to inquire of me; in an oracular way; for by this it seems that they were not only sent to desire the prophet to pray for them, but to obtain an oracle from the Lord, confirming it to them, that the Chaldean army which was gone would not return any more; this they were willing to believe, but wanted to have a confirmation of it from the Lord;

— and so the Targum says “to seek an oracle from me;” or to ask instruction or doctrine from me: now these messengers are bid to go back and tell the king, his nobles, and all the people of the land, what follows:

— behold, Pharaoh’s army, which is come forth to help you, shall return to Egypt, into their own land; being afraid to face the Chaldean army; or being defeated and driven back by it. Josephus a says there was a battle fought between the Egyptians and Chaldeans, in which the latter were conquerors, and put the former to flight, and drove them out of all Syria. Rashi relates a fable, how that the Egyptian army came by ships, and that at sea they saw strange appearances, upon which they said one to another, what means this? they replied, these are our fathers, whom the fathers of those we are going to help drowned in the sea; and immediately returned to their own land.

And the Chaldeans shall come again and fight against this city, and take it and burn it with fire.’ — and the Chaldeans shall come again… to Jerusalem, after they have defeated or drove back the Egyptian army:and fight against this city; with fresh rigour and resolution; being exasperated by the methods taken to oblige them to raise the siege:

— and take it, and burn it with fire; and they did, Jeremiah 39:8.

Thus saith the Lord: Deceive not yourselves, saying, ‘The Chaldeans shall surely depart from us,’ for they shall not depart.

10 For though ye had smitten the whole army of the Chaldeans who fight against you, and there remained but wounded men among them, yet should they rise up every man in his tent and burn this city with fire.”

11 And it came to pass that when the army of the Chaldeans had broken off from Jerusalem for fear of Pharaoh’s army, — and it came to pass, that when the army of the Chaldeans were broken up from Jerusalem… when the siege of the city was broken up and raised: or, when they “went up from Jerusalem” were gone from it;

— for fear of Pharaoh’s army; or rather “because of Pharaoh’s army”; the word “fear” is not in the text; nor did they leave Jerusalem for fear of his army, but to meet it, and give it battle, as they did; however, by this means there was a freer passage to and from the city.

12 then Jeremiah went forth out of Jerusalem to go into the land of Benjamin to separate himself from thence in the midst of the people.

13 And when he was in the Gate of Benjamin, a captain of the guard was there, whose name was Irijah the son of Shelemiah, the son of Hananiah; and he took Jeremiah the prophet, saying, “Thou fallest away to the Chaldeans!” — whose name [was] Irijah, the son of Shelemiah, the son of Hananiah: the grandson as some think, of that Hananiah the false prophet, of whose death Jeremiah the prophet prophesied, Jeremiah 28:16;

— and the Jews have a tradition that Hananiah ordered his son Shelemiah, that if he ever had an opportunity to bring Jeremiah to ruin, to do it; and the same charge Shelemiah gave to his son Irijah, who, having this opportunity, laid hold on him; Rashi make mention of it:

— and he took Jeremiah the prophet, saying, thou fallest away to the Chaldeans; it looks as if, though he might not have a family grudge against him, as the Jews suggest, yet had a hatred of him for his prophecies, and therefore fixes this calumny on him; for otherwise, why did he suffer the people to pass in great numbers without any such charge?

14 Then said Jeremiah, “It is false! I fall not away to the Chaldeans.” But he hearkened not to him; so Irijah took Jeremiah and brought him to the princes. — I fall not away to the Chaldeans; for the Chaldean army was gone from the city; nor did Jeremiah like so well to be with an idolatrous people; for after the city was taken, when Nebuzaradan the captain of the guard gave him his choice, either to go with him to Babylon, where he promised to take care of him; or to go to Gedaliah, who was made governor of Judah; he chose rather to be with him, and his poor company:

— so Irijah took Jeremiah, and brought him to the princes; the princes of Zedekiah’s court, or the princes of the people, the civil magistrates; or it may be the great Sanhedrin, who he knew had no good disposition towards the prophet.

15 Thereupon the princes were wroth with Jeremiah, and smote him and put him in prison in the house of Jonathan the scribe; for they had made that the prison. — and put him in prison, in the house of Jonathan the scribe; such an one as Elishama was in Jehoiakim’s time, who had a house or apartment at court as he had, who was now dead or removed, Jeremiah 36:12.

16 When Jeremiah had entered into the dungeon and into the cells, and Jeremiah had remained there many days,

17 then Zedekiah the king sent and took him out; and the king asked him secretly in his house, and said, “Is there any word from the Lord?” And Jeremiah said, “There is; for, said He: Thou shalt be delivered into the hand of the king of Babylon!” — then Zedekiah the king sent and took him out… after Jeremiah had been in prison for some time; and the Chaldean army being returned, and having renewed their siege, the king is frightened; and knowing the prophet was in prison, sends a messenger to take him out from thence, and bring him to him; which was accordingly done:

— is there any word from the Lord? he means any particular word of prophecy, any late one, and what concerned their present circumstances, showing what would be the issue of the return of the Chaldean army; for prophecy did not come at all times, nor even according to the will of man, but always according to the will of God, and when he thought fit; this the king knew very well, and he wanted a comfortable word, some good news of the failure of the present attempt:

— for, said he, thou shall be delivered into the hand of the king of Babylon; which was boldly and faithfully said, to be said to the face of the king himself, risking his life in so doing; or, at least, exposing himself to severer treatment, if severer could be used.

18 Moreover Jeremiah said unto King Zedekiah, “How have I offended against thee or against thy servants or against this people, that ye have put me in prison? — what have I offended against thee, or against thy servants, or against this people, that ye have put me in prison? or, “what have I sinned?” have I been guilty of treason against thee, O king? or of scandal and defamation of any of thy nobles and courtiers? have I done any injury to any of the king’s subjects? has there been any falsehood in my prophecies? has not everything appeared to be true that I have spoken, concerning the coming of the Chaldeans to invade the land, and besiege the city? and concerning the return of the Chaldean army when broken up?

— why then should I be cast into prison, and detained there? is it not a clear case that what I have said comes from the Lord? and therefore ought not to be used in this manner.

19 Where are your prophets now who prophesied unto you, saying, ‘The king of Babylon shall not come against you, nor against this land’? — where your prophets now that prophesied unto you… your false prophets, as the Targum says; what is become of their prophecies? where is the truth of them, to which general credit has been given? where are they?

20 Therefore hear now, I pray thee, O my lord the king. Let my supplication, I pray thee, be accepted before thee, that thou cause me not to return to the house of Jonathan the scribe, lest I die there.” — that thou cause me not to return to the house of Jonathan the scribe; but that he might be discharged from his confinement; or however be removed into another prison, not so uncomfortable and disagreeable as this man’s house or prison was; and which perhaps was still the worse through his cruel and ill natured carriage to him; and which all together endangered his life: wherefore he adds;

— lest I die there; for though he had continued there many days, yet the place was so exceedingly noisome, that he thought he could not long continue there, was he remanded back to it.

21 Then Zedekiah the king commanded that they should commit Jeremiah into the court of the prison, and that they should give him daily a piece of bread out of the bakers’ street, until all the bread in the city was spent. Thus Jeremiah remained in the court of the prison. — then Zedekiah the king commanded that they should commit Jeremiah into the court of the prison… he did not think fit to discharge him entirely, lest it should give offence to the princes, who had committed him; but he ordered him to be put in a court belonging to the prison, where he might breathe in a freer air, and have liberty of walking to and fro, where his friends might be admitted to come and see him:

— and that they should give him daily a piece of bread out of the bakers’ street; it seems there was a street in Jerusalem so called, where the bakers lived; and perhaps the king’s bakers; who had orders to deliver to the prophet every day a piece or loaf of bread, as much as was sufficient for a man; or, however, as much as the scarcity of provisions in a siege would allow. Kimchi makes mention of a Midrash, which interprets this of bread made of bran, which was sold without the palace; as if it was coarser bread than what was eaten at court:

— until all the bread in the city was spent; that is, as long as there was any. These were the king’s orders: thus Jeremiah remained in the court of the prison: until the city was taken; unless a small time that he was in the dungeon of Malchiah, out of which he was taken again, and restored to the court of the prison, and there continued; Jeremiah 38:6.

Jeremiah 38

1 Then Shephatiah the son of Mattan, and Gedaliah the son of Pashur, and Jucal the son of Shelemiah, and Pashur the son of Malchiah heard the words that Jeremiah had spoken unto all the people, saying,

“Thus saith the Lord: ‘He that remaineth in this city shall die by the sword, by the famine, and by the pestilence; but he that goeth forth to the Chaldeans shall live; for he shall have his life as a prey, and shall live.’ — but he that goeth forth to the Chaldeans shall live: that goes out of the city, throws down his arms, delivers up himself to the Chaldean army, and submits to their mercy, shall have quarters given him, and his life shall be spared.

Thus saith the Lord: ‘This city shall surely be given into the hand of the king of Babylon’s army, which shall take it.’” — thus saith the Lord, this city shall surely be given into the hand of the king of Babylon’s army… when those found in it should be put to the sword, or carried captive: this the prophet declares with the greatest certainty; and what he had often affirmed for twenty years past, and now stands to it, having had fresh assurances from the Lord that so it would be; and which he faithfully published; though he had received some favours from the court, had his liberty enlarged, and was now eating the king’s bread, he was not to be bribed by these things to hold his peace; but the nearer the ruin of the city was, the more confident was he of its destruction.

Therefore the princes said unto the king, “We beseech thee, let this man be put to death; for thus he weakeneth the hands of the men of war who remain in this city, and the hands of all the people, by speaking such words unto them; for this man seeketh not the welfare of this people, but the hurt.” — we beseech thee, let this man be put to death; or, “let this man now be put to death,” as the Targum says;

— for thus he weakened the hands of the men of war that remain in this city, and the hands of all the people, in speaking such words to them; dispirited the soldiers who were set for the defence of the city, such of them as were left, who were not taken off by the sword, famine, or pestilence; since, if what Jeremiah said was true, all attempts to defend it must be in vain; and the people be without any hope of being delivered out of the hands of the enemy.

Then Zedekiah the king said, “Behold, he is in your hand; for the king is not he that can do any thing against you.”

Then they took Jeremiah and cast him into the dungeon of Malchiah, the son of Hammelech, which was in the court of the prison; and they let down Jeremiah with cords. And in the dungeon there was no water, but mire; so Jeremiah sank in the mire.

Now when Ebedmelech the Ethiopian, one of the eunuchs who was in the king’s house, heard that they had put Jeremiah in the dungeon (the king then sitting in the Gate of Benjamin),

Ebedmelech went forth out of the king’s house and spoke to the king, saying,

“My lord the king, these men have done evil in all that they have done to Jeremiah the prophet, whom they have cast into the dungeon; and he is likely to die of hunger in the place where he is, for there is no more bread in the city.”

10 Then the king commanded Ebedmelech the Ethiopian, saying, “Take from hence thirty men with thee, and take up Jeremiah the prophet out of the dungeon before he dies.”

11 So Ebedmelech took the men with him, and went into the house of the king under the treasury, and took from thence old castoff clothes and old rotten rags, and let them down by cords into the dungeon to Jeremiah.

12 And Ebedmelech the Ethiopian said unto Jeremiah, “Put now these old castoff clothes and rotten rags under thine armpits, under the cords.” And Jeremiah did so.

13 So they drew up Jeremiah with cords, and took him up out of the dungeon; and Jeremiah remained in the court of the prison.

14 Then Zedekiah the king sent and took Jeremiah the prophet unto him into the principal entry that is in the house of the Lord; and the king said unto Jeremiah, “I will ask thee a thing; hide nothing from me.”

15 Then Jeremiah said unto Zedekiah, “If I declare it unto thee, wilt thou not surely put me to death? And if I give thee counsel, wilt thou not hearken unto me?”

16 So Zedekiah the king swore secretly unto Jeremiah, saying, “As the Lord liveth, who made us this soul, I will not put thee to death, neither will I give thee into the hand of these men who seek thy life.”

17 Then said Jeremiah unto Zedekiah, “Thus saith the Lord, the God of hosts, the God of Israel: ‘If you will surrender to the officers of the king of Babylon, then your soul will live and this city will not be burned with fire. Thus you and your household will live.’ — if thou wilt assuredly go forth unto the king of Babylon’s princes; the generals of his army, whose names are mentioned, Jeremiah 39:3; the king not being with his army at this time, but at Riblah, Jeremiah 39:5; the meaning is, if he would open the gates of Jerusalem, and go forth from thence to the Chaldean army, and surrender himself and the city into the hands of the princes in it, and general officers of it:

— then thy soul shall live; in thy body and not be separated from it; or live comfortably in peace and safety though not in so much splendour and glory as he had done; and thine house; not only himself, but his wives, children and servants.

— and this city shall not be burned with fire; as had been threatened; and as the Chaldeans would be provoked to do, should it hold out to the last extremity; but should preserve it upon a surrender.

18 But if thou wilt not go forth to the king of Babylon’s princes, then shall this city be given into the hand of the Chaldeans, and they shall burn it with fire, and thou shalt not escape out of their hand.’” — but if thou wilt not go forth to the king of Babylon’s princes… and surrender to them: then shall this city be given into the hands of the Chaldeans; if not willingly delivered up by the king of Judah, it shall be forcibly taken by the king of Babylon’s army.

19 And Zedekiah the king said unto Jeremiah, “I am afraid of the Jews who are fallen to the Chaldeans, lest they deliver me into their hand, and they mock me.” — I am afraid of the Jews that are fallen to the Chaldeans; who did go out of the city, and surrendered to the Chaldeans, whom Zedekiah had cruelly used, or severely threatened:

— lest they deliver me into their hands, and they mock me; that is, lest the Chaldeans should deliver him into the hands of the Jews, and they should jeer and scoff at him, for doing the same thing he had forbidden them on the severest penalty; or lest they should put him to death in the most revengeful and contemptuous manner, but all this was either a mere excuse, or showed great weakness.

20 But Jeremiah said, “They shall not deliver thee. Obey, I beseech thee, the voice of the Lord, which I speak unto thee; so it shall be well with thee, and thy soul shall live. — obey, I beseech thee, the voice of the Lord, which I speak unto thee; the counsel he had given him, to surrender to the Chaldeans, was not from himself, but from the Lord: and though he had no express order to give it at that time, yet it was what was agreeable to the will of God, and what he had exhorted the people to in the beginning of this chapter; and therefore, since it came from the Lord, as it ought to be attended to, so he might be assured of the divine protection, should he act according to it:

— so it shall be well with thee, and thy soul shall live; that is, it would not only be much better with him than he feared, but than it would be with him should he obstinately stand out to the last; he should have more respect and honour from the king of Babylon; and not only have his life spared, but enjoy more of the comforts of life; particularly the sight of his eyes, which he lost when taken.

21 But if thou refuse to go forth, this is the word that the Lord hath shown me:

22 And behold, all the women who are left in the king of Judah’s house shall be brought forth to the king of Babylon’s princes, and those women shall say, ‘Thy friends have set thee up and have prevailed against thee. Thy feet are sunk in the mire, and they have turned away back.’ — and, behold, all the women that are left in the king of Judah’s house… that were left in the royal palace when Jehoiakim and Jeconiah were carried captives; or which were left of the famine and pestilence in, Zedekiah’s house; or would be left there when he should flee and make his escape; meaning his concubines, or maids of honour, and court ladies;

— and those women shall say, thy friends have set thee on, and have prevailed against thee: or, “the men of thy peace” the false prophets, and the princes that hearkened to them, and promised and flattered him with peace and prosperity, these deceived him; they set him on to hold out against the Chaldeans, and not believe the Prophet Jeremiah; and they prevailed with him to do so, though it was against himself, and his own interest:

— and they are turned away back; meaning either his feet, which were distorted, and had turned aside from the right way; or now could go on no further against the enemy, but were obliged to turn back and flee; or else the men of his peace, the false prophets and princes, who had fed him with vain hopes of safety, now left him, and every man shifted for himself. This would be said by the women, either in a mournful manner, by way of complaint; or as scoffing at the king, as a silly foolish man, to hearken to such persons; and so he that was afraid of being mocked by the Jews is jeered at by the women of his house.

23 So they shall bring out all thy wives and thy children to the Chaldeans. And thou shalt not escape out of their hand, but shalt be taken by the hand of the king of Babylon; and thou shalt cause this city to be burned with fire.” — so they shall bring out all thy wives and thy children to the Chaldeans… not the citizens of Jerusalem; but, as Kimchi observes, the Chaldeans that should enter the city shall bring them out to the Chaldeans without: or it may be rendered impersonally, “they shall be brought out” not only the ladies at court, that waited on him and his queen, as before; but all his wives and concubines, and his children, or his sons rather; for at the taking of the city no mention is made of daughters, only of sons, who were slain before his eyes, Jeremiah 39:6;

— and thou shalt not escape out of their hand, but shalt be taken by the hand of the king of Babylon; not by him personally, for he was not present at the taking of him, but by his army, who having taken him, brought him to him, and delivered him into his hand, Jeremiah 39:5;

— and thou shalt cause this city to be burnt with fire; or, “thou shall burn this city with fire” b; be the moral cause of it; through his sin and obstinacy, impenitence and unbelief, the burning of the city might be laid to his charge; his sin was the cause of it; and it was all one as if he had burnt it with his own hands. All this is said to work upon him to hearken to the advice given; but all was in vain.

24 Then said Zedekiah unto Jeremiah, “Let no man know of these words, and thou shalt not die.

25 But if the princes hear that I have talked with thee, and they come unto thee and say unto thee, ‘Declare unto us now what thou hast said unto the king, also what the king said unto thee; hide it not from us, and we will not put thee to death,’ — and say unto thee, declare unto us now what thou hast said unto the king; hide it not from us, and we will not put thee to death; also what the king said unto thee: the king knew how inquisitive they would be, and sift the prophet to the bottom, to know both what the prophet said to the king, about the state of affairs respecting the Chaldeans, and the surrender of the city to them, which they supposed to be the subject of the discourse; and what were the king’s thoughts about it, and his determinations concerning it; and in order to make the prophet easy, and more free and open to tell the whole matter, he suggests they would promise him his life should not be taken away.

26 then thou shalt say unto them, ‘I presented my supplication before the king, that he would not cause me to return to Jonathan’s house to die there.’” — then thou shalt say unto them… here the king puts words into the prophet’s mouth, what he should say to the princes, to put them off from inquiring further, and so keep the matter a secret:

— that he would not cause me to return to Jonathan’s house, to die there; this he had entreated of the king before, Jeremiah 37:20; and now, no doubt, renewed his request, having this fair opportunity with the king alone to do it; or, however, it is highly probable he did it upon this hint of the king. This shows how much the king stood in fear of his princes in this time of his distress; and that he had only the name of a king, and had not courage and resolution enough to act of himself, according to the dictates of his mind; yea, that he feared men more than he feared the Lord.

27 Then came all the princes unto Jeremiah and asked him, and he told them according to all these words that the king had commanded. So they left off speaking with him, for the matter was not perceived. — for the matter was not perceived; or, “was not heard” though there were persons that saw the king and the prophet together, yet nobody heard anything that passed between them; and therefore Jeremiah could not be confronted in what he had said, or be charged with concealing anything.

28 So Jeremiah remained in the court of the prison until the day that Jerusalem was taken, and he was there when Jerusalem was taken. — the Targum, rendering it, “and it came to pass when Jerusalem was taken.”

Jeremiah (Ch 35-36)

•November 18, 2021 • Leave a Comment

The list of kings of Judah towards the end; in successive reigns, as Josiah (reign 640–609), Jehoahaz (reign 609), Jehoiakim (reign 609–598), Jehoiachin or Jechonias (reign 598–597), and Zedekiah (reign 597–586)

Jeremiah 35

1 The word which came unto Jeremiah from the Lord in the days of Jehoiakim the son of Josiah, king of Judah, saying, — the time indicated would be around 609-598 BC during Jehoiakim’s reign.

“Go unto the house of the Rechabites and speak unto them, and bring them into the house of the Lord, into one of the chambers, and give them wine to drink.” — go unto the house of the Rechabites… Or “family” these are the same with the Kenites, who descended from Hobab or Jethro, Moses’s father in law, Judges 1:16; these, as their ancestors, became proselytes to Israel, and always continued living with them, though a distinct people from them; these here had their name from Rechab, a famous man in his time among those people.

Then I took Jaazaniah the son of Jeremiah, the son of Habazziniah, and his brethren and all his sons and the whole house of the Rechabites,

and I brought them into the house of the Lord, into the chamber of the sons of Hanan, the son of Igdaliah, a man of God, which was by the chamber of the princes, which was above the chamber of Maaseiah the son of Shallum, the keeper of the door.

And I set before the sons of the house of the Rechabites pots full of wine, and cups; and I said unto them, “Drink ye wine.”

But they said, “We will drink no wine; for Jonadab the son of Rechab, our father, commanded us, saying, ‘Ye shall drink no wine, neither ye, nor your sons for ever. — for Jonadab the son of Rechab our father; not their immediate father, but their progenitor; perhaps the same Jonadab is meant who lived in the times of Jehu, and rode with him in his chariot; by which it appears he was a man of note and figure, and who lived near three hundred years before this time, II Kings 10:15; which is more likely than that he should be a descendant of his, and the proper father of the present Rechabites;

— commanded us, saying, ye shall drink no wine, nor your sons, for ever. What was the reason of this command and of what follows is not easy to say; whether it was to prevent quarrels and contentions, luxury and sensuality; or to inure them to hardships; or to put them in remembrance that they were but strangers in the land in which they lived; or to retain them in the original course of life their ancestors had lived in, feeding cattle; be it what it will, these his sons thought themselves under obligations to observe; perhaps finding, by experience, it was for their good so to do.

Neither shall ye build a house, nor sow seed, nor plant a vineyard, nor have any; but all your days ye shall dwell in tents, that ye may live many days in the land where ye are strangers.’ — neither shall ye build house, nor sow seed, nor plant vineyard, nor have any… that is, they were not to build houses, sow seed, or plant vineyards, for themselves, for their own profit and advantage; nor possess either of these through purchase or gift: partly because they were strangers in the land of Israel;

— and partly because the pastoral life was what their ancestors had lived; and therefore Jonadab was desirous it should be continued in his posterity; as well as because by this means they would live not envied by the Israelites; since they did not covet to get any part of their possessions into their hands; upon any public calamity, as sword, famine, or pestilence, they could more easily flee to other places.

Thus have we obeyed the voice of Jonadab the son of Rechab, our father, in all that he hath charged us: to drink no wine all our days, we, our wives, our sons, nor our daughters,

nor to build houses for us to dwell in; neither have we vineyard, nor field, nor seed.

10 But we have dwelt in tents, and have obeyed and done according to all that Jonadab our father commanded us.

11 But it came to pass, when Nebuchadnezzar king of Babylon came up into the land, that we said, ‘Come, and let us go to Jerusalem for fear of the army of the Chaldeans and for fear of the army of the Syrians.’ So we dwell at Jerusalem.” — so we dwell at Jerusalem, making use of the city as a temporary refuge, until they might return to their home-land. The Rechabites thus offered a fine example of willing obedience to the command of their tribal head.

12 Then came the word of the Lord unto Jeremiah, saying,

13 “Thus saith the Lord of hosts, the God of Israel: Go and tell the men of Judah and the inhabitants of Jerusalem, ‘Will ye not receive instruction to hearken to My words?’ saith the Lord.

14 ‘The words of Jonadab the son of Rechab, that he commanded his sons not to drink wine, are performed; for unto this day they drink none, but obey their father’s commandment. Notwithstanding I have spoken unto you, rising early and speaking, but ye hearkened not unto Me. — the words of Jonadab the son of Rechab, that he commanded his sons, not to drink wine, are performed… that article particularly, respecting drinking wine, has been carefully observed; which, though so agreeable to the nature of man, what cheers the heart of God and man, and was not prohibited them by any law of God; yet, being forbidden by their father, they abstained from it:

— for unto this day they drink none, but obey their father’s commandment; though prescribed them three hundred years ago; during all which time they had punctually observed it, even to that very day; which might with great truth and strictness be said; since they had that very day refused to drink any:

— notwithstanding I have spoken unto you, rising early, and speaking; who am the eternal God; the King of kings; the great Lawgiver, able to save and to destroy; who had spoken to them, and given them laws as soon as they were a people, very early, in the times of Moses, on Mount Sinai and Horeb; and of which they had been reminded time after time, and enforced by proper arguments and motives; whereas the command of Jonadab was that of a mere man, not above three hundred years ago, and of which his posterity had never been put in mind, but as it was handed down from father to son; and this they constantly observed:

— but ye hearkened not unto me; so that the house of Judah’s disobedience was greatly aggravated.

15 I have sent also unto you all My servants the prophets, rising up early and sending them, saying, “Return ye now every man from his evil way and amend your doings, and go not after other gods to serve them, and ye shall dwell in the land which I have given to you and to your fathers.” But ye have not inclined your ear, nor hearkened unto Me.

16 Because the sons of Jonadab the son of Rechab have performed the commandment of their father which he commanded them, but this people hath not hearkened unto Me,

17 therefore thus saith the Lord God of hosts, the God of Israel: Behold, I will bring upon Judah and upon all the inhabitants of Jerusalem all the evil that I have pronounced against them, because I have spoken unto them but they have not heard, and I have called unto them but they have not answered.’” — behold, I will bring upon Judah, and upon all the inhabitants of Jerusalem, all the evil that I have pronounced against them: which means of all the threatenings and curses in the law and the prophets respecting the Jews, until the times of Jeremiah; though it may more especially intend the evil, God by him had pronounced upon them; namely, that the Chaldean army should come into their land, besiege Jerusalem, and take it, and to carry its inhabitants away as captives:

— because I have spoken unto them, but they have not heard; and I have called unto them, but they have not answered; he spoke to them by his prophets, he called to them in his providences, and took every method to warn them of their sin and danger, and bring them to repentance and reformation; but all to no purpose;

— the Targum says, “because I sent unto them all my servants the prophets, but they obeyed not; and they prophesied to them, but they returned not.”

18 And Jeremiah said unto the house of the Rechabites, “Thus saith the Lord of hosts, the God of Israel: ‘Because ye have obeyed the commandment of Jonadab your father, and kept all his precepts and done according unto all that he hath commanded you,

19 therefore thus saith the Lord of hosts, the God of Israel: Jonadab the son of Rechab shall not lack for a man to stand before Me for ever.’” — Jonadab the son of Rechab shall not want a man to stand before me for ever; which may be understood of a long time, of ages to come; or as long as the people of the Jews were a people, or the world should stand, the posterity of this man should continue: or, “a man shall not be cut off from Jonadab” his offspring shall never fail. It is certain that some of this family returned from the captivity, 1 Chronicles 2:55

— the Targum paraphrased, “ministering before me;” serving and worshipping God, for they were religious people; that is, in their own families, carrying on religious worship among themselves, though not in the temple, where they had no office, and did no service; though some think they had, some being called scribes.

Jeremiah 36

1 And it came to pass in the fourth year of Jehoiakim the son of Josiah, king of Judah, that this word came unto Jeremiah from the Lord, saying: — and it came to pass in the fourth year of Jehoiakim the son of Josiah king of Judah… around 606 BC; eighteen years before the destruction of Jerusalem.

“Take thee a scroll of a book, and write therein all the words that I have spoken unto thee against Israel and against Judah and against all the nations from the day I spoke unto thee, from the days of Josiah, even unto this day. — and write therein all the words that I have spoken unto thee against Israel, and against Judah; for though Israel was carried captive before the times of Jeremiah, and his prophecies were chiefly directed against Judah; yet as there were some of the ten tribes mixed with them, they were included in these prophecies, and therefore mentioned:

— and against all the nations; such as Egypt, Edom, Ammon, and Moab, Jeremiah 9:26;

— from the day that I spake unto thee, from the days of Josiah, even unto this day; that is, from the time the Lord called him to prophesy in his name, which was in, the thirteenth year of Josiah, who reigned thirty-one years; and this being the fourth year of Jehoiakim, it must be the twenty-third year of his prophesying, and the a course of full twenty-two years; Jeremiah 1:2;

— now all his discourses and prophecies he had delivered out against one and another, during this time, must all be written in one roll or book, that that they might be read. This roll could probably be the book of Lamentations, and if so, the book of Lamentations should serve as a appendix to the book of Jeremiah..

It may be that the house of Judah will hear all the evil which I purpose to do unto them, that they may return every man from his evil way, that I may forgive their iniquity and their sin.”

Then Jeremiah called Baruch the son of Neriah; and Baruch wrote from the mouth of Jeremiah all the words of the Lord which He had spoken unto him upon a scroll of a book. — then Jeremiah called Baruch the son of Neriah… one of his disciples, and whom he had before made use of in the purchase of a field of his uncle’s son, and to whom he gave the evidence of the purchase, Jeremiah 32:12; he was probably a better penman than the prophet, or a quicker writer;

— and Baruch wrote from the mouth of Jeremiah all the words of the Lord, which he had spoken unto him, upon a roll of a book; it seems that Jeremiah had not committed any of his prophecies to writing; and yet it cannot be thought that by the mere strength of memory he could repeat every discourse and prophecy he had delivered in the space of twenty-two years; wherefore it must be concluded that same Spirit, which first dictated the prophecies to him, brought them fresh memory; so that he could readily repeat them to Baruch, who took them down in writing on a roll of parchment.

And Jeremiah commanded Baruch, saying, “I am shut up; I cannot go into the house of the Lord.

Therefore go thou, and read in the scroll, which thou hast written from my mouth, the words of the Lord in the ears of the people in the Lord’S house upon the fasting day; and also thou shalt read them in the ears of all Judah who come out of their cities. — upon the fasting day; the day of atonement; the great fast, which was on the tenth day of the seventh month, in the fourth year of Jehoiakim; and so a different time of reading from that in Jeremiah 36:9. This was a very proper time to read it in, when the people were fasting and humbling themselves before the Lord; though some think this was a fast proclaimed by Jehoiakim, to avert the vengeance threatened by the Chaldean army.

It may be they will present their supplication before the Lord, and will return every one from his evil way; for great is the anger and the fury that the Lord hath pronounced against this people.”

And Baruch the son of Neriah did according to all that Jeremiah the prophet commanded him, reading in the book the words of the Lord in the Lord’S house.

And it came to pass in the fifth year of Jehoiakim the son of Josiah, king of Judah, in the ninth month, that they proclaimed a fast before the Lord to all the people in Jerusalem, and to all the people who came from the cities of Judah unto Jerusalem. — and all the people that came from the cities of Judah unto Jerusalem: these proclaimed the fast; they applied to the government for one, or however obeyed the king’s orders, and published and proclaimed a fast; not only the inhabitants of Jerusalem, but those who came from other cities on the king’s order, or for worship.

10 Then read Baruch in the book the words of Jeremiah in the house of the Lord, in the chamber of Gemariah the son of Shaphan, the scribe, in the higher court at the entry of the New Gate of the Lord’S house in the ears of all the people.

11 When Michaiah the son of Gemariah, the son of Shaphan, had heard out of the book all the words of the Lord,

12 then he went down into the king’s house into the scribe’s chamber; and lo, all the princes sat there, even Elishama the scribe, and Delaiah the son of Shemaiah, and Elnathan the son of Achbor, and Gemariah the son of Shaphan, and Zedekiah the son of Hananiah, and all the princes. — and all the princes, who were either members of the great Sanhedrin, or courtiers; it appears from hence that this court was very profane and irreligious; for though they had proclaimed a fast, to make a show of religion, or at the importunity of the people; yet they did not attend temple worship and service themselves, but were all together in the secretary’s office, very probably about political affairs.

13 Then Michaiah declared unto them all the words that he had heard when Baruch read the book in the ears of the people.

14 Therefore all the princes sent Jehudi the son of Nethaniah, the son of Shelemiah, the son of Cushi unto Baruch, saying, “Take in thine hand the scroll wherein thou hast read in the ears of the people, and come.” So Baruch the son of Neriah took the scroll in his hand, and came unto them.

15 And they said unto him, “Sit down now, and read it in our ears.” So Baruch read it in their ears. — so Baruch read it in their ears; without any fear or dread, though in the king’s palace, and before an assembly of princes; nor did he excuse himself on account of weariness, having just read it to the people; or upbraid the princes with not being in the temple, where they might have heard it.

16 Now it came to pass, when they had heard all the words, they were afraid both one and the other, and said unto Baruch, “We will surely tell the king of all these words.”

17 And they asked Baruch, saying, “Tell us now, how didst thou write all these words from his mouth?”

18 Then Baruch answered them, “He pronounced all these words unto me with his mouth, and I wrote them with ink in the book.”

19 Then said the princes unto Baruch, “Go, hide thee, thou and Jeremiah; and let no man know where ye be.” — go hide thee, thou and Jeremiah, and let no man know where ye be. Some of these princes at least seem to be good men, and had regards for the prophet and his scribe, and were concerned for their welfare; and knowing the furious temper of the king, provided against the worst; and in point of prudence advised Baruch and his master to abscond, and not let anyone know where they were, lest they should be betrayed; nor did they, the princes, desire to know themselves. 

20 And they went in to the king into the court, but they laid up the scroll in the chamber of Elishama the scribe, and told all the words in the ears of the king.

21 So the king sent Jehudi to fetch the scroll; and he took it out of Elishama the scribe’s chamber. And Jehudi read it in the ears of the king and in the ears of all the princes who stood beside the king. — literally, “over the king” for since they were standing in his presence, their heads were higher than his;

— and Jehudi read it in the ears of the king, and in the ears of all the princes that stood by the king: as he doubtless was ordered; and which he did so loudly, clearly and distinctly, that the king and all the princes could hear.

22 Now the king sat in the winter house in the ninth month, and there was a fire on the hearth burning before him.

23 And it came to pass that when Jehudi had read three or four leaves, he cut it with the penknife and cast it into the fire that was on the hearth, until all the scroll was consumed in the fire that was on the hearth.

24 Yet they were not afraid, nor rent their garments, neither the king nor any of his servants who heard all these words. — yet they were not afraid, nor rent their garments… they were not struck with horror at such an impious action as the burning of the roll; nor afraid of the judgements and wrath of God threatened in it; nor did they rend their garments in token of sorrow and mourning on account of either, as used to be when anything blasphemous was said or done, or any bad news were brought.

25 Nevertheless Elnathan and Delaiah and Gemariah had made intercession to the king that he should not burn the scroll; but he would not hear them.

26 But the king commanded Jerahmeel the son of Hammelech, and Seraiah the son of Azriel, and Shelemiah the son of Abdeel to take Baruch the scribe and Jeremiah the prophet; but the Lord hid them. — but the Lord hid them; the princes advised them to hide themselves, and they did, very probably in a house of some of their friends; but this would not have been sufficient, had not the Lord took them under his protection.

27 Then the word of the Lord came to Jeremiah, after the king had burned the scroll and the words which Baruch wrote at the mouth of Jeremiah, saying,

28 “Take thee again another scroll, and write in it all the former words that were in the first scroll, which Jehoiakim the king of Judah hath burned.

29 And thou shalt say to Jehoiakim king of Judah, ‘Thus saith the Lord: Thou hast burned this scroll, saying, “Why hast thou written therein, saying: the king of Babylon shall certainly come and destroy this land, and shall cause to cease from thence man and beast?”

30 Therefore thus saith the Lord concerning Jehoiakim king of Judah: He shall have none to sit upon the throne of David, and his dead body shall be cast out in the day to the heat and in the night to the frost. — he shall have none to sit upon the throne of David; that is, none of his seed that should reign after him, or succeed him in the throne of David and kingdom of Judah; for his son Jeconiah reigned but three months, which is reckoned as nothing, and could not be called sitting upon the throne; and Zedekiah, who followed, was not his lawful successor, not his seed but a brother to Jehoiakim, and was set up by the king of Babylon in contempt of the latter.

31 And I will punish him and his seed and his servants for their iniquity; and I will bring upon them and upon the inhabitants of Jerusalem and upon the men of Judah all the evil that I have pronounced against them; but they hearkened not.’” — and I will bring upon them, and upon the inhabitants of Jerusalem, and upon the men of Judah, all the evil that I have pronounced against them; the sword, famine, and pestilence; the destruction of their land, city, and temple; and their captivity in Babylon.

32 Then Jeremiah took another scroll and gave it to Baruch the scribe, the son of Neriah who wrote in it from the mouth of Jeremiah all the words of the book which Jehoiakim king of Judah had burned in the fire. And there were added to them many like words. — many like words or clauses, there were added unto them of the same nature and argument; besides, the discourse delivered in the Temple court was, in modern phrase, revised and enlarged, dictated to Baruch as before, and in this shape has probably come down to us through the fresh inspiration of God’s spirits, from hence we may infer that God did not always use the very form of words which the writers have set down, but directing them in general to express his sense with new dimensions, with a heavier denunciation of his wrath and vengeance. From whence proceeds that a variety of style and format which we may observe in the Scriptures, suitable to the different genius and flair of different writers.

Jeremiah (Ch 33-34)

•November 17, 2021 • 1 Comment

The list of kings of Judah towards the end; in successive reigns, as Josiah (reign 640–609), Jehoahaz (reign 609), Jehoiakim (reign 609–598), Jehoiachin or Jechonias (reign 598–597), and Zedekiah (reign 597–586)

Jeremiah 33

1 Moreover the word of the Lord came unto Jeremiah the second time, while he was yet shut up in the court of the prison, saying,

“Thus saith the Lord the maker thereof, the Lord who formed it to establish it, the Lord is His name: — the Lord isn’t his name, the Lord is a title; Yehovah is his name (more at the end)

‘Call unto Me, and I will answer thee, and show thee great and mighty things, which thou knowest not.’ — some copies read it, “things reserved” as the Targum says; and so Rashi, who interprets it of things future, of things reserved in the heart of God;

— which thou knowest not; until revealed; canst be known without further revelation; that by these great and hidden things are not meant the destruction of Jerusalem, nor the seventy years’ captivity, nor return from that, nor things which Jeremiah had been made acquainted with time after time, and had prophesied of them; but something not revealed as yet…

For thus saith the Lord, the God of Israel, concerning the houses of this city and concerning the houses of the kings of Judah, which are thrown down by the siege mounds and by the sword: — the Targum says, “which they pulled down, and threw up mounts to strengthen the wall, against those that kill with the sword.”

‘They come to fight with the Chaldeans, but it is to fill them with the dead bodies of men whom I have slain in Mine anger and in My fury, and for all whose wickedness I have hid My face from this city. — and for all whose wickedness I have hid my face from the city; had no pity for it, showed no mercy to it, gave it no help and assistance, or protection, having withdrawn his presence from it. So the Targum says, “I have caused my Shekinah to depart from this city, because of their wickedness.”

Behold, I will bring it health and cure; and I will cure them and will reveal unto them the abundance of peace and truth.

And I will cause the captivity of Judah and the captivity of Israel to cease, and will build them as at the first. — and I will cause the captivity of Judah and the captivity of Israel to return… mention being made of the return of the captivity of Israel, or the ten tribes, as well as that of Judah, shows that this prophecy does not relate to the return of the Jews from their seventy years’ captivity in Babylon; but is to be understood to be yet in the future;

— according to the Septuagint of Ezekiel 4, the captivity of Judah is 40 years whereas the captivity of Israel will be 190 years.

And I will cleanse them from all their iniquity whereby they have sinned against Me; and I will pardon all their iniquities whereby they have sinned and whereby they have transgressed against Me.

And it shall be to Me a name of joy, a praise and an honor before all the nations of the earth, which shall hear all the good that I do unto them; and they shall fear and tremble for all the goodness and for all the prosperity that I provide unto it.’ — and they shall fear and tremble, for all the goodness and for all the prosperity that I procure unto it; that is, they shall fear the Lord, and tremble at his word; not with a slavish, but filial fear, which is consistent with joy and gladness.

10 “Thus saith the Lord: ‘Again there shall be heard in this place (which ye say shall be desolate, without man and without beast, even in the cities of Judah and in the streets of Jerusalem that are desolate, without man and without inhabitant and without beast),

11 the voice of joy and the voice of gladness, the voice of the bridegroom and the voice of the bride, the voice of them that shall say, “Praise the Lord of hosts, for the Lord is good; for His mercy endureth for ever” — and of those who shall bring the sacrifice of praise into the house of the Lord. For I will cause to return the captives of the land, as at the first, saith the Lord.

— such wild partyings the likes of Paris Hilton’s would ease and instead they would ask, “Why hath the Lord pronounced all these evils against us? Or what is our sin that we have committed against the Lord our God?”

12 “Thus saith the Lord of hosts: ‘Again in this place which is desolate, without man and without beast, and in all the cities thereof shall be a habitation of shepherds causing their flocks to lie down.

13 In the cities of the mountains, in the cities of the vale, and in the cities of the South, and in the land of Benjamin, and in the places about Jerusalem, and in the cities of Judah, shall the flocks pass again under the hands of him that counteth them,’ saith the Lord.

14 “‘Behold, the days come,’ saith the Lord, ‘that I will perform that good thing which I have promised unto the house of Israel and to the house of Judah. — behold, the days are coming; there shall come a time when he will verify every good word which he hath spoken to, or concerning his people. 

15 In those days and at that time will I cause the Branch of righteousness to grow up unto David; and He shall execute judgment and righteousness in the land.

16 In those days shall Judah be saved, and Jerusalem shall dwell safely. And this is the name wherewith she shall be called: The Lord Our Righteousness.’

17 “For thus saith the Lord: ‘David shall never be in want for a man to sit upon the throne of the house of Israel; — David shall never want a man to sit upon the throne of the house of Israel; or, “there shall not be cut off unto David a man” and this is to be understood of the temporal kingdom of David, which has mysterious been preserved from even a long time ago.

18 neither shall the priests, the Levites, be in want for a man before Me to offer burnt offerings, and to kindle meat offerings, and to do sacrifice continually.’” — neither shall the priests the Levites for want a man before me… although the work of the Levitical priesthood has been abandoned long ago, their line, clan or tribe had mysterious been preserved.

19 And the word of the Lord came unto Jeremiah, saying,

20 “Thus saith the Lord: ‘If ye can break My covenant of the day and My covenant of the night, and that there should not be day and night in their season, — thus saith the Lord, if you can break my covenant of the day, and my covenant of the night… the same with the ordinances of the sun, moon, and stars, Jeremiah 31:35; the original constitution and law of nature, settled from the beginning of the world, and observed ever since, in the constant revolution of day and night; and which was formed into a covenant and promise to Noah, after the deluge, that day and night should not cease, as long as the earth remained,

21 then may also My covenant be broken with David My servant, that he should not have a son to reign upon his throne, and with the Levites the priests, My ministers.

22 As the host of heaven cannot be numbered, neither the sand of the sea measured, so will I multiply the seed of David My servant and the Levites who minister unto Me.’”

23 Moreover the word of the Lord came to Jeremiah, saying,

24 “Considerest thou not what this people have spoken, saying, ‘The two families which the Lord hath chosen, He hath even cast them off’? Thus they have despised My people, that they should be no more a nation before them. — with respect to the two families, these two families being the kingdom of Israel and the kingdom of Judah; they “despised My people,” claiming that they had rejected God and then Jesus and hence our well-accepted paganized “Christians” are the chosen of God; hence the birth and prominence of the replacement theology today;

— replacement theology is the view that our modern Ishtar- and Mithras-worshipping church is the new or true Israel that has permanently replaced or superseded Israel as the people of God.

25 Thus saith the Lord: ‘If My covenant be not with day and night, and if I have not appointed the ordinances of heaven and earth, —”Not so” the Lord says;

26 then will I cast away the seed of Jacob and David My servant, so that I will not take any of his seed to be rulers over the seed of Abraham, Isaac, and Jacob; for I will cause their captivity to cease, and have mercy on them.’” — “Well, here’s God’s response: ‘If my covenant with day and night wasn’t in working order, if sky and earth weren’t functioning the way I set them going, then, but only then, you might think I had disowned the descendants of Jacob and of my servant David, and that I wouldn’t set up any of David’s descendants over the descendants of Abraham, Isaac, and Jacob. But as it is, I will give them back everything they’ve lost. The last word is, I will have mercy on them.’” (MSG)

~~~

More on God’s name, Yehovah.

God’s name is the four-letter Hebrew word יהוה‎ YHVH Yehovah, which are embedded in the Masoretic text over 6000 times, yet when translated into our English language most had been translated as Lord, or LORD, which are titles, but not his name. His name is יהוה‎ Yehovah, or YEHOVAH (but there are no capital letters in Hebrew).

It wasn’t until 1524 that Gian Giorgio Trissino, an Italian Renaissance grammarian, invented the letter J that this new letter started to take a hold in the writings of western Europe. Even in 1611 when the English Bible the King James has our subject of study by the prophet Jeremiah, he was known as Ieremiah. So Jehovah is a very late comer.

The following verses with the LORD erred in translation. His name Yehovah should be used:

I am the LORD; that is My name. And My glory will I not give to another, neither My praise to graven images. Isaiah 42:8

And it shall come to pass, that whosoever shall call on the name of the LORD shall be delivered; for in Mount Zion and in Jerusalem shall be deliverance, as the LORD hath said, and in the remnant whom the LORD shall call. Joel 2:32

“I am sought of them that asked not for Me; I am found of them that sought Me not. I said, ‘Behold Me, behold Me,’ unto a nation that was not called by My name. Isaiah 65:1

When we call our God, the LORD, we err, because his name is not the LORD, which is a title. His name is YEHOVAH! May We all ask for his forgiveness, and may Our merciful God forgive us all.

Jeremiah 34

In this chapter, because of their breach of covenant to let servants go free, it is another cause of the taking and burning of Jerusalem; of the captivity of Zedekiah king of Judah; and of the destruction of the whole land.

1 The word which came unto Jeremiah from the Lord when Nebuchadnezzar king of Babylon and all his army, and all the kingdoms of the earth of his dominion, and all the people, fought against Jerusalem and against all the cities thereof, saying,

“Thus saith the Lord, the God of Israel: Go and speak to Zedekiah king of Judah and tell him, ‘Thus saith the Lord: Behold, I will give this city into the hand of the king of Babylon, and he shall burn it with fire.

And thou shalt not escape out of his hand, but shalt surely be taken and delivered into his hand; and thine eyes shall behold the eyes of the king of Babylon, and he shall speak with thee mouth to mouth, and thou shalt go to Babylon.

Yet hear the word of the Lord, O Zedekiah king of Judah. Thus saith the Lord of thee: Thou shalt not die by the sword, — yet hear the word of the Lord, O Zedekiah king of Judah… which, though a king, he ought to hearken to the Lord;

— thus saith the Lord of thee, thou shalt not die by the sword: of Zedekiah king of Judah of a violent death; and therefore fear not to deliver thyself and city into the hands of the king of Babylon; for Zedekiah fears he would put him to death immediately.

but thou shalt die in peace; and with the burnings of thy fathers, the former kings who were before thee, so shall they burn incense for thee; and they will lament thee, saying, “Ah, lord!” For I have pronounced the word, saith the Lord.’”

Then Jeremiah the prophet spoke all these words unto Zedekiah king of Judah in Jerusalem,

when the king of Babylon’s army fought against Jerusalem and against all the cities of Judah that were left, against Lachish and against Azekah; for these fortified cities remained of the cities of Judah. — and against all the cities of Judah that were left; unconquered by him; when he invaded the land, he fought against, and took, and ravished all the cities that lay in his way; and it seems there were none that stood out against him but Jerusalem, now besieged by him, and two others, mentioned below;

— against Lachish, and against Azekah; for these defenced cities remained of the cities of Judah; two cities that had been fortified by Rehoboam, II Chronicles 11:9; and were still standing besides Jerusalem, which as yet had not fallen into the army of Babylon.

This is the word that came unto Jeremiah from the Lord, after King Zedekiah had made a covenant with all the people who were at Jerusalem to proclaim liberty unto them: — this is the word that came unto Jeremiah from the Lord, which he recorded as faithfully as he had received it, after that the King Zedekiah had made a covenant with all the people which were at Jerusalem, entering into a solemn agreement with them, to proclaim liberty unto them, according to the Lord’s ordinance which permitted the Hebrews to keep the members of their own nation as bond-servants for only six years, since in the seventh year they must all be given their liberty, Exodus 21:22;

that every man should let his manservant and every man his maidservant, being a Hebrew or a Hebrewess, go free, that none should be served by them, to wit: by a Jew, his brother. — cause or compel them to be bond-servants, to wit, of a Jew, an Hebrew or an Hebrewess, for the Law concerned these only, not the slaves of another nationality.

10 Now when all the princes and all the people, who had entered into the covenant, heard that every one should let his manservant and every one his maidservant go free, that none should be served by them any more, then they obeyed and let them go. — they hearkened, and let them go free. That is, they conformed to the obligations of the covenant, which they had entered into at the instigation of their princes.

11 But afterward they turned, and caused the servants and the handmaids whom they had let go free to return, and brought them into subjection for servants and for handmaids. — but afterwards they turned, having cold feet… from the law of God, and their own agreement, and returned to their former usage of their servants; they changed their minds and measures.

12 Therefore the word of the Lord came to Jeremiah from the Lord, saying,

13 “Thus saith the Lord, the God of Israel: I made a covenant with your fathers in the day that I brought them forth out of the land of Egypt, out of the house of bondage, saying,

14 ‘At the end of seven years let go every man his brother, a Hebrew who hath been sold unto thee; and when he hath served thee six years, thou shalt let him go free from thee.’ But your fathers hearkened not unto Me, neither inclined their ear. — this is another sin of Israel, the year of release, a release of a slave, and release of debt; the release of the land, a year of rest;

— but your fathers hearkened not unto me, neither inclined their ear; to obey the laws of God, and particularly this concerning servants. This is not to be understood of the fathers with whom the covenant was first made, and to whom this law was first given; but their posterity in later times, who yet lived long before the present generation, and so might with great propriety be called their fathers; and by which it appears that this law had been long neglected.

15 And ye had now turned, and had done right in My sight in proclaiming liberty every man to his neighbor; and ye had made a covenant before Me in the house which is called by My name.

16 But ye turned and polluted My name, and caused every man his servant and every man his handmaid, whom he had set at liberty at their pleasure, to return, and brought them into subjection to be unto you for servants and for handmaids.

17 “Therefore thus saith the Lord: Ye have not hearkened unto Me, in proclaiming liberty, every one to his brother and every man to his neighbor. Behold, I proclaim a ‘liberty’ for you, saith the Lord, to the sword, to the pestilence, and to the famine; and I will make you to be removed into all the kingdoms of the earth.

18 And I will give the men who have transgressed My covenant, who have not performed the words of the covenant which they had made before Me when they cut the calf in twain and passed between the parts thereof—

19 the princes of Judah and the princes of Jerusalem, the eunuchs, and the priests, and all the people of the land who passed between the parts of the calf—

20 I will even give them into the hand of their enemies and into the hand of them that seek their life; and their dead bodies shall be for meat unto the fowls of the heaven and to the beasts of the earth.

21 And Zedekiah king of Judah and his princes will I give into the hand of their enemies, and into the hand of them that seek their life, and into the hand of the king of Babylon’s army which has gone up from you.

22 Behold, I will command, saith the Lord, and cause them to return to this city; and they shall fight against it, and take it, and burn it with fire. And I will make the cities of Judah a desolation without an inhabitant.” — and they shall fight against it, and take it, and burn it with fire; they fought against it by shooting arrows from their bows, casting stones from their engines and by beating down the walls with their battering rams; with which making breaches, they entered in and took the city; burnt the temple, palaces and other houses with fire; of all which see the accomplishment in Jeremiah 52:4;

— and I will make the cities of Judah a desolation without an inhabitant: many of them were already; the king of Babylon having taken, ravaged and plundered them before he came to Jerusalem; and whither the inhabitants of them, that escaped the sword, fled for security; and others of them, that were not, now should be made desolate upon the taking of Jerusalem,

— as Lachish and Azekah, Jeremiah 34:7; which should fall into the hands of the enemy, and the inhabitants thereof be forced to flee into other countries, or would be carried away as captives; so that they would be but few, if any, to dwell in these two cities.

Jeremiah (Ch 31-32)

•November 16, 2021 • Leave a Comment

Chapter 31 is connected with the former chapters, respects the same times, and is full of prophecies and conversion of the nations; of the covenant of peace. It begins with the principal promise of the covenant, confirmed by past experience, of divine goodness, and with a fresh declaration of God’s everlasting commitment to Israel.

Jeremiah 31

1 “At the same time,” saith the Lord, “will I be the God of all the families of Israel, and they shall be My people.” — I be the God of all the families of Israel; not of some few persons only, or of one of a city, and two of a family, but of every family; and this will be when “all Israel” will be under God’s sovereign; which mean this will be prophetic, yet in the future as the house of Israel has never return, even now as this is written.

Thus saith the Lord: “The people who were left from the sword found grace in the wilderness, even Israel, when I went to cause him to rest.” — thus saith the Lord, the people which were left of the sword… which were not consumed by the sword of Nebuchadnezzar of Babylon, and who survived through his cruel edicts, and by his sword, famine and pestilence.

The Lord hath appeared of old unto me, saying, “Yea, I have loved thee with an everlasting love; therefore with lovingkindness have I drawn thee.

A Timbrels or a Tambourine for dance

Again I will build thee, and thou shalt be built, O virgin of Israel; thou shalt again be adorned with thy timbrels, and shalt go forth in the dances of them that make merry. — the Israelites have the title of “virgin of Israel” bestowed upon them to imply that, in consequence of their repentance after captivity, “they should be washed from the stains of their idolatries,” and they did; but other problems developed over the years: hypocrisies, over zealous of the laws, Sabbath-keepings while forgetting justice, mercy and faith;

Thou shalt yet plant vines upon the mountains of Samaria; the planters shall plant, and shall eat them as common things. — “the mountains of Samaria” is situated in today’s West Bank, which is populated by Palestinians and under Palestinian control; the ten tribes, especially of Ephraim, haven’t regain their land yet; perhaps B’ney Yosef (Children of Joseph) the North America branch will spearhead their recovery and set up the continent of North America for a global Hebraic awakening?

For there shall be a day that the watchmen upon Mount Ephraim shall cry, ‘Arise ye, and let us go up to Zion unto the Lord our God.’” — is B’ney Yosef their watchman? Let’s wait and see; but since God has foretold that a watchman will arise, so there will be one, whether is it B’ney Yosef or not we don’t know yet; or would there be another organisation? Perhaps there are a few watchmen, it’s in the plural – watchmen.

For thus saith the Lord: “Sing with gladness for Jacob, and shout among the chief of the nations; proclaim ye, praise ye, and say, ‘O Lord, save Thy people, the remnant of Israel.’ — “the chief of the nations” is obviously the United States of America; that’s the topdog! — hence whoever the watchmen is upon Mount Ephraim, he will cry aloud, “Arise ye, and let us go up to Zion”

— again, I couldn’t resist bringing forth a parallel passage from Ezekiel 6 with comments below:

2 “Son of man, set thy face toward the mountains of Israel, and prophesy against them — Son of man, set thy face towards the mountains of Israel… or cities of Israel, the future inhabitants of them; not the ancient ten tribes, for they had been carried captive long before this time, even in the times of Hezekiah; but far more likely, into the far future unless it can be thought that this prophecy is designed to show the reason of their captivity, which isn’t.

3 and say: ‘Ye mountains of Israel, hear the word of the Lord God. Thus saith the Lord God to the mountains and to the hills, to the rivers and to the valleys: Behold I, even I, will bring a sword upon you, and I will destroy your high places. — this message to the “mountains of Israel;” these mountains refer to the United States, UK and France… “and to the hills, to the rivers and to the valleys;” the hills: Ireland, Switzerland and the Scandinavian countries: Denmark, Norway, and Sweden, Finland, and Iceland; and the valleys, the low countries: Belgium, the Netherlands, and Luxembourg;

— and to the rivers; where during the nineteenth century, the British Royal Navy were known to “Rule the Waves” and the United States having been plowing up and down the five oceans with her Seven Fleets since the British left the scene.

Behold, I will bring them from the north country, and gather them from the coasts of the earth, and with them the blind and the lame, the woman with child, and her that travaileth with child together; a great company shall return thither.

They shall come with weeping, and with supplications will I lead them; I will cause them to walk by the rivers of waters in a straight way, wherein they shall not stumble; for I am a Father to Israel, and Ephraim is My firstborn. — for am a father to Israel, and Ephraim is my firstborn; and so very dear to him, as in Jeremiah 31:20. So the Targum says “and Ephraim is beloved before me;”

— all the blessings which God bestows upon men, whether Israelites or not, all flow from being as Abraham’s children; he first takes them into the relation of all his children, is a father to them in covenant; and then bestows children’s blessings on them. The allusion, perhaps, is to Joseph’s having the birthright, and whose younger son, Ephraim, was preferred to Manasseh the elder, 1 Chronicles 5:2. Ephraim becomes the head of Israel, the ten tribes, but excludes the house of Judah, who has the scepter.

10 “Hear the word of the Lord, O ye nations, and declare it in the isles afar off, and say, ‘He that scattered Israel will gather him, and keep him as a shepherd doth his flock.’

11 For the Lord hath redeemed Jacob, and ransomed him from the hand of him that was stronger than he.

12 Therefore they shall come and sing in the height of Zion, and shall flow together to the goodness of the Lord—for wheat and for wine and for oil, and for the young of the flock and of the herd; and their soul shall be as a watered garden, and they shall not sorrow any more at all.

13 Then shall the virgin rejoice in the dance, both young men and old together; for I will turn their mourning into joy, and will comfort them and make them rejoice from their sorrow. — for a country like the United States now, with so much filths, to be a virgin, it has to undergo much purifications, which in God’s eye has to undergo a prolonged captivity; Judah’s experience under Nebuchadnezzar of Babylon was just a preamble; just 70 years; currently a great captivity for Ephraim is in the making! Perhaps a super hyperinflation would be a start?

14 And I will satiate the soul of the priests with fatness, and My people shall be satisfied with My goodness,” saith the Lord.

15 Thus saith the Lord: “A voice was heard in Ramah, lamentation and bitter weeping; Rachel, weeping for her children, refused to be comforted for her children, because they were no more.” — Ramah was a city of Benjamin, near which Rachel, the mother of Joseph and Benjamin, was buried;

— Rachel weeping for her children; not really and in person, but by a figurative way of Ephraim and Manasseh. Rachel being the mother of Joseph and Benjamin; Joseph being the father of Ephraim and Manasseh.

16 Thus saith the Lord; “Restrain thy voice from weeping, and thine eyes from tears; for thy work shall be rewarded,” saith the Lord; “and they shall come back from the land of the enemy. — thus saith the Lord, refrain thy voice from weeping, and thine eyes from tears… though sorrow on such an occasion may be lawfully indulged, yet it ought to be moderated; and attention should be given to those things which may serve to relieve under it, and especially when they come from the Lord himself; then a stop is to be put to the mournful voice, and wet eyes are to be dried up.

17 And there is hope in thine end,” saith the Lord, “that thy children shall come back to their own border.

18 “I have surely heard Ephraim bemoaning himself thus: ‘Thou hast chastised me and I was chastised, as a bullock unaccustomed to the yoke; turn Thou me, and I shall be turned, for Thou art the Lord my God. — thou hast chastised me and I was chastised; one possibility is that Ephraim has to undergo a cleaning of 190 years, and Judah 40; why the difference? Perhaps Judah had undergo numerous pogroms and cleanings whereas Ephraim has none since the day when went captivity and into apparent oblivion;

— Ephraim chastised . . . as a bullock; see, Ephraim is being symbolized by the bullock or ox again:

More on the Ox and the Unicorn:

His glory is like the firstling of his ox (bullock), and his horns are like the horns of unicorns. With them he shall push the people together to the ends of the earth; and they are the ten thousands of Ephraim, and they are the thousands of Manasseh,” Deuteronomy 33:17.

In the above verse, the Ox and Ephraim are named first, the firstborn of his (Joseph’s) “bullock is his glory” the reference being to Ephraim; followed by Unicorn and Manasseh, which is embedded in the British Coat of Arms.

The Unicorn Embedded in the British Coat of Arms

Although Manasseh was the firstborn, Joseph the father crossed his hands and placed Ephraim as firstborn, hence Ephraim, often known as the thirteenth tribe, represents not just the house of Joseph, but more often the house of the 10-tribes Northern Kingdom.

— Ephraim bemoaning himself; but today Ephraim, with 7 fleets and the largest army/navy in the world, is proud and arrogant; boastful, drunk and amusing herself with her harlets; but that will change!

19 Surely after I was turned, I repented; and after I was instructed, I smote upon my thigh. I was ashamed, yea, even confounded, because I bore the reproach of my youth.’ — surely after that I was turned I repented… Ephraim’s prayer was answered; as he prayed he might be turned, he was; and when he was turned, then he repented, not only of sin in general, but of such sins as he had been particularly guilty of; not only of the grosser actions of life, but of inward sins: lusts, lies and corruptions.

20 Is Ephraim My dear son? Is he a pleasant child? For since I spoke against him, I do earnestly remember him still; therefore My heart is troubled for him; I will surely have mercy upon him,” saith the Lord. — I will surely have mercy on him, saith the Lord; or show mercy to him; as the Lord does to his children, by receiving them graciously upon their return; by manifesting and applying pardoning grace; by bestowing fresh favours on them; and by bringing them safe to eternal glory and happiness.

21 “Set thee up waymarks, make thee high heaps; set thine heart toward the highway, even the way which thou wentest; turn back, O virgin of Israel, turn back to these thy cities. — set thee up way marks, make thee high heaps… of stones, raised up as pillars, or like pyramids; or upright, as palm trees; to be marks and signs, to know the way again upon a return. The Targum says, “O congregation of Israel, remember the right works of thy fathers; pour out supplications; in bitterness set thy heart.”

— turn again, O virgin of Israel, turn again to these thy cities; an invitation and encouragement to Ephraim to turn again to their own land; from a “Babylonish captivity” to come, so from all lands in the latter day; after 190 years of purification, which is yet to be fulfilled, and to which the prophecy more properly belongs.

22 How long wilt thou go about, O thou backsliding daughter? For the Lord hath created a new thing in the earth: a woman shall compass a man.”

23 Thus saith the Lord of hosts, the God of Israel: “As yet they shall use this speech in the land of Judah and in the cities thereof, when I shall bring them back from captivity: ‘The Lord bless thee, O habitation of justice and mountain of holiness.’ — as yet they shall use this speech in the land of Israel, and in the cities thereof, when I shall bring again back from their captivity; not the Babylonish captivity, but a futuristic one; though there was repentance among them, by means of a type of Ezra and Nehemiah, and others; when, by way of salutation and prayer, the following words “The Lord bless thee,” will be said by all that know them, and wish well to them.

24 And there shall dwell in Judah itself, and in all the cities thereof together, husbandmen, and they that go forth with flocks.

25 For I have satiated the weary soul, and I have replenished every sorrowful soul.”

26 Upon this I awaked and beheld, and my sleep was sweet unto me.

27 “Behold, the days come,” saith the Lord, “that I will sow the house of Israel and the house of Judah with the seed of man and with the seed of beast. — that I will sow the house of Israel and the house of Judah, with the seed of man, and with the seed of beast; that is, will multiply both man and beast, so that there shall be a great increase; whereas, through war, famine, pestilence and captivity, their numbers were greatly reduced.

28 And it shall come to pass, that as I have watched over them to pluck up and to break down, and to throw down and to destroy and to afflict, so will I watch over them to build and to plant,” saith the Lord. — to build and to plant, saith the Lord; to build their city and temple, and to plant them in their own land; the temple which God will be building, whose foundation he lays, the superstructure of which he rears up, and will complete it in his own time;

— the allusion is to the sowing of a field with seed, which in due time springs up, and produces a large increase. Some understand this of the spiritual blessing of regeneration; but of incorruptible seed by the word of God: though afterwards an account is given of the new covenant.

29 “In those days they shall say no more: “‘The fathers have eaten a sour grape, and the children’s teeth are set on edge.’ — that is, the fathers have sinned, and the children are punished for their sins. So the Targum says, “the fathers have sinned, and the children are smitten.”

30 But every one shall die for his own iniquity: every man that eateth the sour grape, his teeth shall be set on edge.

31 “Behold, the days come,” saith the Lord, “that I will make a new covenant with the house of Israel and with the house of Judah — “Behold, the days will come,” again, this is prophetic, especially with the house of Israel and with the house of Judah; yet in the future.

32 not according to the covenant that I made with their fathers in the day that I took them by the hand to bring them out of the land of Egypt, My covenant which they broke, although I was a husband unto them,” saith the Lord. — not according to the covenant that I made with their fathers… meaning not Abraham, Isaac, and Jacob; or their ancestors that came out of Egypt, as appears by what follows; which was the covenant made at Sinai.

33 “But this shall be the covenant that I will make with the house of Israel: After those days,” saith the Lord, “I will put My law in their inward parts, and write it in their hearts, and will be their God, and they shall be My people. — I will put my law in their inward parts, and write it in their hearts; it will have the force of law or laws, which is a reigning, governing principle; and which is implanted in the genre by the spirit and power of God; the tables on which this law or laws are written are not tables of stone, but the fleshly tables of the heart; the heart is the proper seat.

34 And they shall teach no more every man his neighbor and every man his brother, saying, ‘Know the Lord.’ For they shall all know Me, from the least of them unto the greatest of them,” saith the Lord, “for I will forgive their iniquity, and I will remember their sin no more.”

35 Thus saith the Lord, who giveth the sun for a light by day, and the ordinances of the moon and of the stars for a light by night, who divideth the sea when the waves thereof roar; the Lord of hosts is His name:

36 “If those ordinances depart from before Me,” saith the Lord, “then the seed of Israel also shall cease from being a nation before Me for ever.”

37 Thus saith the Lord: “If heaven above can be measured, and the foundations of the earth searched out beneath, I will also cast off all the seed of Israel for all that they have done,” saith the Lord.

38 “Behold, the days come,” saith the Lord, “that the city shall be built to the Lord from the Tower of Hananeel unto the Gate of the Corner. — behold, the days are coming, saith the Lord… this prophecy refers to future times in the latter redemption, and were never fulfilled during the second temple period;

— that the city shall be built to the Lord; the city of Jerusalem; which was to be rebuilt upon the return of all Israelites from their captivity, as by the order, and under the direction and protection of the Lord, so for his service and worship; the temple, known as the Ezekiel temple, and divine worship restored; and both that and the city, built up a dwelling for God, where he is worshipped, feared and glorified.

39 And the measuring line shall yet go forth opposite it upon the hill Gareb, and shall compass about to Goath.

40 And the whole valley of the dead bodies and of the ashes, and all the fields unto the Brook of Kidron unto the corner of the Horse Gate toward the east shall be holy unto the Lord. It shall not be plucked up nor thrown down any more for ever.”

Jeremiah 32

The list of kings of Judah towards the end; in successive reigns, as Josiah (reign 640–609), Jehoahaz (reign 609), Jehoiakim (reign 609–598), Jehoiachin or Jechonias (reign 598–597), and Zedekiah (reign 597–586)

1 The word that came to Jeremiah from the Lord in the tenth year of Zedekiah king of Judah, which was the eighteenth year of Nebuchadnezzar. — in the tenth year of Zedekiah king of Judah, which was the eighteenth year of Nebuchadnezzar; that would be 597 BC, the same with Nebuchadnezzar king of Babylon, a year before the taking of the city by him; for that was in the eleventh of Zedekiah, and the nineteenth of Nebuchadnezzar; Jeremiah 52:1.

For then the king of Babylon’s army besieged Jerusalem; and Jeremiah the prophet was shut up in the court of the prison, which was in the king of Judah’s house. — and Jeremiah the prophet was shut up in the court of the prison, which was in the king’s palace, showing great stupidity and hardness of heart in the king, his courtiers and elders, to imprison a prophet of the Lord when surrounded by an enemy’s army and that according to the prediction of a true prophet; who warned them of the taking of their city, and carrying them off as captives, would be fulfilled.

For Zedekiah king of Judah had shut him up, saying, “Why dost thou prophesy and say, ‘Thus saith the Lord: Behold, I will give this city into the hand of the king of Babylon, and he shall take it;

and Zedekiah king of Judah shall not escape out of the hand of the Chaldeans, but shall surely be delivered into the hand of the king of Babylon, and shall speak with him mouth to mouth, and his eyes shall behold his eyes; — and Zedekiah king of Judah shall not escape out of the hand of the Chaldeans… this is a continuation of the prophecy of Jeremiah, repeated to the king, as he was more of himself; who, upon the taking of the throne, he would endeavour to scheme his escape as he did; but wasn’t successful, Jeremiah 52:8.

and he shall lead Zedekiah to Babylon, and there shall he be until visit I him, saith the Lord; though ye fight with the Chaldeans, ye shall not prosper’?” — and he shall lead Zedekiah to Babylon… as he did in chains, from Riblah, where he was brought unto him after he was taken, endeavouring to make his escape, Jeremiah 52:8.

And Jeremiah said, “The word of the Lord came unto me, saying:

Behold, Hanameel the son of Shallum thine uncle shall come unto thee, saying, ‘Buy thee my field that is in Anathoth; for the right of redemption is thine to buy it.’ — behold, Hanameel the son of Shallum thine uncle shall come unto thee… Hilkiah, the father of Jeremiah, and this Shallum, were own brothers; so that Jeremiah and Hanameel were brothers’ sons, or own cousins:

— saying, buy thee my field that is in Anathoth; the place from whence Jeremiah came, about two or three miles from Jerusalem, and therefore must be in the possession of the Chaldean army; wherefore it may seem very strange in Hanameel to propose it to sale, and stranger still in Jeremiah to buy it.

So Hanameel mine uncle’s son came to me in the court of the prison according to the word of the Lord, and said unto me, ‘Buy my field, I pray thee, that is in Anathoth, which is in the country of Benjamin; for the right of inheritance is thine, and the redemption is thine; buy it for thyself.’ Then I knew that this was the word of the Lord.

“And I bought the field from Hanameel my uncle’s son, that was in Anathoth, and weighed out to him the money, even seventeen shekels of silver.

10 And I subscribed the evidence and sealed it, and took witnesses, and weighed him the money in the balances.

11 So I took the evidence of the purchase, both that which was sealed according to the law and custom and that which was open;

12 and I gave the evidence of the purchase unto Baruch the son of Neriah, the son of Mahseiah, in the sight of Hanameel mine uncle’s son, and in the presence of the witnesses who signed the book of the purchase, before all the Jews who sat in the court of the prison.

13 And I charged Baruch before them, saying,

14 ‘Thus saith the Lord of hosts, the God of Israel: Take these deeds, this evidence of the purchase, both which is sealed and this evidence which is open, and put them in an earthen vessel, that they may continue many days.

15 For thus saith the Lord of hosts, the God of Israel: Houses and fields and vineyards shall be possessed again in this land.’

16 “Now when I had delivered the evidence of the purchase unto Baruch the son of Neriah, I prayed unto the Lord, saying:

17 Ah Lord God! Behold, Thou hast made the heaven and the earth by Thy great power and outstretched arm; and there is nothing too hard for Thee.

18 Thou showest lovingkindness unto thousands, and recompensest the iniquity of the fathers into the bosom of their children after them. The Great, the Mighty God, the Lord of hosts is His name,

19 great in counsel and mighty in work. For Thine eyes are open upon all the ways of the sons of men, to give every one according to his ways and according to the fruit of his doings;

20 who hast set signs and wonders in the land of Egypt even unto this day, and in Israel and among other men, and hast made Thee a name, as at this day;

21 and hast brought forth Thy people Israel out of the land of Egypt, with signs and with wonders, and with a strong hand and with an outstretched arm, and with great terror;

22 and hast given them this land which Thou didst swear to their fathers to give them, a land flowing with milk and honey.

23 And they came in and possessed it, but they obeyed not Thy voice, neither walked in Thy law: they have done nothing of all that Thou commanded them to do. Therefore Thou hast caused all this evil to come upon them.

24 Behold the siege ramps! They have come unto the city to take it; and the city is given into the hand of the Chaldeans, who fight against it, because of the sword and of the famine and of the pestilence. And what Thou hast spoken has come to pass, and behold, Thou seest it.

25 And Thou hast said unto me, O Lord God: ‘Buy thee the field for money, and take witnesses,’ for the city is given into the hand of the Chaldeans.”

26 Then came the word of the Lord unto Jeremiah, saying,

27 “Behold, I am the Lord, the God of all flesh. Is there any thing too hard for Me?

28 Therefore thus saith the Lord: Behold, I will give this city into the hand of the Chaldeans and into the hand of Nebuchadnezzar king of Babylon, and he shall take it.

29 And the Chaldeans who fight against this city shall come and set fire on this city, and burn it with the houses upon whose roofs they have offered incense unto Baal, and poured out drink offerings unto other gods to provoke Me to anger.

30 For the children of Israel and the children of Judah have done only evil before Me from their youth; for the children of Israel have only provoked Me to anger with the work of their hands, saith the Lord.

31 For this city hath been to Me as a provocation of Mine anger and of My fury from the day that they built it even unto this day, so that I should remove it from before My face

32 because of all the evil of the children of Israel and of the children of Judah, which they have done to provoke Me to anger — they, their kings, their princes, their priests, and their prophets, and the men of Judah, and the inhabitants of Jerusalem.

33 And they have turned unto Me the back and not the face. Though I taught them, rising up early and teaching them, yet they have not hearkened to receive instruction; — sometimes God is explicit in expressing why Israel sinned, like idolatories; but sometimes God just hint at what’s wrong with his people; here is another one: “they have turned unto Me the back and not the face” for which the more details are found in the writing of another prophet, Ezekiel (more at the end)

34 but they set their abominations in the house which is called by My name to defile it.

35 And they built the high places of Baal, which are in the Valley of the Son of Hinnom, to cause their sons and their daughters to pass through the fire unto Molech, which I commanded them not, neither came it into My mind that they should do this abomination, to cause Judah to sin.

36 “And now therefore thus saith the Lord, the God of Israel, concerning this city whereof ye say, ‘It shall be delivered into the hand of the king of Babylon by the sword and by the famine and by the pestilence’:

37 Behold, I will gather them out of all countries whither I have driven them in Mine anger and in My fury and in great wrath; and I will bring them again unto this place, and I will cause them to dwell safely.

38 And they shall be My people, and I will be their God;

39 and I will give them one heart and one way, that they may fear Me for ever, for the good of them and of their children after them.

40 And I will make an everlasting covenant with them, that I will not turn away from them, to do them good; but I will put My fear in their hearts, that they shall not depart from Me.

41 Yea, I will rejoice over them to do them good, and I will plant them in this land assuredly with My whole heart and with My whole soul.

42 “For thus saith the Lord: As I have brought all this great evil upon this people, so will I bring upon them all the good that I have promised them.

43 And fields shall be bought in this land whereof ye say, ‘It is desolate without man or beast. It is given into the hand of the Chaldeans.’

44 Men shall buy fields for money, and sign evidences and seal them, and take witnesses in the land of Benjamin and in the places about Jerusalem, and in the cities of Judah and in the cities of the mountains, and in the cities of the valley and in the cities of the South; for I will cause their captives to return, saith the Lord.”

~~~

More about their back against God, in Ezekiel 8

15 Then said He unto me, “Hast thou seen this, O son of man? Turn thee yet again, and thou shalt see greater abominations than these.”

16 And He brought me into the inner court of the Lord’S house, and behold, at the door of the temple of the Lord, between the porch and the altar, were about five and twenty men with their backs toward the temple of the Lord and their faces toward the east; and they worshiped the sun toward the east. — the heads of the twenty-four courses of the priesthood, led by the high priest, making up the “twenty five men” were not only worshipping the sun: they were doing so in the very temple of God, with their backs turned upon the presence of God!

— the worship of heavenly bodies was against God’s will which Moses had warned the people (Deuteronomy 4:19, 17:3, whose penalty is to be stoned to death, Deuteronomy 17:5 ’till they die). These 25 men corrupted themselves by worshipping the sun; and so the Targum renders it, “and, lo, they corrupted themselves, worshipping facing the east the sun; their backs toward the temple of the Lord” — turned their backs to the most holy place; which is an aggravation of their impiety; casting the utmost contempt for God:

Moses’ warnings in Deuteronomy 17

3 And [if you] hath gone and served other gods and worshiped them, either the sun or moon or any of the host of heaven, which I have not commanded, 4 and it be told thee, and thou hast heard of it and inquired diligently, and behold, it be true and the thing certain that such abomination is wrought in Israel, 5 then shalt thou bring forth that man or that woman who has committed that wicked thing unto thy gates, even that man or that woman, and shalt stone them with stones till they die. Deuteronomy 17:3-5

— today, more than 98.5 percent of Christians are honoring the SUN by observing SUNday worship. They have “their backs toward the temple of the Lord and their faces toward the east; and they worshiped the SUN toward the east; whose penalty is to be stoned to death – ’till they die.

— also, following the SUN-worshipping Samaritans, most Church of God Communities are showing their contempt for God by having their “wavesheaf offering” and Pentecost on a SUNday; always on a SUNday. And these are supposedly in God’s Sanctuary, but God says He is a jealous God, so these pretentious Christians could be spewed out of His mouth! A death penalty – ’till they die!

Jeremiah (Ch 29-30)

•November 15, 2021 • Leave a Comment

Chapter 29 involves Jeremiah’s Letter to the Exiles and its Consequences.

The Contents of the Letter.

Just as certain false prophets had tried to arouse and maintain false hopes among the inhabitants in Jerusalem, there also certain men who were active among the exiles who had been taken to Babylon. The result was that a spirit of discontent and restlessness took hold of the Jews, which not only increased the bitterness of their affliction, but also tended to break down all moral restraint. Jeremiah therefore, by God’s command, sent a letter to the exiles, in which he gives them some excellent rules of behavior in the midst of the trying circumstances in which they found themselves.

Jeremiah 29

1 Now these are the words of the letter that Jeremiah the prophet sent from Jerusalem unto the residue of the elders who were carried away captives, and to the priests, and to the prophets, and to all the people whom Nebuchadnezzar had carried away captive from Jerusalem to Babylon — now, these are the words of the letter that Jeremiah the prophet sent from Jerusalem unto the elders of the exile, to those who had survived the hardships up to that time;

— and the captives, the priests and prophets, and to all the people whom Nebuchadnezzar had carried away from Jerusalem to Babylon, to the congregation of the exiles, disorganized as it was in the conditions of their living situation;

— and the prophets: including one true prophet that was carried captive, and that was Ezekiel; but of false prophets were many.

(after Jeconiah the king, and the queen, and the eunuchs, the princes of Judah and Jerusalem, and the carpenters, and the smiths had departed from Jerusalem), — after that Jeconiah (Jehoiachin or Jechonias (reign 598–597)), the king, and the queen, Nehushta, the dowager, daughter of Einathan, and the eunuchs, the courtiers or chamberlains, high court officers, the princes of Judah and Jerusalem, and the carpenters, and the smiths, all the artisans and craftsmen of the city, II Kings 24:16, were departed from Jerusalem.

by the hand of Elasah the son of Shaphan and Gemariah the son of Hilkiah, whom Zedekiah king of Judah sent unto Babylon to Nebuchadnezzar king of Babylon, saying:

“Thus saith the Lord of hosts, the God of Israel, unto all who are carried away captives, whom I have caused to be carried away from Jerusalem unto Babylon:

Build ye houses and dwell in them, and plant gardens and eat the fruit of them. the exile would be 70 years, not just 2 years! The endtime iniquite, which could be a form of an exile, of whom Ezekiel was one for “bearing their iniquity” for the house of Israel could be 190 years, and not just 3 and a half years; see Ezekiel 4.

Take ye wives and beget sons and daughters, and take wives for your sons and give your daughters to husbands, that they may bear sons and daughters, that ye may be increased there, and not diminished. — take ye wives, and beget sons and daughters… that is, such as had no wives, who were either bachelors or widowers; not that they were to take wives of the Chaldeans, but of those of their own nation; for intermarriages with heathens were forbidden them; and this they were to do, in order to propagate their posterity, and keep up a succession.

And seek the peace of the city whither I have caused you to be carried away captives, and pray unto the Lord for it; for in the peace thereof shall ye have peace. — and seek the peace of the city… the prosperity and happiness of Babylon, or any other city in Chaldea, where they were placed: this they were to do by prayer and supplication to God, and by all other means that might be any ways conducive to the good of the state where they were.

For thus saith the Lord of hosts, the God of Israel: Let not your prophets and your diviners who are in the midst of you deceive you, neither hearken to your dreams which ye cause to be dreamed. — let not your prophets and your diviners that be in the midst of you, deceive you; these are false prophets as the Targum says; and there were many such in the captivity; who pretended to foretell future events, and so impose upon others, who were too apt to believe them; these insinuated, that in a little time they should have their liberty, and return to their own land again, contrary to the prophecies that came from the Lord himself.

For they prophesy falsely unto you in My name: I have not sent them, saith the Lord.

10 “For thus saith the Lord: That after seventy years are accomplished at Babylon, I will visit you and perform My good word toward you, causing you to return to this place. — for thus saith the Lord, that after seventy years be accomplished at Babylon… these seventy years are not to be reckoned from the last captivity under Zedekiah; nor from the precise present time; nor from the first of Jeconiah’s captivity; but the fourth year of Jehoiakim, and the first of Nebuchadnezzar, when he first came up against Jerusalem; Jeremiah 25:1.

11 For I know the thoughts that I think toward you, saith the Lord, thoughts of peace and not of evil, to give you an expected end.

12 Then shall ye call upon Me, and ye shall go and pray unto Me and I will hearken unto you. — then shall ye call upon me… when the expected end is about to be given; when God intends to bestow mercy, he gives his people a spirit of prayer to ask for it; and even the promise of it is a considerable argument to encourage and engage more to pray for it:

— and ye shall go and pray unto me: walk in my ways; or rather ye shall go into your private closets, or into those public buildings or places where prayers are made, and there put up your petitions; that they should continue praying without ceasing, until they enjoyed the blessing, and had the expected end given:

— and I will hearken unto you: God is a God hearing Being; he listens to the requests of his people, but answers them in his own time and way; which is no small encouragement to pray unto him.

13 And ye shall seek Me and find Me when ye shall search for Me with all your heart.

14 And I will be found by you, saith the Lord, and I will return you from captivity, and I will gather you from all the nations and from all the places whither I have driven you, saith the Lord; and I will bring you back into the place from whence I caused you to be carried away captive. — since the return from captivity is not just from Babylon but “from all the nations” this hints at a prophetic message, and this message is for the endtimes.

One parallel passage from Ezekiel 6:

“Son of man, set thy face toward the mountains of Israel, and prophesy against them — Son of man, set thy face towards the mountains of Israel… or cities of Israel, the future inhabitants of them; not the ancient ten tribes, for they had been carried captive long before this time, even in the times of Hezekiah; but far more likely, into the far future unless it can be thought that this prophecy is designed to show the reason of their captivity, which isn’t. 

and say: ‘Ye mountains of Israel, hear the word of the Lord God. Thus saith the Lord God to the mountains and to the hills, to the rivers and to the valleys: Behold I, even I, will bring a sword upon you, and I will destroy your high places. — this message to the “mountains of Israel;” these mountains refer to the United States, UK and France… “and to the hills, to the rivers and to the valleys;” the hills: Ireland, Switzerland and the Scandinavian countries: Denmark, Norway, and Sweden, Finland, and Iceland; and the valleys, the low countries: Belgium, the Netherlands, and Luxembourg;

— and to the rivers; where during the nineteenth century, the British Royal Navy were known to “Rule the Waves;” and the United States having been plowing up and down the five oceans with her Seven Fleets since the British left the scene.

15 “Because ye have said, ‘The Lord hath raised us up prophets in Babylon’ — the Lord hath raised us up prophets in Babylon; this is meant to be false prophets who foretold nothing but peace and prosperity; there is no need of other prophets if they have listened to those in Judea and in Jerusalem; but these are false prophets; yet, being such that prophesied to them things that could be agreeable, and as such, considered as prophets sent by God, when often they are not.

16 know that thus saith the Lord of the king that sitteth upon the throne of David, and of all the people that dwelleth in this city, and of your brethren who have not gone forth with you into captivity— these are those that refused to go into Babylon, saith the Lord, and be well with them; but those who refused to go are actually disobeying God.

17 thus saith the Lord of hosts: Behold, I will send upon them the sword, the famine, and the pestilence, and will make them like vile figs that cannot be eaten, they are so evil. — when they are actually disobeying God, they could expect to face the consequences; and that is “the sword, the famine, and the pestilence.”

18 And I will persecute them with the sword, with the famine, and with the pestilence, and will deliver them to be removed to all the kingdoms of the earth, to be a curse and an astonishment and a hissing, and a reproach among all the nations whither I have driven them, — and I will persecute them with the sword, with the famine, and with the pestilence… Or, “follow after them” such as should make their escape out of the city, and go into Egypt, or other countries, for shelter and safety, should be pursued by the vengeance of God, and should fall by sword, famine, or pestilence, in other places.

19 because they have not hearkened to My words, saith the Lord, which I sent unto them by My servants the prophets, rising up early and sending them; but ye would not hear, saith the Lord. — because they have not hearkened to my words, saith the Lord… which were spoken to them by the prophets; not hearkening to them, but despising them, a contempt of God, and his word, was the cause of their ruin.

20 “Hear ye therefore the word of the Lord, all ye of the captivity, whom I have sent from Jerusalem to Babylon. — all ye of the captivity, whom I have sent from Jerusalem to Babylon; some parts of this letter are directed to one sort of the captives, and others to another sort of them; some being good men, some bad; but what follows all are called upon to observe, good and bad; it being a prediction of a certain event, which they would see fulfilled in a short time; and therefore might be of service of them; to the godly, for the confirmation of them in the belief of what the Lord had promised; and to the rest, to make them stop giving heed to false prophets, that should here after arise.

21 Thus saith the Lord of hosts, the God of Israel, concerning Ahab the son of Kolaiah, and of Zedekiah the son of Maaseiah, who prophesy a lie unto you in My name: Behold, I will deliver them into the hand of Nebuchadnezzar king of Babylon; and he shall slay them before your eyes. — of Ahab the son of Kolaiah, and of Zedekiah the son of Maaseiah, which prophesy a lie unto you: two false prophets, of whom we have no account any where else but here; and are, no doubt, the prophets, or however two of them, that they of the captivity boasted of that God had raised unto them in Babylon.

22 And of them shall be taken up a curse by all the captivity of Judah who are in Babylon, saying, ‘The Lord make thee like Zedekiah and like Ahab, whom the king of Babylon roasted in the fire,’ — or “burnt them” not at once, but with a slow fire; burning persons with fire, and casting them into a fiery furnace, were ways used by the Chaldeans in putting persons to death, Daniel 3:6.

23 because they have committed villainy (wicked or criminal behaviour) in Israel, and have committed adultery with their neighbors’ wives, and have spoken lying words in My name which I have not commanded them. Indeed I know, and am a witness, saith the Lord.”

24 Thus shalt thou also speak to Shemaiah the Nehelamite, saying, — Or, “the dreamer” because he pretended to have dreams from the Lord; or because what he delivered as prophecies were mere dreams; as that the captives should quickly return to their own land; so the Targum, paraphrasing “who was of Halem;” he was another of the false prophets in Babylon.

25 “Thus speaketh the Lord of hosts, the God of Israel, saying: Because thou hast sent letters in thy name unto all the people who are at Jerusalem, and to Zephaniah the son of Maaseiah the priest, and to all the priests, saying,

26 ‘The Lord hath made thee priest in the stead of Jehoiada the priest, that ye should be officers in the house of the Lord for every man that is mad and maketh himself a prophet, that thou shouldest put him in prison, and in the stocks.

27 Now therefore, why hast thou not reproved Jeremiah of Anathoth, who maketh himself a prophet to you? — now therefore why hast thou not reproved Jeremiah of Anathoth… not by words only, but by actions; by beating and scourging, by pillory or imprisonment, and so restraining him from prophesying to the people.

28 For therefore he sent unto us in Babylon, saying: This captivity is long; build ye houses and dwell in them, and plant gardens and eat the fruit of them.’” — for therefore he sent unto us in Babylon, saying… that is, Jeremiah the prophet; and this was the reason, because they couldn’t restrain him from prophesying; so that Shemaiah lays all the blame on Zephaniah, and his brethren the priests; who, had they done their duty, would have prevented Jeremiah’s letter to the captives, as he suggests; the purport of which was.

29 And Zephaniah the priest read this letter in the ears of Jeremiah the prophet. — in the ears of Jeremiah the prophet: whether out of good will, to let him know who were his enemies abroad; or out of ill will, to stir up the people against him; or in pretence of proceeding equitably with him; not taking him up, and punishing him before he brought the accusation and charge against him.

30 Then came the word of the Lord unto Jeremiah, saying,

31 “Send to all those of the captivity, saying, ‘Thus saith the Lord concerning Shemaiah the Nehelamite: Because Shemaiah hath prophesied unto you, and I sent him not and he caused you to trust in a lie,

32 therefore thus saith the Lord: Behold, I will punish Shemaiah the Nehelamite and his seed: he shall not have a man to dwell among this people, neither shall he behold the good that I will do for My people, saith the Lord, because he hath taught rebellion against the Lord.’” — behold, I will punish Shemaiah the Nehelamite, and his seed; not him only, but his posterity also: thus God sometimes visits the sins of parents on their children, they being, as it were, a part of themselves, and oftentimes partners with them in their iniquities:

— he shall not have a man to dwell among this people; either at Babylon, or at Jerusalem, whither he had promised a speedy return:

— neither shall he behold the good that I will do for my people, saith the Lord; by returning them, after seventy years captivity, to their own land, and to the enjoyment of all their privileges, civil and religious.

Jeremiah 30

The word that came to Jeremiah from the Lord, saying,

“Thus speaketh the Lord God of Israel, saying: ‘Write thee all the words that I have spoken unto thee in a book. — saying, write thee all the words that I have spoken unto thee in a book; being things of consequence, that they might remain to after ages; and be read to the use, comfort, and edification of the Lord’s people, in times to come.

For lo, the days come,’ saith the Lord, ‘that I will bring back from captivity My people Israel and Judah,’ saith the Lord; ‘and I will cause them to return to the land that I gave to their fathers, and they shall possess it.’” — and I will cause them to return to the land that I gave to their fathers, and they shall possess it; the land of Canaan, given to Abraham, Isaac and Jacob; and which shall be again by the Jews their posterity; for, without that the Jews upon their call and conversion shall return to their own land, in a literal sense, I see not how we can understand this, and many other prophecies.

And these are the words that the Lord spoke concerning Israel and concerning Judah: — and these are the words that the Lord spake concerning Israel, and concerning Judah. Which follow in this chapter and the next; first concerning Israel, the ten tribes; and then concerning the two tribes of Judah and Benjamin, even concerning all Israel; whereas, if this prophecy only respects the return from the captivity in Babylon, there is very little in it which concerns the ten tribes, or but a very few of them. The words may be rendered, “unto Israel, and unto Judah”; as being the persons to whom they were directed, as well as were the subjects of them.

“For thus saith the Lord: ‘We have heard a voice of trembling, of fear and not of peace. — we have heard a voice of trembling, of fear, and not of peace; which is to be understood, of the fear and dread injected into them by the Babylonians when they besieged their city, and burned that, and their temple; nor of the fear and dread which came upon the Babylonians at the taking of their city by Cyrus, upon which followed the deliverance of the Jews.

Ask ye now, and see whether a man doth travail with child? Why do I see every man with his hands on his loins, as a woman in travail, and all faces are turned into paleness? — wherefore do I see every man with his hands his loins, as a woman in travail; the usual posture of women in such a condition, trying hereby to abate their pain, and ease themselves. This metaphor is made use of, both to express the sharpness and shortness of this distress; as the pains of a woman in travail are very sharp, yet short, and, when over, quickly forgotten; and so it wilt be at this time; it will be a sharp trial of the church and people of God; but it will last but for a short time; and the joy and happy times that will follow will soon cause it to be forgotten.

Alas! for that day is great, so that none is like it. It is even the time of Jacob’s trouble, but he shall be saved out of it. — the “time of Jacob’s trouble” could parallel Ezekiel 4 – 390/40 Years (or 190/150/40 years).

“‘For it shall come to pass in that day,’ saith the Lord of hosts, ‘that I will break his yoke from off thy neck, and will burst thy bonds, and strangers shall no more be served by him.

But they shall serve the Lord their God, and David their king, whom I will raise up unto them. — and David their king; not literally, who shall be raised up from the dead, and reign over them, though he does not assert it; nor his successors called by his name.

10 “‘Therefore fear thou not, O My servant Jacob,’ saith the Lord; ‘neither be dismayed, O Israel; for lo, I will save thee from afar, and thy seed from the land of their captivity; and Jacob shall return, and shall be in rest and be quiet, and none shall make him afraid. — this is prophetic, into our times, their return are “from afar” whereas Babylon is nearby comparatively.

11 For I am with thee,’ saith the Lord, ‘to save thee; though I make a full end of all nations whither I have scattered thee, yet will I not make a full end of thee; but I will correct thee in measure, and will not leave thee altogether unpunished.’ — though I will make a full end of all nations whither I have scattered thee, yet will I not make a full end of thee; a full end has been made of the Assyrians, Chaldeans, and Egyptians; these people and their names are no more;

— the destruction of the national life of the heathen nations on whom judgment was to fall should be complete and irreversible, so that Moab, Ammon, Edom, should no more have a place in the history of the world;

— the Targum says, “in destroying I will not destroy thee.”

12 “For thus saith the Lord: ‘Thy bruise is incurable, and thy wound is grievous.

13 There is none to plead thy cause, that thou mayest be bound up; thou hast no healing medicines.

14 All thy lovers have forgotten thee; they seek thee not; for I have wounded thee with the wound of an enemy, with the chastisement of a cruel one for the multitude of thine iniquity, because thy sins were increased. — all thy lovers have forgotten thee… the Egyptians and Assyrians were historic, but Japan, Turkey, Germany and Spain could be futuristic, whom they sought unto for help, and entered into an alliance with, and who promised them great things; but forgot their promises and forsook them (more at the end)

15 Why criest thou for thine affliction? Thy sorrow is incurable for the multitude of thine iniquity; because thy sins were increased, I have done these things unto thee.

16 Therefore all they that devour thee shall be devoured, and all thine adversaries, every one of them, shall go into captivity; and they that despoil thee shall be a spoil, and all that prey upon thee will I give for a prey. — and all thine adversaries, everyone of them, as were the Assyrians, Egyptians, Chaldeans, Grecians, Romans and the Papacy, shall also go into destruction; Revelation 13:10.

17 For I will restore health unto thee, and I will heal thee of thy wounds,’ saith the Lord, ‘because they called thee an outcast, saying, “This is Zion, whom no man seeketh after.”’

18 “Thus saith the Lord: ‘Behold, I will bring back from captivity Jacob’s tents, and have mercy on his dwelling places; and the city shall be built upon her own heap, and the palace shall remain after the manner thereof. — and have mercy on his dwelling places; by restoring Israel, or Jacob’s posterity, to their dwelling places in Jerusalem, and other places rebuilt by them and for them;

— the Targum says, “I will have mercy on his cities.”

19 And out of them shall proceed thanksgiving and the voice of them that make merry; and I will multiply them, and they shall not be few; I will also glorify them, and they shall not be small.

20 Their children also shall be as in former time, and their congregation shall be established before Me, and I will punish all that oppress them.

21 And their nobles shall be of themselves, and their governor shall proceed from the midst of them; and I will cause him to draw near, and he shall approach unto Me; for who is this that engaged his heart to approach unto Me?’ saith the Lord.

22 ‘And ye shall be My people, and I will be your God.’”

23 Behold, the whirlwind of the Lord goeth forth with fury, a continuing whirlwind; it shall fall with pain upon the head of the wicked.

24 The fierce anger of the Lord shall not return, until He has done it, and until He has performed the intents of His heart; in the latter days ye shall consider it. — in the latter days ye shall consider it; and in the latter day you shall understand it; and see it wholly and fully accomplished. The eyes of His shepherd will finally be opened!

~~~

More about “all thy lovers have forgotten thee” Jeremiah 30:14 with a parallel verse in Ezekiel 16:37

behold, therefore I will gather all thy lovers with whom thou hast taken pleasure, and all them that thou hast loved, with all them that thou hast hated. I will even gather them round about against thee and will uncover thy nakedness unto them, that they may see all thy nakedness Ezekiel 16:37: — when the going gets tough, the tough gets going and American allies (Germany, Turkey, S Korea, the Philippines and Japan?) will take their own interests first, team up with other enemies of the United States (Iran, N Korea, Russia and China?) and will turn against the United States.

And this is not these countries’ doings, but it is God’s will that will cause these allies to be against the United States, and it is again God’s will through His Spirits that will trap the United States in a snare “And I will spread My net upon him, and he shall be taken in My [not China’s nor Russia’s] snare,” Ezekiel 17:20; and he will be like a beast caught in a cage squealing away to no avail, then uncover her nakedness, American nakedness.

Jeremiah (Ch 27-28)

•November 14, 2021 • Leave a Comment

The list of kings of Judah towards the end; in successive reigns, as Josiah (reign 640–609), Jehoahaz (reign 609), Jehoiakim (reign 609–598), Jehoiachin or Jechonias (reign 598–597), and Zedekiah (reign 597–586).

The year in that Jeremiah began to prophesy, Jeremiah 1:2 in the thirteenth year of Josiah reign would be around 628 BC, and he preached for the last 19 years of Josiah’s life, until 609 BC when Josiah died. By the time the kings of Judah reigns ended with Zedekiah being exiled to Babylon and his reign ended in 586 BC, Jeremiah’s prophesying life work in and around Jerusalem would have lasted some 42 years.

Jeremiah 27

In the beginning of the reign of Jehoiakim the son of Josiah, king of Judah, came this word unto Jeremiah from the Lord, saying, — Jehoiakim reign from 609 to 598; so this is another relaying, with more details, of the same scenes we have gone through before.

Thus saith the Lord to me: “Make thee bonds and yokes and put them upon thy neck, — thus saith the Lord to me, make thee bonds and yokes… the yokes were made of wood, as appears from Jeremiah 28:13; and the bonds were strings or thongs, which bound the yoke together, that it might not slip off the neck, on which it was put:

and send them to the king of Edom, and to the king of Moab, and to the king of the Ammonites, and to the king of Tyre, and to the king of Sidon by the hand of the messengers who come to Jerusalem unto Zedekiah king of Judah. — all neighbouring kings and states: Edom, Moab, children of Ammon, Tyre and Sidon, to whom the wine cup of God’s wrath was to be sent, and they made to drink of it.

And command them to say unto their masters, ‘Thus saith the Lord of hosts, the God of Israel; thus shall ye say unto your masters:

I have made the earth, the man and the beast that are upon the ground by My great power and by My outstretched arm, and have given it unto whom it seemed meet unto Me.

And now have I given all these lands into the hand of Nebuchadnezzar the king of Babylon, My servant; and the beasts of the field have I given him also to serve him. — and now I have given all these lands: Edom, Moab, Ammon, Tyre, Sidon and Judea:

— into the hand of Nebuchadnezzar the king of Babylon, my servant; whom God used as an instrument in correcting and chastising the nations; and who obeyed his will, though he knew it not; nor did what he did in obedience to it; and yet had the honour of being called his servant, and of being rewarded with a very large empire;

— and the beasts of the field have I given him also to serve him; either to bring him, and his armies, and his carriages of provisions for them, for the invasion and taking the above countries; or the cattle found there, which belonged to these countries, and the inhabitants thereof, which would fall into his hands with them.

And all nations shall serve him and his son and his son’s son, until the very time of his land comes; and then many nations and great kings shall themselves be served by him. — and his son, and his son’s son; their Scripture names were Evilmerodach and Belshazzar, Jeremiah 52:31.

And it shall come to pass, that the nation and kingdom which will not serve the same Nebuchadnezzar the king of Babylon, and that will not put their neck under the yoke of the king of Babylon, that nation will I punish, saith the Lord, with the sword and with the famine and with the pestilence, until I have consumed them by his hand. — that nation will I punish, saith the Lord, with the sword, and with the famine, and with the pestilence; with one judgement after another; some will perish by the sword of the enemy, sallying out upon them, or endeavouring to make their escape; others by famine their provisions being spent through the length of the siege; and others by pestilence, or the plague, or by the hand of God:

— until I have consumed them by his hand; Nebuchadnezzar’s; by any means of him; by his sword, and strait besieging them; or, “into his hand”;

— and so the Targum says, “until I have delivered them into his hand;” having consumed multitudes by the sword, famine and pestilence, will deliver the rest into his hands to be carried away as captives.

Therefore hearken not ye to your prophets, nor to your diviners, nor to your dreamers, nor to your enchanters, nor to your sorcerers, who speak unto you, saying, “Ye shall not serve the king of Babylon.” — which speak unto you, saying, ye shall not serve the king of Babylon; meaning, either that they ought not to become tributary to him; or they should not be brought into subjection by him: and so were stirred up to oppose him, and not submit to him.

10 For they prophesy a lie unto you to remove you far from your land, and that I should drive you out and ye should perish. — to remove you far from your land; not that they designed it by their prophecies, but so it was eventually; for, standing it out against Nebuchadnezzar, encouraged by the lies and dreams of their prophets, he, in process of time, took them and carried them as captives into Babylon; whereas, had they surrendered at once, they might have continued in their own land, paying a tax or tribute to the king of Babylon;

— and that I should drive you out, and ye should perish; drive them out of their own land, and so perish in a foreign land: God is said to do that which his servant or instrument did, being provoked by the sin and disobedience of the people, hearkening to their lying prophets and not to him.

11 But the nations that bring their neck under the yoke of the king of Babylon and serve him, those will I let remain still in their own land, saith the Lord, and they shall till it and dwell therein.’” — but the nations that bring their neck under the yoke of the king of Babylon, and serve him… that at once, and readily, submit unto him and pay him tribute.

12 I spoke also to Zedekiah king of Judah according to all these words, saying, “Bring your necks under the yoke of the king of Babylon, and serve him and his people, and live. — bring your necks under the yoke of the king of Babylon; you, O king, your nobles, and your people. Zedekiah was set upon the throne by the king of Babylon, was a tributary to him, and had took an oath to be faithful to him;

— and yet was meditating against him; consulting and entering into a confederacy with neighbouring nations to throw off the yoke and be independent from him.

13 Why will ye die, thou and thy people, by the sword, by the famine, and by the pestilence, as the Lord hath spoken against the nation that will not serve the king of Babylon? — why will ye die, thou and thy people, the sword, by the famine, and by the pestilence… through a blockade of the Chaldean army, which would invade their land, and besiege their city, upon a refusal to be subject to their yoke.

14 Therefore hearken not unto the words of the prophets who speak unto you, saying, ‘Ye shall not serve the king of Babylon,’ for they prophesy a lie unto you. — therefore hearken not unto the words of the prophets… these are false prophets, as the Targum says; such bad kings always had them, to whom they listened, and which often brought forth bad and terrible consequences.

15 ‘For I have not sent them,’ saith the Lord, ‘yet they prophesy a lie in My name; that I might drive you out, and that ye might perish, ye and the prophets who prophesy unto you.’” — ye, and the prophets that prophesy unto you; for it would end in the ruin and destruction of them both; both by the false prophets, as the Targum here again calls them, and those that listened to their prophecies; both would fall into the same ditch.

16 Also I spoke to the priests and to all this people, saying, “Thus saith the Lord: Hearken not to the words of your prophets who prophesy unto you, saying, ‘Behold, the vessels of the Lord’S house shall now shortly be brought again from Babylon’; for they prophesy a lie unto you. — also I spoke to the priests, and to all this people, saying… from the court he went to the temple, and spoke to the priests that were ministering there, and place to meet with the people and the priests; which latter especially had a concern in what he had to say especially the vessels of the temple;

— behold, the vessels of the Lord’s house shall now shortly be brought again from Babylon; which were carried thither, both in the times of Jehoiakim, and of Jeconiah, II Chronicles 36:7; these vessels carried off would in a short time be returned; that the king of Babylon, either willingly and of his own accord, or being pressed or forced to it, would send them back; so little reason had they to fear an invasion from him or captivity by him.

18 But if they are prophets, and if the word of the Lord is with them, let them now make intercession to the Lord of hosts, that the vessels which are left in the house of the Lord and in the house of the king of Judah, and at Jerusalem go not to Babylon. — that the vessels which are left in the house of the Lord, and in the house of the king of Judah, and at Jerusalem, go not to Babylon; instead of prophesying about the return of what are gone, let them pray for the preservation and continuance of what are left, that they do not go also; of which there was great danger of following the same route of being taken away to Babylon,

— yea, certainty, in case of non-submission to, and rebellion against, the king of Babylon; there were some vessels of the sanctuary which yet remained, as well as others in the king’s palace, and in the houses of the noble and rich men in Jerusalem; for the keeping of which they would do well to show a proper concern; and nothing more effectual than prayer to God; and, next to that, submission to the Chaldean yoke.

19 For thus saith the Lord of hosts concerning the pillars, and concerning the sea, and concerning the bases, and concerning the residue of the vessels that remain in this city, — for thus saith the Lord of hosts concerning the pillars… the pillars of brass that stood in the temple; the one called Boaz, and the other Jachin, 1 Kings 7:15;

— and concerning the sea; the sea of molten brass, which stood upon twelve oxen, 1 Kings 7:23; and concerning the bases: the ten bases, which also were made of brass, 1 Kings 7:27; and concerning the residue of the vessels that remain in this city; in the king’s palace, and in the houses of the noblemen, and of the rich and wealthy of Jerusalem.

20 which Nebuchadnezzar king of Babylon took not when he carried away captive Jeconiah the son of Jehoiakim, king of Judah, from Jerusalem to Babylon, and all the nobles of Judah and Jerusalem” — which Nebuchadnezzar king of Babylon took not… for he seems only to have taken the vessels of gold and silver, and left the vessels of brass, as the above were; II Kings 24:13;

— when he carried away captive Jeconiah, the son of Jehoiakim, king of Judah, from Jerusalem to Babylon, and all the nobles of Judah and Jerusalem; II Kings 24:12.

21 yea, thus saith the Lord of hosts, the God of Israel, concerning the vessels that remain in the house of the Lord, and in the house of the king of Judah and of Jerusalem:

22 ‘They shall be carried to Babylon, and there shall they be until the day that I visit them,’ saith the Lord. ‘Then will I bring them up, and restore them to this place.’” — they shall be carried to Babylon… as they were; and of which, with others, there is a particular account in II Kings 25:13;

— and there shall be until the day that I visit them, saith to the Lord; the Chaldeans in a way of wrath, and the Jews as captives and slaves; which was at the end of the seventy years’ captivity; and so long the vessels of the sanctuary continued there; here we read of them as in use the very night that Belshazzar was slain, and Babylon taken, Daniel 5:2;

— then will I bring them up, and restore them to this place; which was fulfilled when the Lord stirred up the spirit of Cyrus, king of Persia to give leave to the Jews to return to their own land, and rebuild their temple; and at the same time delivered into the hands of Sheshbazzar, to the prince of Judah, the vessels of the temple, Ezra 1:1.

Jeremiah 28

The list of kings of Judah towards the end; in successive reigns, as Josiah (reign 640–609), Jehoahaz (reign 609), Jehoiakim (reign 609–598), Jehoiachin or Jechonias (reign 598–597), and Zedekiah (reign 597–586).

1 And it came to pass the same year, in the beginning of the reign of Zedekiah king of Judah, in the fourth year and in the fifth month, that Hananiah the son of Azur the prophet, who was of Gibeon, spoke unto me in the house of the Lord in the presence of the priests and of all the people, saying, — since Zedekiah ruled for 12 years, his fourth could still be rendered the beginning of his reign, which would be around 594 BC;

— or for another explanation: it was the fourth of Zedekiah’s reign, the same year in which he paid a visit to the king of Babylon, Jeremiah 51:59; there in Babylon, Zedekiah had his kingdom confirmed to him, and it was even enlarged, and was made king over five neighbouring kings; and so this, though the fourth of his reign over Judah, was the first of his enlarged dominions.

— Hananiah the son of Azur the prophet; the false prophet, as the Targum and Septuagint versions call him; spoke unto me in the house of the Lord, in the presence of the priests, and of all the people; he came to the temple where Jeremiah was to confront him; the priests and all the people being present;

—the land Gibeon was allocated to the tribe of Benjamin; but Gibeonite may not even be Israelites, but one of the Canaanites who deceived Joshua into making a covenant with them so they may live, and not wiped out; when Joshua found out he condemned them to be hewers of wood and a drawers of water (Joshua 9:21, 23).

“Thus speaketh the Lord of hosts, the God of Israel, saying, ‘I have broken the yoke of the king of Babylon. — thus speaketh the Lord of hosts, the God of Israel… using the language of the true prophets, and describing the Lord just in the same manner they do, and speaking in God’s name: a bold and daring action, when he knew the Lord had not sent him, nor had said any such thing to him..

Within two full years will I bring back into this place all the vessels of the Lord’S house that Nebuchadnezzar king of Babylon took away from this place and carried them to Babylon. — within two full years… or, as the Targum says, “at the end of two years;” what the false prophets before had said would be done in a very little time; this fixes the precise time of doing it; a very short time; in comparison of the seventy years that Jeremiah had spoken of, Jeremiah 25:11;

— will I bring again into this place all the vessels of the Lord’s house, that Nebuchadnezzar king of Babylon took away from this place; the temple, where he now was; namely, all such vessels as before this time had been taken by him, both in Jehoiakim’s reign, and at the captivity of Jeconiah.

And I will bring back to this place Jeconiah the son of Jehoiakim, king of Judah, with all the captives of Judah who went into Babylon,’ saith the Lord; ‘for I will break the yoke of the king of Babylon.’” — and I will bring again to this place Jeconiah the son of Jehoiakim king of Judah… this he knew would please the people, who looked upon Zedekiah only as a vessel to the king of Babylon, and not properly their king; but Jeconiah, as he is here called; and he knew that Zedekiah dared not resent this, but was obliged to feigned a desire of Jeconiah’s return, though otherwise not agreeable to him;

— with all the captives of Judah that went into Babylon, saith the Lord; the princes, officers, and others, that should be living at the time fixed: for I will break the yoke of the king of Babylon; weaken his power over other nations, and particularly deliver the king of Judah from his bondage, and from subjection to him.

Then the prophet Jeremiah said unto the prophet Hananiah in the presence of the priests and in the presence of all the people who stood in the house of the Lord,

even the prophet Jeremiah said, “Amen. The Lord do so. The Lord perform thy words which thou hast prophesied, to bring back the vessels of the Lord’S house and all that is carried away captive from Babylon into this place. — even the prophet Jeremiah said, Amen…. or, “so be it”- he wished it might be so as Hananiah had said, if it was the will of God; as a prophet he knew it could not be;

— to bring again the vessels of the Lord’s house, and all that is carried away captive, to Babylon into this place; as a priest, this must be very desirable to Jeremiah, the Jews observe, since he would be a gainer by it; being a priest, he should eat of the holy things; when Hananiah, being a Gibeonite, would be a hewer of wood and a drawer of water to him (Joshua 9:21, 23).

Nevertheless hear thou now this word that I speak in thine ears and in the ears of all the people:

The prophets that have been before me and before thee of old prophesied both against many countries and against great kingdoms, of war and of evil and of pestilence. — the prophets that have been before me, and before thee of old… such as Isaiah, Hoses, Joel, Amos, Micah, Nahum, Habakkuk, Zephaniah, and others: these prophesied both against many countries and against great kingdoms; as Egypt, Babylon, Syria, Ethiopia, Moab, as Isaiah particularly did.

The prophet who prophesieth of peace, when the word of the prophet shall come to pass, then shall the prophet be known that the Lord hath truly sent him.”

10 Then Hananiah the prophet took the yoke from off the prophet Jeremiah’s neck, and broke it. — then Hananiah the prophet took the yoke from off the prophet Jeremiah’s neck… which he wore as a symbol of the subjection of Judea and other nations to the king of Babylon: but more so, it was the command of God that he made it, and wore it;

— but now he took the prophet’s yoke from his neck; and brake it; being made of wood, as it afterwards appears, and so might easily be broken.

11 And Hananiah spoke in the presence of all the people, saying, “Thus saith the Lord: ‘Even so will I break the yoke of Nebuchadnezzar king of Babylon from the neck of all nations within the space of two full years.’” And the prophet Jeremiah went his way. — even so will I break the yoke of Nebuchadnezzar king of Babylon from the neck of all nations, within the space of two full years; the time he had fixed for the bringing back of the vessels of the sanctuary, Jeremiah 28:3;

— and the prophet Jeremiah went his way; showing thereby his dissent from him, and his dislike and detestation of his lies and blasphemies; patiently bearing his affronts and insolence; and prudently withdrawing to prevent riots and tumults; returning no answer till he had received one from the Lord himself, which he quickly had.

12 Then the word of the Lord came unto Jeremiah the prophet (after Hananiah the prophet had broken the yoke from off the neck of the prophet Jeremiah), saying,

13 “Go and tell Hananiah, saying, ‘Thus saith the Lord: Thou hast broken the yokes of wood, but thou shalt make for them yokes of iron. — thou hast broken the yokes of wood: or, “bonds” or “the thongs” with which the yokes of wood were bound and fastened;

— but thou shall make for them yokes of iron; but Jeremiah said; who went on to prophesy of a more severe bondage the nations be brought into by Nebuchadnezzar, in direct contradiction to Hananiah’s prophecy; instead of wooden yokes, they would have iron ones; which would lie heavier, and bear harder upon them, and which could not be broken nor taken off.

14 For thus saith the Lord of hosts, the God of Israel: I have put a yoke of iron upon the neck of all these nations, that they may serve Nebuchadnezzar king of Babylon, and they shall serve him; and I have given him the beasts of the field also.’” — that they may serve Nebuchadnezzar king of Babylon, and they shall serve him; directly contrary to what Hananiah had prophesied,

— and I have given him the beasts of the field also; as he had said he would, Jeremiah 27:6; and which is repeated, to show that the whole would be punctually fulfilled; that not only those nations, the men, the inhabitants of them, would be delivered to him; but even the very cattle, and all that belonged to them.

15 Then said the prophet Jeremiah unto Hananiah the prophet, “Hear now, Hananiah, the Lord hath not sent thee, but thou makest this people to trust in a lie.

16 Therefore thus saith the Lord: ‘Behold, I will cast thee from off the face of the earth. This year thou shalt die, because thou hast taught rebellion against the Lord.’” — behold, I will cast thee from off the face of the earth; with the utmost indignation and abhorrence, as not worthy to live upon it: it signifies that he should die, and that not a natural, but violent death, by the immediate hand of God, by some judgement upon him; and so be by force taken off the earth, and buried in it, and be no more seen on it;

— this year thou shalt die; within the same year, reckoning from this time; so that, had he died any time within twelve months from hence, it would have been sufficient to have verified the prophecy:

— because thou hast taught rebellion against the Lord; to despise his word by his prophet; to contradict his will; to refuse subjection to the king of Babylon; to neglect his instructions, directions, and exhortations; and to believe a lie.

17 So Hananiah the prophet died the same year in the seventh month. — in the seventh month: it was two months after he had prophesied; for it was in the fifth month that he prophesied, and in the seventh he died.

Jeremiah (Ch 25-26)

•November 13, 2021 • Leave a Comment

The list of kings of Judah towards the end; in successive reigns, as Josiah (reign 640–609), Jehoahaz (reign 609), Jehoiakim (reign 609–598), Jehoiachin or Jechonias (reign 598–597), and Zedekiah (reign 597–586).

The year in that Jeremiah began to prophesy, Jeremiah 1:2 in the thirteenth year of Josiah reign would be around 628 BC, and he preached for the last 19 years of Josiah’s life, until 609 BC when Josiah died. By the time the kings of Judah reigns ended with Zedekiah being exiled to Babylon and his reign ended in 586 BC, Jeremiah’s prophesying would have lasted some 42 years.

Jeremiah 25

1 The word that came to Jeremiah concerning all the people of Judah in the fourth year of Jehoiakim the son of Josiah, king of Judah (that was the first year of Nebuchadnezzar king of Babylon), — the fourth year of Jehoiakim would be perhaps 606 BC or whereabout;

— before the prophet Jeremiah was sent to the shepherds, elders and kings of Judah only, Jeremiah 23 and 24; now his message is to all the people.

which Jeremiah the prophet spoke unto all the people of Judah and to all the inhabitants of Jerusalem, saying: — which Jeremiah the prophet spake unto all the people of Judah… perhaps at one of the three feasts: at Passover, Pentecost, or Tabernacles; at which all the males appeared in Jerusalem as commanded.

From the thirteenth year of Josiah the son of Amon, king of Judah, even unto this day (that is, the three and twentieth year), the word of the Lord hath come unto me, and I have spoken unto you, rising early and speaking; but ye have not hearkened. — from the thirteenth year of Josiah the son of Amon king of Judah, even unto this day… the year in which Jeremiah began to prophesy, Jeremiah 1:2; which would be around 628 BC.

And the Lord hath sent unto you all His servants the prophets, rising early and sending them; but ye have not hearkened, nor inclined your ear to hear. — but ye have not hearkened; they took no notice of it; turned a deaf ear to it; however, did not obey or act as they were directed and exhorted to.

They said, “Turn ye again now every one from his evil way and from the evil of your doings, and dwell in the land that the Lord hath given unto you and to your fathers for ever and ever. — turn ye again now everyone from his evil way, and from the evil of your doings; repent of sins, and reform from them; particularly their idolatries, to which they were prone, and are after mentioned.

And go not after other gods to serve them and to worship them, and provoke Me not to anger with the works of your hands; and I will do you no hurt. — and I will do you no hurt; by sword, or famine, or pestilence, or captivity; signifying the hurt he had threatened them with should not be done, provided they forsook their idolatrous worship; God does no hurt to his true worshippers; yea, he makes all things work together for their good.

Yet ye have not hearkened unto Me,” saith the Lord, “that ye might provoke Me to anger with the works of your hands to your own hurt.”

Therefore thus saith the Lord of hosts: “Because ye have not heard My words,

behold, I will send and take all the families of the north,” saith the Lord, “and Nebuchadnezzar the king of Babylon, My servant, and will bring them against this land and against the inhabitants thereof, and against all these nations round about, and will utterly destroy them and make them an astonishment and a hissing and perpetual desolations. — and Nebuchadnezzar the king of Babylon my servant: though a great king, he was a servant of the Lord of hosts; a servant, a pawn both as a creature of his make, and as a king that ruled under him; and as he was an instrument in his hand to chastise his people the Jews;

— and against all these nations round about; Egypt and others; so that the Jews could have no help from them; nor an alliance with them;

— and will utterly destroy them, and make them an astonishment, and an hissing, and perpetual desolations; both the Jews and their neighbours; who should be an astonishment to some, and a hissing to others, and remain desolate for a long time; even till the seventy years were ended.

10 Moreover I will take from them the voice of mirth and the voice of gladness, the voice of the bridegroom and the voice of the bride, the sound of the millstones and the light of the candle.

11 And this whole land shall be a desolation and an astonishment, and these nations shall serve the king of Babylon seventy years. — and other nations shall serve the king of Babylon seventy years; both the Jews, and other nations of Egypt, reckoning from the date of this prophecy, the fourth year of Jehoiakim’s reign, when Daniel and others were carried captive, Daniel 1:1; to the first year of Cyrus.

12 And it shall come to pass, when seventy years are accomplished, that I will punish the king of Babylon and that nation,” saith the Lord, “for their iniquity, and the land of the Chaldeans, and will make it perpetual desolations. — that I will punish the king of Babylon, and that nation, saith the Lord, for their iniquity; the king for his tyranny, and the nation for their idolatry; and both for these and other sins they were guilty of;

— for, though they did the will of God in carrying the Jews captive, they no doubt in their usage of them exceeded their commission, and were justly punishable for their iniquities. This is not to be understood of the present king of Babylon, Nebuchadnezzar, nor of Nabonadius, or Belshazzar, whom the Lord punished by Cyrus; who appears to have been a very wicked man, and in the excess of not, profaning the vessels of the temple the night he was slain, Daniel 5:1.

13 And I will bring upon that land all My words which I have pronounced against it, even all that is written in this book, which Jeremiah hath prophesied against all the nations. — even all that is written in this book, which Jeremiah hath prophesied against all the nations: the Egyptians, Philistines, Moabites, Edomites, Arabians, Persians, and also the Babylonians, in Jeremiah 46:1.

14 For many nations and great kings shall serve themselves by them also; and I will recompense them according to their deeds and according to the works of their own hands.” — for many nations and great kings shall serve themselves of them also… take their cities, seize upon the kingdoms, spoil them of their wealth and riches, and bring them into servitude to them: these “many nations” which should and did all this, were the Medes and Persians, and those that were subject to them, or their allies and auxiliaries in this expedition; and the “great kings” were Cyrus and Darius, and those that were confederate with them.

15 For thus saith the Lord God of Israel unto me: “Take the wine cup of this fury at My hand, and cause all the nations to whom I send thee to drink it. — take the wine cup of this fury at my hand; in a vision the Lord appeared to Jeremiah with a cup of wine in his hand, which he bid him take of him. It is usual in Scripture for the judgments of God on men to be signified by a cup of hot and intoxicating liquor, Isaiah 51:17.

16 And they shall drink and be moved, and be mad because of the sword that I will send among them.” — and they shall drink, and be moved, and be mad… the judgements foretold shall come upon them, whether they will or not; which will have such effects upon them, as intoxicating liquor has on drunken persons; make them shake and tremble, and reel to and fro, and toss and tumble about, and behave like madmen.

17 Then took I the cup at the Lord’S hand, and made all the nations to drink, unto whom the Lord had sent me, — and made all the nations to drink, unto whom, the Lord had sent me; not that he travelled through each of the nations with a cup in his hand, as an emblem of what wrath would come upon them, and they should drink deep of; but this was done in vision, and also in prophecy; the prophet proclaiming the will of God, all his judgements upon the nations, and what would befall them.

18 to wit: Jerusalem and the cities of Judah, and the kings thereof and the princes thereof, to make them a desolation, an astonishment, a hissing and a curse, as it is this day; — to make them a desolation, an astonishment, an hissing, and a curse; to strip them of their crowns and kingdom, of their wealth, and riches, and honour, and bring them into slavery and bondage; so that they became an astonishment to some, to see the change that was made in them; and were hissed stand cursed by others:

— as it is this day; which is added, either because of the certainty of it, or because it began to take, place this very year; though more fully in Jeconiah’s time, and still more in Zedekiah’s; or rather this clause might be added by Jeremiah after the captivity; or by Baruch, or by Ezra, or whoever collected his prophecies, and put them into one volume, as Jeremiah 52:1 seems to be added by another hand.

19 Pharaoh king of Egypt, and his servants, and his princes, and all his people; — Pharaoh king of Egypt… who is mentioned first after the kings of Judah; not only because the Jews were in alliance with Egypt, and trusted to them; and therefore this is observed, to show the vanity of their confidence and dependence; but because the judgements of God first took place on the king of Egypt; for in this very year, in which this prophecy was delivered, Pharaohnecho king of Egypt was smitten by Nebuchadnezzar, Jeremiah 46:2.

20 and all the mingled people, and all the kings of the land of Uz, and all the kings of the land of the Philistines, and Ashkelon, and Gaza, and Ekron, and the remnant of Ashdod.

21 Edom, and Moab, and the children of Ammon; — Edom, and Moab, and the children of Ammon; all well known and implacable enemies of Israel; the Edomites descended from Esau; and the Moabites and Ammonites from Moab and Ammon, the two sons of Lot by his daughters. Their destruction is prophesied of in Jeremiah: chapters 48-49.

22 and all the kings of Tyre, and all the kings of Sidon, and the kings of the isles which are beyond the sea; — and all the kings of Tyrus, and all the kings of Zidon… two very ancient cities in Phoenicia, frequently mentioned together in Scripture, being near each other; their ruin were also foretold by prophet Ezekiel; chapters 26-28.

23 Dedan, and Tema, and Buz, and all that are in the utmost corners;

24 and all the kings of Arabia, and all the kings of the mingled people that dwell in the desert;

25 and all the kings of Zimri, and all the kings of Elam, and all the kings of the Medes;

26 and all the kings of the north, far and near, one with another, and all the kingdoms of the world which are upon the face of the earth; and the king of Sheshach shall drink after them. — and the king of Sheshach shall drink after them; or the king of Babylon, as the Targum; and that Babylon is meant by “Sheshach” is certain from Jeremiah 51:41; but why it is so called is not so easy to say. The Jewish writers make it to be the same with Babylon, by a change of the letters in the alphabet, put in such a situation, which they call “Athbash”, in which “shin” is put for “beth”, and “caph” for “lamed”; and so, instead of Babel or Babylon, you have “Sheshach” which is thought to be used rather than Babylon, that Nebuchadnezzar, now besieging Jerusalem.

27 “Therefore thou shalt say unto them, ‘Thus saith the Lord of hosts, the God of Israel: Drink ye and be drunken, and spew and fall, and rise no more, because of the sword which I will send among you.’ — drink ye, and be drunken, and spew, and fall, and rise no more; as is sometimes the case of drunken men; they drink till they are quite intoxicated; and become drunk, and then they spew up what they have drunk; and, attempting to walk, fall, and sometimes so as never to rise; not only break their bones, but their necks, or fall into places where they are suffocated, where they could loose their lives.

28 And it shall be, if they refuse to take the cup at thine hand to drink, then shalt thou say unto them, ‘Thus saith the Lord of hosts: Ye shall certainly drink. — then shalt thou say unto them, thus saith the Lord of hosts, ye shall certainly drink; or those judgements shall certainly be inflicted; there will be no possibility of escaping, whether they were believed or not; for thus saith the Lord of hosts, who is omnipotent and does what he pleases with the armies of heaven over whom he has a despotic power and government on earth.

29 For lo, I begin to bring evil on the city which is called by My name. And should ye be utterly unpunished? Ye shall not be unpunished, for I will call for a sword upon all the inhabitants of the earth, saith the Lord of hosts.’ — judgement often begins at the house of God, for the correction of his people, and to be a warning to others; but the heaviest strokes are reserved for the ungodly.

30 “Therefore prophesy thou against them all these words, and say unto them: “‘The Lord shall roar from on high, and utter His voice from His holy habitation; He shall mightily roar upon His habitation; He shall give a shout, as they that tread the grapes, against all the inhabitants of the earth. — the Lord shall roar from on high: from heaven, like a lion in violent claps of thunder; or in such dreadful dispensations of his providence, as will be very amazing and yet terrifying;

— he shall give a shout, as they that tread the grapes, against all the inhabitants of the earth; or, “answer a shout” give the onset for battle against the inhabitants of the earth, as the general of an army; which is accompanied with a shout, like that which is made by workmen treading in the wine press, to encourage one another to go on the more cheerfully in their work.

31 A noise shall come even to the ends of the earth, for the Lord hath a controversy with the nations. He will plead with all flesh; He will give them that are wicked to the sword,’” saith the Lord. — a noise shall come to the ends of the earth; the report of these calamities and confusions shall reach the most distant countries; for the Lord hath a controversy with the nations God enters into judgement with men for their impieties (lack of piety or reverence for God).

32 Thus saith the Lord of hosts: “Behold, evil shall go forth from nation to nation, and a great whirlwind shall be raised up from the coasts of the earth.” — thus saith the Lord of hosts, behold, evil shall go forth from nation to nation… begin in one nation, and then go on to another; first in Judea, and then in Egypt; and so on, like a catching distemper, or like fire that first consumes one house, and then another; and thus shall the cup go round from nation to nation, before prophesied of: thus, beginning at Judea, one nation after another was destroyed by the king of Babylon; then he and his monarchy were destroyed by the Medes and Persians; and then they by the Macedonians; and then the Greeks by the Romans;

— and a great whirlwind shall be raised up from the coasts of the earth; or “from the sides of it” that is, “from the ends of it” as the Targum paraphrases it, “and many people shall come openly from the ends of the earth;” this was first verified by the Chaldean army under Nebuchadnezzar, compared to a whirlwind, Jeremiah 4:13; and then by the Medes and Persians under Cyrus; and after that by the Greeks under Alexander the Great, and last of all by the Romans under Titus Vespasian.

33 And the slain of the Lord shall be at that day from one end of the earth even unto the other end of the earth. They shall not be lamented, neither gathered, nor buried; they shall be dung upon the ground. — shall be at that day from one end of the earth even unto the other end of the earth; and like Covid-19 not that this should be at one and the same time; for there never was such a time, that there was such a general slaughter in the world, that the slain should reach from one end to the other;

Covid-19 could just be the beginning in which the cup should go round to all nations, meant by “at that day” the slain of the Lord would be in all parts of the world; or that, according to his will, there would be a great slaughter everywhere as the cup went round, or the sword was sent, first ravaging one country and then another.

34 Howl, ye shepherds, and cry; and wallow yourselves in the ashes, ye leaders of the flock; for the days of your slaughter and of your dispersions are accomplished, and ye shall fall like a pleasant vessel. — howl, ye shepherds, and cry… the Targum says, “howl, ye kings, and cry” and the rulers and governors of the nations before threatened with destruction are meant; who are here called upon to lamentation and mourning for the ruin and loss of their kingdoms.

35 And the shepherds shall have no way to flee, nor the leaders of the flock to escape. — and the shepherds shall have no way to flee… Or, “and flight shall perish from the shepherds” though they may attempt it, they shall not be able to accomplish it; neither the dignity of their persons, the greatness of their power, or the abundance of their riches, would make a way for them; their enemies being so numerous, powerful and watchful.

36 A voice of the cry of the shepherds, and a howling of the leaders of the flock shall be heard; for the Lord hath despoiled their pasture. — a voice of the cry of the shepherds; those are great calamities indeed that strike such a terror upon great men, and put them into this mighty consternation;

— for the Lord hath spoiled their pastures; in which they fed their flock, and out of which they fed themselves; the spoiling of this makes them cry out thus. Carrying on the metaphor of a lion roaring, the prophet alludes to the great fright into which shepherds are put when they hear a roaring lion coming toward them, and find that neither they nor their flocks can escape.

37 And the peaceable habitations are cut down because of the fierce anger of the Lord. — and the peaceable habitations are cut down; those that used to be quiet and not molested, who had long dwelt in peace and safety, shall now be exposed to all the calamities of war, and shall be thereby destroyed; or, those that used to be peaceable, and not to molest any of their neighbours, nor give provocation to any, shall yet not escape.

38 He hath forsaken His covert as the lion; for their land is desolate because of the fierceness of the Oppressor, and because of His fierce anger. — he hath forsaken his covert as a lion… some understand of God leaving Jerusalem, or the temple, where he dwelt; who, while he made it his residence, protected it; but when he forsook it, it became exposed to the enemy; that is true with the destruction of the first temple by Nebuchadnezzar; but also true with the destruction of the second temple; that is, by the Romans;

— because of the fierceness of the oppressor; the tyrant Nebuchadnezzar, and later by Hadrian; or the “oppressing sword” as some supply it and so the Targum says, “from before the sword of the enemy.”

Jeremiah 26

1 In the beginning of the reign of Jehoiakim the son of Josiah, king of Judah, came this word from the Lord, saying, — in the beginning of the reign of Jehoiakim the son of Josiah king of Judah… so that the prophecy of this chapter were before the preceding chapter; that being in the fourth year, this in the beginning of Jehoiakim’s reign; so here is another flashback. Josiah was dead, Jehoahaz his son reigned but three months, and then was deposed by Pharaohnecho king of Egypt; and this Jehoiakim, another son of Josiah, also called Eliakim, was set on the throne.

“Thus saith the Lord: ‘Stand in the court of the Lord’S house, and speak unto all the cities of Judah, which come to worship in the Lord’S house, all the words that I command thee to speak unto them; diminish not a word. — and speak unto all the cities of Judah; the inhabitants of them; not only to those that dwelt at Jerusalem but also to those in the rest of the cities of Judah; for what he was to say concerned them all, they having all sinned, and needed repentance; without which they would be involved in the general calamity of the nation:

— which come to worship in the Lord’s house; as they did three times in the year, at the feasts of Passover, Pentecost, and Tabernacles; and it could be the last of these, when this prophecy was to be delivered to them.

It may so be they will hearken and turn every man from his evil way, that I may repent Me of the evil which I purpose to do unto them because of the evil of their doings.’

And thou shalt say unto them, ‘Thus saith the Lord: If ye will not hearken to Me, to walk in My law which I have set before you,

to hearken to the words of My servants the prophets whom I sent unto you, both rising up early and sending them, but ye have not hearkened — to hearken to the words of my servants the prophets… the interpretations they give of the law; the teachings they deliver; the exhortations, cautions, and reproofs given by them in the name of the Lord, whose servants they were; and therefore should be hearkened to; since hearkening to them is hearkening to the Lord himself, in whose name they speak, and whose message they deliver.

then will I make this house like Shiloh, and will make this city a curse to all the nations of the earth.’” — then will I make this house like Shiloh… where the ark was until it was taken by the Philistines; and then the Lord forsook his tabernacle there, Psalms 78:60; and so he threatens to do the like to the temple at Jerusalem, should they continue in their disobedience to him;

— and will make this city a curse to all the nations of the earth; that is, the city of Jerusalem, which should be taken up, and used proverbially in all countries; who, when they would curse anyone, should say, the Lord make thee as Jerusalem, or do unto thee as he has done to Jerusalem.

So the priests and the prophets and all the people heard Jeremiah speaking these words in the house of the Lord. — heard Jeremiah speaking these words in the house of the Lord; in the temple; in the court of Israel; they heard him out, and did not interrupt him while he was speaking; and having heard him, they were angry with him and were witnesses against him; they did not hear him so as to obey his words, receive his instructions and follow his directions; but they heard him with indignation, and were determined to prosecute him unto death.

Now it came to pass, when Jeremiah had made an end of speaking all that the Lord had commanded him to speak unto all the people, that the priests and the prophets and all the people took him, saying, “Thou shalt surely die! — that the priests and the prophets and all the people, took him; the priests and the prophets were the leading men in this action; they stirred up the people against him and through their instigation he was seized and laid hold on;

— saying, thou shall surely die; signifying that they would bring a charge against him, and which by the law would be death; unless they meant in the manner of zealots to put him to death themselves, without judge or jury; and which they would have put in execution, had not the princes of the land or the great Sanhedrin heard of it; and therefore to prevent it came to the temple, as is afterwards related.

Why hast thou prophesied in the name of the Lord, saying, ‘This house shall be like Shiloh, and this city shall be desolate without an inhabitant’?” And all the people were gathered against Jeremiah in the house of the Lord. — and all the people were gathered against Jeremiah in the house of the Lord; besides those that were in the temple that heard him, others, upon a rumour that he was apprehended by the priests and prophets and people in the temple, got together in a mob about him: or, they were “gathered to” to hear what he had to say in his own defence; but it appears afterwards that they were on his side, Jeremiah 26:16.

10 When the princes of Judah heard these things, then they came up from the king’s house unto the house of the Lord, and sat down in the entry of the New Gate of the Lord’S house. — and sat down in the entry of the new gate of the Lord’s house; as a court of judicature, to hear and try the cause between the prophet and his accusers. This gate of the temple is thought to be the upper gate, which Jotham built, II Kings 15:35;

the Targum calls it the eastern gate; but Jeremiah called it the New Gate, because being newly repaired, or some new structures added to it, it gives this reason for its being called new; that when Jehoiakim was carried captive, and some of the vessels of the temple, Nebuchadnezzar’s army broke the eastern gate, which Zedekiah afterwards repaired and made new.

11 Then spoke the priests and the prophets unto the princes and to all the people, saying, “This man is worthy to die; for he hath prophesied against this city, as ye have heard with your ears.” — for he hath prophesied against this city; the city of Jerusalem; saying that it should be a curse to other nations; or, as they interpreted it, that it should be utterly destroyed, and become desolate, and none should inhabit it.

12 Then spoke Jeremiah unto all the princes and to all the people, saying, “The Lord sent me to prophesy against this house and against this city all the words that ye have heard. — the Lord sent me to prophesy against this house, and against this city, all the words that ye have heard; he does not deny but that he had prophesied against the city of Jerusalem and against the temple, and that they should both come to ruin, unless the people repented and reformed;

— but then he urges, that he was sent by the Lord on this errand, and that every word that he had said, and they had heard, he was ordered to say by the Lord; and therefore what was he, that he should withstand God? he surely was not to be blamed for doing what the Lord commanded him to do; besides, all this was threatened only in case they continued being obstinate and impenitent.

13 Therefore now amend your ways and your doings, and obey the voice of the Lord your God; and the Lord will repent of the evil that He hath pronounced against you.

14 As for me, behold, I am in your hand: do with me as seemeth good and meet unto you. — do with me as seemeth good and meet unto you; he readily submitted to their pleasure, and should patiently endure what they thought fit to inflict upon him; it gave him no great concern whether his life was taken from him; he was satisfied he had done what he ought to do, and would do the same; and therefore they might proceed just as they pleased against him.

15 But know ye for certain that if ye put me to death, ye shall surely bring innocent blood upon yourselves and upon this city, and upon the inhabitants thereof; for truly the Lord hath sent me unto you to speak all these words in your ears.”

16 Then said the princes and all the people unto the priests and to the prophets, “This man is not worthy to die, for he hath spoken to us in the name of the Lord our God!” — then said the princes and all the people unto the priests and to the prophets… hearing Jeremiah’s testimony for themselves, it appeared that he was justified in what he had said and done; hence they acquitted him; and the people, who before were on the side of the priests and false prophets; yet hearing what Jeremiah had testified for himself and also the judgement of the princes, they joined with the court in an address to the priests and prophets, who were the chief accusers, and who would fain have had him brought in guilty of death; that

— this man is not worthy to die; or, “the judgement of death is not for this man”; we cannot give judgement against him; he is not guilty of any crime deserving death; 

— for he hath spoken to us in the name of the Lord our God; not in his own name, nor of his own head; but in the name of the Lord, and by his order; and therefore was not a false, but a true prophet: what methods they took to know this, and to make it appear to the people, is not said; very probably the settled character of the prophet; their long acquaintance with him, and knowledge of him; his integrity and firmness of mind; the plain marks of seriousness and humility, and a disinterested view, made them conclude in his favour.

17 Then rose up certain of the elders of the land, and spoke to all the assembly of the people, saying,

18 “Micah the Morasthite prophesied in the days of Hezekiah king of Judah, and spoke to all the people of Judah, saying, ‘Thus saith the Lord of hosts: “‘Zion shall be plowed like a field, and Jerusalem shall become heaps, and the mountain of the house as the high places of a forest.’

19 “Did Hezekiah king of Judah and all Judah put him at all to death? Did he not fear the Lord, and besought the Lord, and the Lord repented of the evil which He had pronounced against them? Thus might we procure great evil against our souls.” — did Hezekiah king of Judah and all Judah put him at all to death?… no, they did not: neither the king, by his own authority; nor the Sanhedrin, the great court of judicature, for the nation; they never sought to take away his life, nor sat in council about it; they never arraigned him, and much less condemned him:

— did he not fear the Lord, and besought the Lord; that is, Hezekiah; he did, as knowing that Micah was a prophet of the Lord, and sent by him; wherefore he received his prophecy with great awe and reverence, as coming from the Lord, and made his supplications to him that he would avert the judgements threatened:

— and the Lord repented of the evil which he had pronounced against them? the king and his people, the city and the temple; and so the threatened evil came not upon them in their days.

20 And there was also a man who prophesied in the name of the Lord, Urijah the son of Shemaiah of Kirjathjearim, who prophesied against this city and against this land according to all the words of Jeremiah.

21 And when Jehoiakim the king, with all his mighty men and all the princes, heard his words, the king sought to put him to death; but when Urijah heard it, he was afraid and fled, and went into Egypt.

22 And Jehoiakim the king sent men into Egypt, namely, Elnathan the son of Achbor and certain men with him into Egypt.

23 And they fetched forth Urijah out of Egypt and brought him unto Jehoiakim the king, who slew him with the sword and cast his dead body into the graves of the common people.

24 Nevertheless the hand of Ahikam the son of Shaphan was with Jeremiah, that they should not give him into the hand of the people to put him to death. — nevertheless, the hand of Ahikam the son of Shaphan was with Jeremiah… though this instance was urged as a precedent to go by, being lately done; or though the king’s cruelty had been so lately exercised in such a manner; yet this man, who had been one of Josiah’s courtiers and counsellors, II Kings 22:12; stood by Jeremiah, and used all his power, authority, and influence, in his favour:

— that they should not give him into the hand of the people, to put him to death; that the Sanhedrin should not; who, by the last precedent mentioned, might seem inclined to it; but this great man, having several brothers, as well as other friends, that paid a regard to his arguments and solicitations; he prevailed upon them not to give leave to the people to put him to death, who appear to have been very fickle and mutable;

— at first they joined with the priests and false prophets against Jeremiah, to accuse him; but upon the judgement and vote of the princes, they changed their sentiments, and were for the prophet against the priests and the false prophets.

Jeremiah (Ch 23-24)

•November 12, 2021 • Leave a Comment

The list of kings of Judah towards the end; in successive reigns, as Josiah (reign 640–609), Jehoahaz (reign 609), Jehoiakim (reign 609–598), Jehoiachin or Jechonias (reign 598–597), and Zedekiah (reign 597–586).

Jeremiah 23

1 “Woe be unto the shepherds that destroy and scatter the sheep of My pasture!” saith the Lord. — woe be unto the shepherds… or, “O ye shepherds” or “governors” as the Targum says; the civil rulers and magistrates, kings and princes of the land of Judag; since ecclesiastical rulers, the priests and prophets, are mentioned as distinct from them in Jeremiah 23:9; whose business it was to rule and guide, protect and defend the people;

— that destroy and scatter the sheep of my pasture, saith the Lord God; set them bad examples, led them into idolatry which were the cause of their ruin, and of their being carried captive, and scattered in other countries; inasmuch as these people were the Lord’s pasture sheep, whom he had an interest in, and a regard unto, and had committed them to the care and charge of these shepherds to be particularly taken care of.

Therefore thus saith the Lord God of Israel against the shepherds that feed My people: “Ye have scattered My flock and driven them away, and have not visited them. Behold, I will visit upon you the evil of your doings,” saith the Lord. — ye have scattered my flock, and driven them away, and have not visited them; they had been driven out of their dwellings, and out of their own land, and being among the nations of the world, and took no thoughts for their return;

— behold, I will visit you for the evil of your doings, saith the Lord; that is, punish them for their iniquities; since they visited not the flock in a way of mercy and kindness, as the duty of their office required, the Lord would visit them in a way of justice, and punish them according to their doings.

“And I will gather the remnant of My flock out of all countries whither I have driven them, and will bring them again to their folds; and they shall be fruitful and increase. — and I will gather the remnant of my flock, out of all countries… such of them as did not perish by the sword, famine, and pestilence, or died not in captivity, and chose not to remain in the kingdom where they were.

And I will set up shepherds over them who shall feed them; and they shall fear no more, nor be dismayed, neither shall they be lacking,” saith the Lord. — and I will set shepherds over them, who shall feed them… good shepherds, rulers and governors, that shall rule them with wholesome laws, and protect and defend them; such as Zerubbabel, Nehemiah and others, after the captivity.

“Behold, the days come,” saith the Lord, “that I will raise unto David a righteous Branch; and a King shall reign and prosper, and shall execute judgement and justice in the earth. — that I will raise unto David a righteous Branch; the Messiah; so it is explained by the Targum, which calls him the Messiah of the righteous; and by the ancient Jews also; who is spoken of frequently by the prophets as a branch, Isaiah 4:2.

In His days Judah shall be saved, and Israel shall dwell safely; and this is His name whereby He shall be called: The Lord Our Righteousness. — He shall be called, the Lord our, Righteousness; here the Messiah is spoken of by a name, in a figure, which is used also by Isaiah and Zechariah.

“Therefore, behold, the days come,” saith the Lord, “that they shall no more say, ‘The Lord liveth who brought up the children of Israel out of the land of Egypt,’

but, ‘the Lord liveth who brought up and who led the seed of the house of Israel out of the north country, and from all countries whither I had driven them.’ And they shall dwell in their own land.” — which brought up and which led the seed of the house of Israel out of the north country, and from all countries whither I had driven them: which respects not only the deliverance of the Jews from Babylon, which lay north of Judea; but the return of the ten tribes, and also the gathering of them together at the latter day, when they shall turn to the Lord, and return to their own land;

— notice the subtle change: from the house of Judah to the house of Israel; that is, now it is the ten tribes; and second, out of all the countries or nations, rather than just one nation Babylon; hence this is prophetic regarding the ten tribes and for the endtimes.

Mine heart within me is broken because of the prophets; all my bones shake. I am like a drunken man and like a man whom wine hath overcome, because of the Lord and because of the words of His holiness. — mine heart within me is broken because of the prophets… the false prophets, as the Targum rightly interprets it, because of their false doctrines and wicked lives; and because of the mischief they did the people, and the ruin they brought upon them and to themselves.

10 For the land is full of adulterers; for because of cursing the land mourneth; the pleasant places of the wilderness are dried up, and their course is evil, and their force is not right.

11 “For both prophet and priest are profane; yea, in My house have I found their wickedness,” saith the Lord. — for both prophet and priest are profane… being guilty of the mentioned sins; the Targum says, “the scribe and the priest;” and such were the scribes and priests in the time of our Lord; they played “the hypocrite” as some render the word here; and are often charged with the sin of hypocrisy and called hypocrites.

12 “Therefore their way shall be unto them as slippery ways in the darkness; they shall be driven on, and fall therein; for I will bring evil upon them, even the year of their visitation,” saith the Lord. — for I will bring evil upon them: the evil of punishment, which is from the Lord: as sword, famine, pestilence and captivity;

— “even the year of their visitation” could also mean a day of visitation at the latter days, see Jeremiah 23:20.

13 “And I have seen folly in the prophets of Samaria: They prophesied in Baal and caused My people Israel to err. — and I have seen folly in the prophets of Samaria… the ten tribes of Israel, among whom, in Ahab’s time there were many false prophets, Baal’s prophets, even four hundred and fifty; whose “folly” the Lord had formerly taken notice of; even their idolatry and impiety for giving into which the ten tribes had been carried captive years ago. 

14 I have seen also in the prophets of Jerusalem a horrible thing: They commit adultery and walk in lies; they strengthen also the hands of evildoers, that none doth return from his wickedness. They are all of them unto Me as Sodom, and the inhabitants thereof as Gomorrah.” — I have seen also in the prophets of Jerusalem an horrible thing… or “so have I seen” as before observed even in the prophets of Jerusalem, where the temple was, and where the pure worship of God was professed to be observed;

— and walk in lies; or, “walking in lies” constantly speaking lies in their common talk and conversation; so that they were not to be believed in anything they said; which was monstrous; and delivering out false doctrines in the name of the Lord, pretending they received them from him; which was worse than prophesying in the name of Baal.

15 Therefore thus saith the Lord of hosts concerning the prophets: “Behold, I will feed them with wormwood, and make them drink the water of gall; for from the prophets of Jerusalem is profaneness gone forth into all the land.” — therefore thus saith the Lord of hosts concerning the prophets… concerning the false prophets, as the Targum says; their sin is before declared, and now their punishment: behold, I will feed them with wormwood; with some bitter affliction and calamity;

— so the Targum says, “behold, I will bring upon them distress bitter as wormwood;”

— and make them drink the water of gall: or “the juice of hemlock” or “poison” or “the savour of death” as they poisoned the people with their false doctrines, they shall drink poison themselves; they shall not only have that which is bitter and unpleasant, but that which is noxious and hurtful; not only a bitter potion, but a destructive one; the Targum says, “I will cause them to drink a cup of the curse, bad as the heads of serpent.”

16 Thus saith the Lord of hosts: “Hearken not unto the words of the prophets that prophesy unto you. They make you vain; they speak a vision of their own heart, and not out of the mouth of the Lord. — they make you vain; they filled their heads with vain and empty things, and their hearts with vain hopes;

— so the Targum says, “they deceive you;” they taught vain things, and made them vain and sinful in their lives and conversations; and therefore were not to be hearkened to.

17 They say still unto them that despise Me, ‘The Lord hath said, “Ye shall have peace.”’ And they say unto every one that walketh after the imagination of his own heart, ‘No evil shall come upon you.’” — the Lord hath said, ye shall have peace; all manner of prosperity; that they should dwell in their own land, and not go into captivity, and enjoy the good things of it in peace and prosperity; this they pretended they had from the Lord; which was an aggravation of their sins; not only to tell a lie, but to tell it in the name of the Lord, and in direct opposition to what the true prophets said from the mouth of the Lord, particularly Jeremiah.

18 For who hath stood in the counsel of the Lord, and hath perceived and heard His word? Who hath marked His word and heard it?

19 Behold, a whirlwind of the Lord is gone forth in fury, even a grievous whirlwind; it shall fall grievously upon the head of the wicked. — behold, a whirlwind of the Lord is gone forth in fury… or, “behold, a whirlwind of the Lord, of the fury is gone forth” which latter clause explains the former; and, hews, that by “the whirlwind of the Lord” is meant his “fury” or “wrath” which, like a whirlwind, would come suddenly and at an unawares and be very boisterous and powerful;

— and which was gone forth from the Lord and the Chaldean army would quickly appear and invade Judea and besiege Jerusalem, compared to a full and fanning wind, and its chariots to a whirlwind, Jeremiah 4:11.

20 The anger of the Lord shall not return, until He has executed and till He has performed the thoughts of His heart; in the latter days ye shall consider it perfectly. — in the “latter days” (Genesis 49:1Numbers 24:14Deuteronomy 4:30Deuteronomy 31:29), i.e., in the then distant future), in the then distant future — literally, the end of the days, the endtimes;

— in the latter days ye shall consider it perfectly; when too late to avert it by repentance and reformation when all this shall be fulfilled, and the seventy years captivity take place;

— or, “in the end of days” in the latter part off time, when the Jews seek the Lord their God, Hosea 3:5; then “shall they understand it with an understanding” as it may be rendered; when they shall have the veil removed from them, and turn to the Lord;

— in the latter days ye shall consider it perfectly; or rather, in the latter days ye shall understand it clearly, viz. that the calamities which will have come upon you are the divine judgement upon your sins;

— here and there the Scriptures hint the message is prophetic, into our time, the endtimes; hence one may read the rest of this chapter with the endtimes in mind, especially there is a proliferation of false prophets around.

21 “I have not sent these prophets, yet they ran; I have not spoken to them, yet they prophesied. — I have not spoken to them, yet they prophesied; wherefore what they prophesied was not the word of the Lord, but what they themselves devised; and so was what was false;

— as the Targum adds: it is a sad character of men when they speak in public neither by the will of God, nor according to the word of God.

22 But if they had stood in My counsel and had caused My people to hear My words, then they should have turned them from their evil way and from the evil of their doings. — but if they had stood in My counsel and had caused My people to hear My words, proclaiming them as they were truly revealed, then they should have turned them from their evil way and from the evil of their doings;

— in other words, they would preach repentance from idolatry instead of confirming the people in their false security, which has ever been a trick of such as falsely proclaimed themselves messengers of the Lord. To give weight to these reproofs, the Lord now shows why it is that He is familiar with the hypocritical conduct of the false prophets.

23 “Am I a God at hand,” saith the Lord, “and not a God afar off? — God is omniscient, and omnipotent; the Targum says, “I God have created the world from the beginning, saith the Lord; and I God will renew the world for the righteous.”

24 Can any hide himself in secret places, that I shall not see him?” saith the Lord. “Do not I fill heaven and earth?” saith the Lord.

25 “I have heard what the prophets said who prophesy lies in My name, saying, ‘I have dreamed, I have dreamed.’ — saying, I have dreamed, I have dreamed; not a common dream, but a divine dream; this was one way in which the Lord formerly made known his mind and will to his servants, Numbers 12:6; wherefore these false prophets, in imitation of the true ones, and in order to gain credit from the people, pretended they had a dream from the Lord, in which such and such things were revealed to them;

— and this is repeated by them for the greater certainty of it, and to raise the people’s attention as to something very uncommon and extraordinary. So the Targum says “saying, a word of prophecy has been shown to me in a dream.”

26 How long shall this be in the heart of the prophets who prophesy lies? Yea, they are prophets of the deceit of their own heart, — how long shall this be in the heart of the prophets or prophetess, like one called Jezebel, that prophesy lies?…. to invent such lies, and deceive the people, and turn them away from God; agreeably to the preceding and following verses: this shows that this was not through ignorance and inadvertence; it was a meditated and studied thing by them; they contrived it in their hearts, and they were resolute and bent upon it, and took much delight and pleasure in it.

27 who think to cause My people to forget My name by their dreams which they tell every man to his neighbor, as their fathers have forgotten My name for Baal. — they cause my name Yehovah (YHVH) to be forgotten, and substituted it by false prophets and have used Baal as my name and the prophesying in such a name;

— His name is the four-letter Hebrew word יהוה‎ YHVH Yehovah (not Jehovah since the letter J wasn’t around but only after the sixteenth century; (more on this at the end)

28 The prophet that hath a dream, let him tell a dream; and he that hath My word, let him speak My word faithfully. What is the chaff to the wheat?” saith the Lord. — the prophet that hath a dream, let him tell a dream; the Septuagint version is, “let him tell his dream” let him tell it as his own, and not as a dream from the Lord;

— let him speak my word faithfully; or “truly” as it is; teachers of the word are stewards, and it is required of such that they be faithful, and a more honourable character they cannot well have; and then may the word of the Lord be said to be spoken faithfully, when nothing else is spoken but that; when there is no mixture of man’s with God’s; and when the whole of it is spoken, and nothing kept back or concealed;

— or, “let him speak my word, truth” which is truth; or, for it is truth; so this is a reason why it should be spoken freely, fully, publicly, and boldly, because it is truth, and nothing but truth: or, “let him speak my word as truth;”

— why do ye mix the chaff with the wheat? the Targum interprets this of persons, paraphrasing the words thus, “behold, as one separates between the chaff and the wheat, so I separate between the righteous and the wicked, saith the Lord.”

29 “Is not My word like as a fire?” saith the Lord, “and like a hammer that breaketh the rock in pieces? — is not My Word like as a fire? saith the Lord, devouring and destroying all the philosophy of men which will not stand the test of His eternal truth;

— and like a hammer that breaketh the rock in pieces? its power overcoming even the hardest and the strongest fabric of men’s imagination.

30 “Therefore behold, I am against the prophets,” saith the Lord, “that steal My words every one from his neighbor. — therefore, because the false prophets were practicing deceit and seducing the people, behold, I am against the prophets, saith the Lord, that steal My words, every one from his neighbor; they appropriated the inspired sayings of the true prophets in order to give their own oracles a show of right.

31 Behold, I am against the prophets,” saith the Lord, “that use their tongues and say, ‘He saith.’ — the Targum says, “who prophesy according to the will of their own hearts;” the Targum continues, “therefore, behold, I send my fury against the false prophets.”

32 Behold, I am against them that prophesy false dreams,” saith the Lord, “and do tell them, and cause My people to err by their lies and by their lightness; yet I sent them not, nor commanded them. Therefore they shall not profit this people at all,” saith the Lord. — behold, I am against them that prophesy false dreams, saith the Lord, or the prophetess’ false visions, insisting that the fabric of their own thoughts was to be accepted as God’s revelation, and do tell them, and cause My people, as the Lord still calls them for the sake of the true believers in their midst;

— to err by their lies and by their lightness, by their boastful and wanton inventions; yet I sent them not nor commanded them; therefore they shall not profit this people at all, saith the Lord, a most emphatic statement that their activity would result in nothing but injury to the people.

33 “And when this people or the prophet or a priest shall ask thee, saying, ‘What is the burden of the Lord?’ thou shalt then say unto them, ‘What burden? I will even forsake you, saith the Lord.’ — saying, what is the burden of the Lord? according to a custom by which the prophet was asked concerning any new revelations, which they purposely designated as an unpleasant burden, thou shalt then say unto them, What burden? 

— or, “Thou shalt tell them what the burden of Yehovah is,” namely, I will even forsake you, saith the Lord, an unloading of the burden, a rejecting of the people.

34 And as for the prophet and the priest and the people who shall say, ‘The burden of the Lord,’ I will even punish that man and his house. — and as for the prophet and the priest and the people that shall say, the burden of the Lord, in blasphemous mockery of His solemn announcement, I will even punish that man and his house, all the members of a man’s family who are guilty with him.

35 Thus shall ye say every one to his neighbor and every one to his brother, ‘What hath the Lord answered?’ and, ‘What hath the Lord spoken?’ — thus shall ye say, every one to his neighbor and every one to his brother, what hath the Lord answered? and, what hath the Lord spoken? thus showing the proper respect for the prophecy of Yehovah.

36 And the burden of the Lord shall ye mention no more, for every man’s word shall be his burden; for ye have perverted the words of the living God, of the Lord of hosts our God. — and the burden of the Lord shall ye mention no more, no more toss this expression about in mockery; for every man’s word shall be his burden, that is, this expression, if used in such a jeering sense, would become a burden to such a scorner, heavy enough to bear him down to the ground; 

— for ye have perverted the words of the living God, of the Lord of hosts, our God, whose majesty is here emphatically declared, to give added weight to His proclamation.

37 Thus shalt thou say to the prophet, ‘What hath the Lord answered thee?’ and, ‘What hath the Lord spoken?’ — what hath the Lord answered thee? and what hath the Lord spoken? this is repeated from Jeremiah 23:35; for the confirmation of it, and to show how much the Lord approved of such a way of behaving towards his prophet.

38 But since ye say, ‘The burden of the Lord,’ therefore thus saith the Lord: Because ye say this word, ‘The burden of the Lord,’ and I have sent unto you, saying, ‘Ye shall not say: The burden of the Lord,’ — for the words of God were delivered with a salutary tendency, to warn sinners of the danger of their situation, and to call them to repentance. Those, therefore, who made a right use of them would have no cause to complain. But those who despised and rejected them perverted that which should have been for their wealth into an occasion of falling.

39 therefore behold, I, even I, will utterly forget you, and I will forsake you and the city that I gave you and your fathers, and cast you out of My presence. — and the city that I gave you and your fathers; the city of Jerusalem, which he had given to them to dwell in, and their fathers before them; but now they having sinned against him, and provoked him;

— therefore, notwithstanding this grant of the place to them, and which is mentioned that they might not depend upon it, and buoy up themselves with hopes that they should be in safety on that account; as he had forsaken them, he would forsake that, and the temple in it, and give it up into the hand of the Chaldeans;

— the Targum says, “I will remove you far away, and the city which I save you and your fathers from my word;” it signifies their going into captivity.

40 And I will bring an everlasting reproach upon you, and a perpetual shame which shall not be forgotten.” — and I will bring an everlasting reproach upon you and a perpetual shame, namely, on the part of all her enemies and all the witnesses of her downfall, which shall not be forgotten; a similar fate awaits those who in our days purposely follow the lead of the false prophets and join them in jeering and mocking those who confess the truth of God’s Word.

Jeremiah 24

The list of kings of Judah towards the end; in successive reigns, as Josiah (reign 640–609), Jehoahaz (reign 609), Jehoiakim (reign 609–598), Jehoiachin or Jechonias (reign 598–597), and Zedekiah (reign 597–586).

1 The Lord showed me, and behold, two baskets of figs were set before the temple of the Lord, after Nebuchadnezzar king of Babylon had carried away captive Jeconiah the son of Jehoiakim, king of Judah, and the princes of Judah, with the carpenters and smiths, from Jerusalem and had brought them to Babylon.

One basket had very good figs, even like the figs that are first ripe; and the other basket had very bad figs, which could not be eaten they were so bad. — one basket had very good figs, being full of very fine specimens of this fruit, even like the figs that are first ripe, which were considered special delicacies; 

— and the other basket had very naughty figs, bad, unwholesome, rotten fruit, which could not be eaten, they were so bad.

Then said the Lord unto me, “What seest thou, Jeremiah?” And I said, “Figs: the good figs, very good; and the evil, very evil, that cannot be eaten they are so evil.” — then said the Lord unto me, What seest thou, Jeremiah? And I said, Figs; the good figs very good and the evil very evil, that cannot be eaten, they are so evil; the purpose of the question was to impress the lesson upon Jeremiah’s mind, to call attention to the objects which were to symbolize the Jews.

Again the word of the Lord came unto me, saying,

“Thus saith the Lord, the God of Israel: ‘Like these good figs, so will I acknowledge them that are carried away captive of Judah, whom I have sent out of this place into the land of the Chaldeans for their good. — thus saith the Lord, the God of Israel, still the God of the covenant to all who are Israelites in truth; Like these good figs, so will I acknowledge them that are carried away captive of Judah, regarding them with favor, extending His pleasure to them;

— whom I have sent out of this place into the land of the Chaldeans for their good, to let them experience His blessings, to have them realize that His method of dealing with them was for their own benefit.

For I will set Mine eyes upon them for good, and I will bring them again to this land; and I will build them and not pull them down, and I will plant them and not pluck them up. — for I will set Mine eyes upon them for good, being most attentive to their wants in this respect, and I will bring them again to this land; and I will build them and not pull them down, as a building condemned to be wrecked; 

— and led them to repentance in the land of their captivity, the result being that their condition was bettered; and I will bring them again to this land, and I will plant them and not pluck them up;

And I will give them a heart to know Me, that I am the Lord; and they shall be My people, and I will be their God; for they shall return unto Me with their whole heart. — and I will give them an heart to know Me, that I am the Lord, the punishment of the Babylonian captivity directing their minds to the one true God, who could thus carry out His threats, so that they likewise looked for mercy to Him alone;

— and they shall be My people, and I will be their God, thus restoring the original relation, which had been so rudely disturbed and made impossible by their idolatry; for they shall return unto Me with their whole heart, or, “I will be their God when they return to Me with their whole heart.”

“‘And as the evil figs, which cannot be eaten they are so evil’” — surely thus saith the Lord — “‘so will I deem Zedekiah the king of Judah, and his princes, and the residue of Jerusalem who remain in this land, and them that dwell in the land of Egypt. — and as the evil figs, which cannot be eaten they are so evil: surely thus saith the Lord, So will I give Zedekiah, the king of Judah, and his princes, all the rulers and nobles of the people;

— and the residue of Jerusalem that remain in this land, and them that dwell in the land of Egypt, the obstinate Jews, who refused to heed His warning and accept His advice to yield to the Chaldeans.

And I will deliver them to be removed into all the kingdoms of the earth for their hurt, to be a reproach and a proverb, a taunt and a curse in all places whither I shall drive them. — and I will deliver them to be removed into all the kingdoms of the earth for their hurt, literally, “I will give them for a shaking-up, for evil to all kingdoms of the earth,” so that abuse and misfortune would strike them everywhere, to be a reproach and a proverb, a taunt and a curse, in all places whither I shall drive them, they would be the object of blasphemous derision on the part of all those with whom they would come into contact.

10 And I will send the sword, the famine, and the pestilence among them till they be consumed from off the land that I gave unto them and to their fathers.’” — and I will send the sword, the famine, and the pestilence, the great scourges of all times, among them, till they be consumed from off the land, exterminated, extirpated from the Land of Promise, that I gave unto them and to their fathers;

— thus the Lord predicts further invasions and repeated sackings of Jerusalem. Thus was His curse, as uttered in the Law, Deuteronomy 28:37, carried out upon all those who refused Him obedience according to His demand, as a warning to men of all times.

~~~

More on God’s name, Yehovah.

God’s name is the four-letter Hebrew word יהוה‎ YHVH Yehovah, which are embedded in the Masoretic text over 6000 times, yet when translated into our English language most had been translated as Lord, or LORD, which are titles, but not his name. His name is יהוה‎ Yehovah, or YEHOVAH (but there are no capital letters in Hebrew).

It wasn’t until 1524 that Gian Giorgio Trissino, an Italian Renaissance grammarian, invented the letter J that this new letter started to take a hold in the writings of western Europe. Even in 1611 when the English Bible the King James has our subject of study by the prophet Jeremiah, he was known as Ieremiah. So Jehovah is a very late comer.

The following verses with the LORD erred in translation. His name Yehovah should be used:

I am the LORD; that is My name. And My glory will I not give to another, neither My praise to graven images. Isaiah 42:8

And it shall come to pass, that whosoever shall call on the name of the LORD shall be delivered; for in Mount Zion and in Jerusalem shall be deliverance, as the LORD hath said, and in the remnant whom the LORD shall call. Joel 2:32

“I am sought of them that asked not for Me; I am found of them that sought Me not. I said, ‘Behold Me, behold Me,’ unto a nation that was not called by My name. Isaiah 65:1

When we call our God, the LORD, we err, because his name is not the LORD, which is a title. His name is YEHOVAH! May We all ask for his forgiveness, and may Our merciful God forgive us all.

Jeremiah (Ch 21-22)

•November 11, 2021 • 3 Comments

Pashur, the son of Malchiah, was a priest, who was sent by king Zedekiah to Jeremiah to inquire of the Lord regarding the impending attack of King Nebuchadnezzar II of Babylon (Jeremiah 21:1). Pashur was also the captain, or overseer of the temple during Zedekiah’s reign. In this capacity as captain of the temple he had power to arrest and put in prison any who caused any disturbance in the temple.

In Jeremiah 38:1-6, this Pashur was also one of four men who advised Zedekiah to put Jeremiah to death for his prophecies of doom but who ended up throwing him into a cistern.

The list of kings of Judah towards the end; in successive reigns, as Josiah (reign 640–609), Jehoahaz (reign 609), Jehoiakim (reign 609–598), Jehoiachin or Jechonias (reign 598–597), and Zedekiah (reign 597–586).

Jeremiah 21

1 The word which came unto Jeremiah from the Lord when King Zedekiah sent unto him Pashhur the son of Melchiah, and Zephaniah the son of Maaseiah the priest, saying, — Pashur, the son of Malchiah, was a priest, who was sent by king Zedekiah to Jeremiah to inquire of the Lord regarding the impending attack of King Nebuchadnezzar II of Babylon (Jeremiah 21:1). In Jeremiah 38:1-6, this Pashur was also one of four men who advised Zedekiah to put Jeremiah to death for his prophecies of doom but who ended up throwing him into a cistern.

— and Zephaniah the son of Maaseiah the priest; who was of the “twenty fourth” course; see 1 Chronicles 24:9; in Jeremiah 52:24, he is called the “second priests” like Pashhur; or “sagan”, or deputies to the high priest.

“Inquire, I pray thee, of the Lord for us (for Nebuchadnezzar king of Babylon maketh war against us), if so it be that the Lord will deal with us according to all His wondrous works, that he may go up from us.” — for Nebuchadnezzar king of Babylon maketh war against us; the same that is elsewhere called Nebuchadnezzar, who was on his way up to Jerusalem, and was besieging it, as had been predicted;

— if so be the Lord will deal with us according to all his wondrous works; which God had done in times past for that nation; as by bringing them out of Egypt; driving out the Canaanites before them; delivering them out of the hands of their neighbours, time after time; and particularly by destroying the Assyrian army in Hezekiah’s time, which was besieging the city of Jerusalem, and causing their king to depart and flee in haste; and their present case being similar to that, it is very likely that that was more especially in view;

— that he may go up from us; namely, the king of Babylon; that he may rise up, and raise the siege, and depart into his own country, as Sennacherib did.

Then said Jeremiah unto them, “Thus shall ye say to Zedekiah, — then said Jeremiah unto them… the two priests, Pashur and Zephaniah, after he had sought the Lord, and knew his mind and will: thus shall ye say to Zedekiah; by whom they were sent.

‘Thus saith the Lord God of Israel: Behold, I will turn back the weapons of war that are in your hands, wherewith ye fight against the king of Babylon and against the Chaldeans, who besiege you outside the walls; and I will assemble them into the midst of this city. — behold, I will turn back the weapons of war that are in your hands; they shall hurt yourselves, and be the occasion of your own destruction; so that they would not hurt their enemy, but recoil upon themselves; or like a boomerang;

— the meaning is, that they should be useless and unserviceable; that they should neither be defensive to them, nor offensive to their enemies; but rather hurtful to themselves. It seems to suggest, as if they should fall out with one another; and turn their swords upon one another, and destroy each other; that is, civil wars among themselves;

— wherewith ye fight against the king of Babylon and against the Chaldeans which besiege you without the walls; by shooting arrows at them from outside the walls; or by sallying within the city with swords in hand: this shows that the Chaldean army under the command of the king of Babylon was now just outside the walls of Jerusalem, besieging it;

— and I will assemble them into the midst of this city; God himself will assemble the Chaldean army, which when breaking into the city, should cause the inhabitants of Jerusalem to be brought in to them in the middle of the city, and there slay them; or, so that its defenders, who were still attempting to repel the invaders outside the walls, would be compelled to take refuge in the center of the city, their weapons having proved powerless against the enemy.

And I Myself will fight against you with an outstretched hand and with a strong arm, even in anger and in fury and in great wrath. — and I Myself will fight against you with an outstretched hand and with a strong arm, exhibiting His almighty power in punishing them, like the way he destroyed the Egyptian army;

— with an outstretched hand, and with a strong arm; such as he had used formerly in delivering Israel out of Egypt, but now in delivering them into the hands of their enemies; see Exodus 6:6;

— even in anger and in fury and in great wrath; because of their sins and iniquities, this heap of words is used to show the depth of his indignation: this was not the chastisement of a father, but the rebuke of an enemy in hot displeasure; a punishment inflicted in vindictive wrath by a righteous Judge, appearing in a warlike manner.

And I will smite the inhabitants of this city, both man and beast; they shall die of a great pestilence. — and I will, that is, God himself will smite the inhabitants of this city Jerusalem, both man and beast, not the Chaldean army.

And afterward, saith the Lord, I will deliver Zedekiah king of Judah, and his servants and the people and such as are left in this city from the pestilence, from the sword, and from the famine into the hand of Nebuchadnezzar king of Babylon, and into the hand of their enemies, and into the hand of those that seek their life. And he shall smite them with the edge of the sword; he shall not spare them, neither have pity nor have mercy.’ — I will deliver Zedekiah king of Judah, and his servants; the king himself shall not escape; though he shall not die by the pestilence or famine or sword, yet he shall fall into the hands of the Chaldeans, and also “his servants” his courtiers and counsellors;

— he shall smite them with the edge of the sword; that is, Nebuchadnezzar king of Babylon, or, whoever the army under his command; for what was done by the one is ascribed to the other: this is to be understood of such that fell into their hands upon taking the city, and who endeavoured to make their escape; Jeremiah 39:4;

— he shall not spare them, neither have pity, nor have mercy; they had no regard to rank or figure, to age or sex; the sons of the king were slain before his eyes, and then his eyes were put out; princes were hanged up by the hand; and no compassion shown to old or young, man or maiden; Jeremiah 52:10.

“And unto this people thou shalt say, ‘Thus saith the Lord: Behold, I set before you the way of life and the way of death. — behold, I set before you the way of life, and the way of death; the way how to preserve their lives; and which, if they did not choose to take, would be inevitable death. The allusion seems to be to a phrase used by Moses, when he gave the law; obedience to which would issue in life, and disobedience in death, Deuteronomy 30:15.

He that abideth in this city shall die by the sword and by the famine and by the pestilence; but he that goeth out and falleth to the Chaldeans who besiege you, he shall live, and his life shall be unto him as a prey. — he shall live; that is, surrender themselves unto the Chaldeans; submit to them, so as to obey them, and ye shall live.

10 For I have set My face against this city for evil and not for good, saith the Lord. It shall be given into the hand of the king of Babylon, and he shall burn it with fire.’ — and he shall burn it with fire; as he did, both the house of the Lord in it, the temple, the king’s house or palace, the stately houses of the princes and nobles, and even the houses of all the people; Jeremiah 52:13.

11 “And concerning the house of the king of Judah, say, ‘Hear ye the word of the Lord,

12 O house of David. Thus saith the Lord: “‘Execute judgement in the morning, and deliver him that is despoiled out of the hand of the oppressor, lest My fury go out like fire and burn, that none can quench it, because of the evil of your doings. — O house of David, whose descendants were still occupying the throne of Judah;

— execute judgement in the morning; be at it early, and dispatch it speedily; and do not delay it to the prejudice of persons concerned. The power of judgement with the Jews belonged to the king; he was supreme judge in their courts; they judged, and were judged, the Jews say by whom judgement was executed in a morning, and not in any other part of the day; and the case judged ought, as they say, to be as clear as the morning;

— lest my fury go out like fire, and burn that none can quench it; or put a stop to it, by all their prayers and entreaties, or by all that they can say or do;

— because of the evil of your doings; it is a sad thing when princes set bad examples; it is highly provoking to God, whose deputies they are; and to lead the people on, or they cannot expect safety for themselves and their people.

13 Behold, I am against thee, O inhabitant of the valley and rock of the plain, saith the Lord, who say, “Who shall come down against us? Or who shall enter into our habitations?” — O inhabitant of the valley and rock of the plain, saith the Lord; a description of Jerusalem; between the lower and higher part of which lay a valley, called Tyropaeon, which divided the two hills, on which the city was built; yea, the whole city was on high, on a rock, and around it a valley or plain; and because it was built upon a rock, and fortified with hills and mountains, the inhabitants of it thought themselves safe and secure, and even impregnable;

— which say, who shall come down against us? who shall enter into our habitations? who of our neighbours dare to make an attack upon us? they are so weak and would be foolish in any attempt to break through our fortifications, natural and artificial, and enter into our houses, and take away our possessions, and spoil us of our goods?

14 But I will punish you according to the fruit of your doings, saith the Lord; and I will kindle a fire in the forest thereof, and it shall devour all things round about it.’” — and I will kindle a fire in the forest thereof; not in the forest of Lebanon, but in the city of Jerusalem; whose houses stood as thick as trees in a forest, and which many of them, at least the most stately, might be built or ceiled with cedars from Lebanon; though some understand this of the cities and towns about Jerusalem;

— and so the Targum renders it, “in its cities” and it shall devour all things round about it; the mountains and trees upon them, the cities and towns adjacent.

Jeremiah 22

The list of kings of Judah towards the end; in successive reigns, as Josiah (reign 640–609), Jehoahaz (reign 609), Jehoiakim (reign 609–598), Jehoiachin or Jechonias (reign 598–597), and Zedekiah (reign 597–586).

Thus saith the Lord: “Go down to the house of the king of Judah, and speak there this word

and say, ‘Hear the word of the Lord, O king of Judah, who sittest upon the throne of David, thou and thy servants and thy people who enter in by these gates. — thus saith the Lord, go down to the house of the king of Judah… to the palace of Jehoiakim, who was now the reigning king; the prophet is bid to go down to it, because he was now upon the mountain of the house, or in the temple, from whence to the king’s house there was a descent;

— during the reign of Jehoiakim, Jeremiah 22:18; if so this would be a flashback of about 20 years; but why is this a flashback, from king Zedekiah back to king Jehoiakim, to have a rerun? Perhaps relaying more details into their abominations?

Thus saith the Lord: Execute ye judgement and righteousness, and deliver the despoiled out of the hand of the oppressor, and do no wrong. Do no violence to the stranger, the fatherless nor the widow, neither shed innocent blood in this place. — thus saith the Lord, execute ye judgment and righteousness… judge righteous Judgement; give the cause to whom it belongs, without respect of persons, and without a bribe or corruption; do no unrighteousness to any, by withholding from them what is due unto them, which was what this prince was chargeable with, Jeremiah 22:13;

— and do no wrong, do no violence to the stranger, the fatherless, nor the widow: or those in similar situation, or in such a condition and circumstances as to defend themselves; and whom God has a peculiar regard unto; and therefore they who are his deputies and vicegerents, as kings and civil magistrates are ought to protect such persons, and neither grieve and injure them, nor suffer others to do it;

— neither shed innocent blood in this place; to grieve and wrong the above persons is a very great evil, but to shed the blood of innocent per tons is greater still; and this is aggravated by being committed by such who are set over men to secure and preserve their laws, properties and their lives; and such heinous sins as these the present reigning king of Judah was guilty of; which is the reason of their being mentioned; Jeremiah 22:17.

For if ye do this thing indeed, then shall there enter in by the gates of this house kings sitting upon the throne of David, riding in chariots and on horses, he and his servants and his people. — the context here shows, that the prophecy is directed, not only to the king’s court in particular, but likewise to the whole city of Jerusalem, one part of which was called the city of David; and the whole looked upon as a royal city, kings sitting upon the throne of David;

— the Targum says, “by my word I swear:” that this house shall become a desolation; meaning not the temple, nor the city, but the king’s palace.

For thus saith the Lord unto the king’s house of Judah: “Thou art Gilead unto Me, and the head of Lebanon; yet surely I will make thee a wilderness, and cities which are not inhabited. — yet surely I will make thee a wilderness, and cities which are not inhabited; though as fruitful as Gilead, yet shall become like a barren desert; and though full of children, courtiers, princes, and nobles, yet shall be like cities quite depopulated.

And I will prepare destroyers against thee, every one with his weapons; and they shall cut down thy choice cedars and cast them into the fire. — they shall cut down thy choice cedars, and cast them into the fire; the sons of the king, the princes of the blood, the nobles of the land, and other persons of rank and distinction, comparable to the tall cedars of Lebanon;

— so the Targum says “and they shall slay the beauty of thy mighty ones, as the trees of a forest are cut down, and cast into the fire;”

— or else the stately palaces of the king and his nobles, and other beautiful buildings, which were lined and ceiled with cedar, are here meant; and which the Chaldeans burnt with fire, Jeremiah 52:13.

“And many nations shall pass by this city, and they shall say every man to his neighbor, ‘Why hath the Lord done thus unto this great city?’ — wherefore hath the Lord done thus unto this great city? so fortified and so full of people; the metropolis of the whole nation; the greatest city in the east; yea, the joy of the whole earth; a city peculiarly dear to the Lord; greatly honoured by him with his presence, worship, and ordinances, and yet now in ruins;

— how comes this to pass? they see and acknowledge the hand of the Lord in it, having a better notion of things than the Jews themselves had.

Then they shall answer, ‘Because they have forsaken the covenant of the Lord their God, and worshiped other gods and served them.’” — as the Targum says; they left the true God, who had done great and good things for them, and worshipped those who were only gods by name, and not by nature; and served stocks and stones.

10 Weep ye not for the dead, neither bemoan him, but weep sore for him that goeth away; for he shall return no more, or see his native country. — weep ye not for the dead, so Jeremiah admonished the people of Judah, neither bemoan him, namely, Josiah, the last good king, who had stayed the doom pronounced upon the reprobate people;

— but weep sore for him that goeth away, whose departure in this case is truly an occasion for great sorrowing, for he shall return no more nor see his native country, being dragged into a shameful exile, from which there would be no deliverance.

11 For thus saith the Lord concerning Shallum the son of Josiah king of Judah, who reigned instead of Josiah his father, who went forth out of this place: “He shall not return thither any more, — for thus saith the Lord touching Shallum… he was Shallum the fourth son of Josiah, 1 Chronicles 3:15; for it was likely that he should immediately succeed his father Josiah, after he was shot by archers during the battle against Neco of Egypt, where died upon his arrival on Jerusalem;

— Or, Josiah’s successor is Shallum indeed, the fourth son of Josiah; but that he was more commonly known as Jehoahaz; it seems probable that Shallum was his name before he ascended the throne, and that he changed it for Jehoahaz during his short reign;

— And the sons of Josiah were the firstborn Johanan, the second Jehoiakim, the third Zedekiah, the fourth Shallum, 1 Chronicles 3:15.

12 but he shall die in the place whither they have led him captive and shall see this land no more. — Shallum or Jehoahaz reigned only for 3 months before being deposed by the Egyptian Pharaoh Necho II and taken into Egyptian captivity and died there.

13 “Woe unto him that buildeth his house by unrighteousness and his chambers by wrong, that useth his neighbor’s service without wages, and giveth him nought for his work, — woe unto him, so the Lord now proceeds to call out upon Jehoiakim, the next king, that buildeth his house by unrighteousness, by unjust measures, by impressing people into work without compensation, that useth his neighbor’s service without wages.

14 that saith, ‘I will build me a wide house and large chambers, and cutteth him out windows, and it is ceiled with cedar and painted with vermilion.’

15 Shalt thou reign because thou enclosest thyself in cedar? Did not thy father eat and drink, and do judgement and justice, and then it was well with him? — shalt thou reign because thou closest thyself in cedar? making a show of wealth which he did not in reality possess and had no right to parade. Did not thy father eat and drink, enjoying the ordinary comforts of life;

— and do judgement and justice? exercising these two virtues according to the demands of righteousness. And then it was well with him, the blessing of the Lord resting upon him for his upright behavior.

16 He judged the cause of the poor and needy; then it was well with him. Was not this to know Me?” saith the Lord. — the Targum says, “is not this the knowledge with which I am well pleased? saith the Lord.”

17 “But thine eyes and thine heart are for nothing but thy covetousness and to shed innocent blood, and for oppression and for violence.” — but thine eyes and thine heart are not but for thy covetousness, being directed only to the gaining of his own advantage, regardless of the rights of other people, and for to shed innocent blood and for oppression and for violence to do it, Jehoiakim thus proving himself a tyrant in every sense of the word.

18 Therefore thus saith the Lord concerning Jehoiakim the son of Josiah, king of Judah: “They shall not lament for him, saying, ‘Ah, my brother!’ or, ‘Ah, sister!’ They shall not lament for him, saying, ‘Ah, lord!’ or, ‘Ah, his glory!’ — they shall not lament for him; these words contrast the death as well as the life of Jehoiakim with that of Josiah. For him there should be no lamentation such as was made for the righteous king (II Chronicles 35:25), therefore thus saith the Lord concerning Jehoiakim… this shows who is before spoken of and described; Jehoiakim, the then reigning king in Judah, whose name was Eliakim, but was changed by Pharaoh king of Egypt, when he deposed his brother Jehoahaz or Shallum, and set him on the throne, II Kings 23:34;

— saying, ah my brother! or, ah sister!  that is, “Alas, His Majesty!” a woman meeting her brother would not say to him, O my brother, what bad news is this! we have lost our king! nor he reply to her, O sister, it is so, the loss is great indeed!

— Against him came up Nebuchadnezzar, king of Babylon, and bound him (Jehoiakim) in fetters (a chain around the ankles) to carry him to Babylon, II Chronicles 36:6.

19 He shall be buried with the burial of an ass, drawn and cast forth beyond the gates of Jerusalem.

20 “Go up to Lebanon and cry, and lift up thy voice in Bashan, and cry from the Abarim; for all thy lovers are destroyed. — for all thy lovers are destroyed; their friends and allies, with whom they had not only entered into leagues, but had committed spiritual fornication with them; that is, idolatry, as the Egyptians and Assyrians; but these were now subdued by Nebuchadnezzar, and were at least so weakened and destroyed by him, that they could give no assistance to the Jews; see II Kings 24:7.

21 I spoke unto thee in thy prosperity, but thou saidst, ‘I will not hear.’ This hath been thy manner from thy youth, that thou obeyedst not My voice. — this hath been thy manner from thy youth; from the time they came out of Egypt, while they were in the wilderness; or when first settled in the land of Canaan: this was the infancy of their state; and from that time it was their manner and custom to reject the word of the Lord, and turn a deaf ear to it.

22 The wind shall eat up all thy shepherds, and thy lovers shall go into captivity; surely then shalt thou be ashamed and confounded for all thy wickedness. — the Targum says, “all thy governors shall be scattered to every wind;” and thy lovers shall go into captivity: the Assyrians and Egyptians, as before; see Jeremiah 52:31.

23 O inhabitant of Lebanon, that makest thy nest in the cedars, how gracious shalt thou be when pangs come upon thee, the pain as of a woman in travail? — O inhabitant of Lebanon, that makest thy nest in the cedars, this picture being chosen because, as the birds of Lebanon make their nests in the cedars, so the princes of Judah built their homes of the cedars of Lebanon;

— how gracious shall thou be, rather, “how shalt thou moan,” when pangs come upon thee, the pain as of a woman in travail! After this digression with its warning to the people as a whole the prophet turns to the consideration of Jehoiachin’s fate.

24 “As I live,” saith the Lord, “though Coniah the son of Jehoiakim, king of Judah, were the signet upon My right hand, yet would I pluck thee thence; — were the signet upon my right hand; ever so near to him, or ever so much valued by him, as he had been before, and so constantly cared for and regarded by him; as a ring, with anything respectable engraved on it, is constantly wore by persons, and greatly valued.

25 and I will give thee into the hand of those who seek thy life, and into the hand of those whose face thou fearest, even into the hand of Nebuchadnezzar king of Babylon, and into the hand of the Chaldeans. — and I will give thee into the hand of them that seek thy life… cruel and bloodthirsty enemies, whom nothing would satisfy but his life; such were the persons following;

— and into the hand of them whose face thou fearest: being a terrible savage people, to be dreaded both for their number and their cruelty; a strange change this, to be removed out of the hand of God into the hand of such an enemy; even into the hand of Nebuchadnezzar king of Babylon.

26 And I will cast thee out, and thy mother who bore thee, into another country where ye were not born, and there shall ye die.

27 But to the land whereunto they desire to return, thither shall they not return.”

28 Is this man Coniah a despised, broken idol? Is he a vessel wherein is no pleasure? Why are they cast out, he and his seed, and are cast into a land which they know not?

29 O earth, earth, earth, hear the word of the Lord! — O earth, earth, earth… either the inhabitants of the whole earth, or of the land of Israel; or rather the earth, on which men dwell, is here called upon as a witness to what is after said;

— to rebuke the stupidity of the people, and to quicken their attention to somewhat very remarkable and worthy of notice, and therefore the word is repeated three times;

— so the Targum says, “out of his own land they carried him captive into another land; O land of Israel, receive the words of the Lord,”

— Rashi mentions another reason of this threefold appellation, because the land of Israel was divided into three parts: Judea, beyond Jordan, and Galilee.

30 Thus saith the Lord: “Write ye this man as childless, a man that shall not prosper in his days; for no man of his seed shall prosper, sitting upon the throne of David and ruling any more in Judah.” — thus saith the Lord, write ye this man childless… that is, Coniah, or Jeconiah; who though he had children in the captivity, yet they died in it, or however never succeeded him in the throne;

— this, to show the certainty of the thing, the Lord would have written. The speech is directed to the prophets; though the words may be rendered impersonally, “let this man be written childless”, it may be set down, and taken for a sure and certain thing, as though it was written with a pen of iron, that he shall be alone, and die without children, and have none to reign after him.

Jeremiah (Ch 19-20)

•November 10, 2021 • Leave a Comment

Chapter 19 is foreshadowed, represented, and confirmed the destruction of Jerusalem, by the breaking of a potter’s vessel the prophet had in his hand; and by the place where he was bid to do this, and did it.

Jeremiah 19

1 Thus saith the Lord: “Go and get a potter’s earthen bottle, and take some of the elders of the people and the elders of the priests. — the prophet was to get or buy a earthen bottle and take the elders and the priests; those who were the greatest and principal men of the city, which include members of the Sanhedrin, and to go with the prophet to be witnesses of what were said and done, and to see the bottle broke.

And go forth unto the Valley of the Son of Hinnom, which is by the entry of the East Gate, and proclaim there the words that I shall tell thee, — which is by the entry of the east gate; the way into and out of Jerusalem, which lay through the east gate of the city;

— the Targum calls it “the dung gate” through which the filth of the city was carried out, and laid near it.

and say, ‘Hear ye the word of the Lord, O kings of Judah and inhabitants of Jerusalem. Thus saith the Lord of hosts, the God of Israel: Behold, I will bring evil upon this place, of which whosoever heareth, his ears shall tingle. — behold, I will bring evil upon this place; the evil of punishment for the evil of sin; such as the sword, famine and captivity; meaning not on that spot of ground where the prophet with the elders were, but upon the city of Jerusalem and upon all the land of Judea.

Because they have forsaken Me and have estranged this place, and have burned incense in it unto other gods, whom neither they nor their fathers nor the kings of Judah have known, and have filled this place with the blood of innocents. — and have filled this place with the blood of innocents; young children that were sacrificed to idols, as they were in the valley of Hinnom, which seems to be the place principally intended; so that they were not only guilty of idolatry, but of murder; and of the murder even their own babes; cruelty which was shocking and unheard of!

They have built also the high places of Baal, to burn their sons with fire for burnt offerings unto Baal, which I commanded not nor spoke it, neither came it into My mind. — to burn their sons with fire unto Baal; from this as well as from some other places, it is plain that they slew and burned human victims to Baal as well as to Moloch; if these two names were not given, as some suppose they were, to one and the same idol.

Therefore behold, the days come, saith the Lord, that this place shall no more be called Tophet, nor the Valley of the Son of Hinnom, but the Valley of Slaughter. — that this place shall no more be called Tophet: as it had been, from the beating of drums in it, that the cries and shrieks of infants burnt in the fire might not be heard by their parents;

— nor the valley of the son of Hinnom; which was its name in the times of Joshua, and long before it was called Tophet; but now it should have neither names;

— but the valley of slaughter; or, “of the slain” as the Targum says; from the multitude of those that should be killed here, at the siege and taking of Jerusalem; or that should be brought hither to be buried.

And I will make void the counsel of Judah and Jerusalem in this place, and I will cause them to fall by the sword before their enemies and by the hands of them that seek their lives; and their carcasses will I give to be meat for the fowls of the heaven and for the beasts of the earth. — and I will make void the counsel of Judah and Jerusalem in this place… the counsel which they took in this place and agreed to, in offering their sons and daughters to idols; and which they took with these idols and their priests;

— and I will cause them to fall by the sword before their enemies: such as sallied out from the city, or attempted to make their escape;

— and by the hands of them that seek their lives; and so would not spare them, when they fell into them;

— and their carcasses will I give to be meat for the fowls of the heaven, and for the beasts of the earth: signifying that they should have no burial, but their slain bodies should lie upon the earth, and be fed upon by fowls and beasts.

And I will make this city desolate and a hissing. Every one that passeth thereby shall be astonished and hiss, because of all the plagues thereof. — and I will make this city desolate, and an hissing… an hissing to its enemies; an hissing because it was desolate; when its walls should be broken down, its houses burnt with fire, and its inhabitants put to the sword, or carried away as captives;

— everyone that passeth thereby shall be astonished, and hiss; surprised to see its desolation; that a city once so famous and flourishing should be reduced to such a miserable condition; and yet hiss by way of detestation and abhorrence of it, and others for joy at its ruin;

— because of all the plagues thereof: by which it was brought to desolation, as the sword, famine, burning, and captivity.

And I will cause them to eat the flesh of their sons and the flesh of their daughters, and they shall eat every one the flesh of his friend in the siege and straits with which their enemies and they that seek their lives shall straiten them.’ — and I will cause them to eat the flesh of their sons, and the flesh of their daughters… for want of food; the famine should be so great and pressing. Jeremiah, that foretells this, was a witness of it, and has left it on record, Lamentations 4:10;

— and they shall eat everyone the flesh of his friend; the Targum interprets it, the goods or substance of his neighbour; which is sometimes the sense of eating the flesh of another; as it is to be taken in a literal sense;

— in the siege by their enemies, they that seek their lives shall straiten them; the siege of Jerusalem would be so severe, that no provision could be carried into the city for the relief of its inhabitants;

— though this was fulfilled at the Babylonish captivity, yet more fully when Jerusalem was besieged by Vespasian and Titus, and in the times of Hadrian. Josephus q gives us a most shocking scene of a woman eating her own son.

10 “Then shalt thou break the bottle in the sight of the men that go with thee,

11 and shalt say unto them, ‘Thus saith the Lord of hosts: Even so will I break this people and this city, as one breaketh a potter’s vessel that cannot be made whole again; and they shall bury them in Tophet till there be no place to bury. — and they shall bury them in Tophet, till there be no place: where there should be such great numbers slain; or whither such multitudes of the slain should be brought out of the city to be buried there, that at length there would not be room to receive any more dead;

— or, as the Syriac version renders it, “and in Tophet they shall bury, for want of a place to bury” in; in such a filthy, abominable, and accursed place shall their carcasses lie, where they were guilty of idolatry, and sacrificed their innocent babes, there being no other place to bury them.

12 Thus will I do unto this place, saith the Lord, and to the inhabitants thereof, and even make this city as Tophet. — make this city as Tophet; as full of slaughtered men and women as that had been of the blood of innocent children; and as filthy, abominable and execrable a place as that; and to lose its name as that is foretold it should, Jeremiah 19:6; and as Jerusalem did, after the desolation of it by Hadrian.

13 And the houses of Jerusalem and the houses of the kings of Judah shall be defiled as the place of Tophet, because of all the houses upon whose roofs they have burned incense unto all the host of heaven, and have poured out drink offerings unto other gods.’” — and the houses of the kings of Judah; the palaces of the king, princes, and nobles of Judah, one as well as their relatives;

— shall be defiled os Tophet; as that was defiled with the bodies and bones of the slain, and with the faith of the city brought unto it; so the houses of great and small, high and low, should be defiled with the carcasses of the slain that should lie unburied there; their houses should be their graves, and they buried in the ruins of them;

— or, “the houses of Jerusalem, and the houses of the kings of Judah, which are defiled” with the idolatries after mentioned, shall be as Tophet, places of slaughter.

14 Then came Jeremiah from Tophet, whither the Lord had sent him to prophesy; and he stood in the court of the Lord’S house and said to all the people, — and he stood in the court of the Lord’s house, and said to all the people; this was the court of the temple, called the outward court, or the court of the Israelites, where all the people met;

— here the prophet placed himself, on purpose to deliver his prophecy to all the people; even the same as he had delivered at Tophet to the people and the priests.

15 “Thus saith the Lord of hosts, the God of Israel: ‘Behold, I will bring upon this city and upon all her towns all the evil that I have pronounced against it, because they have hardened their necks, that they might not hear My words.’” — all the evil that I have pronounced against it; or decreed against it, as the Targum says; all that he had purposed, and all that he had threatened, or spoke of by Jeremiah, for whatever he has said he will do, and whatsoever he has solved upon, and declared he will do, God will assuredly bring to pass;

— because they have hardened their necks, that they might not hear his words; they turned their backs upon him, pulled away the shoulder, stopped their ears that they might not hear what was said by the prophets from the Lord; they neither inclined their ears to hearken to, nor bowed their necks to receive the yoke of his precepts;

— but, on the contrary, as was their general character, a stiffnecked people and uncircumcised in heart and ears, obstinate and disobedient; and this was the cause of their ruin, by which it appeared to be just and righteous.

Jeremiah 20

Pashur, the son of Malchiah, was a priest, who was sent by king Zedekiah to Jeremiah to inquire of the Lord regarding the impending attack of King Nebuchadnezzar II of Babylon (Jeremiah 21:1). In Jeremiah 38:1-6, this Pashur was also one of four men who advised Zedekiah to put Jeremiah to death for his prophecies of doom but who ended up throwing him into a cistern.

1 Now Pashhur the son of Immer the priest, who was also chief governor in the house of the Lord, heard that Jeremiah prophesied these things. — Pashur was not a high-priest, but only captain, or overseer of the temple. In this capacity he had power to arrest and put in prison the false prophets, and those who caused any disturbance in the temple;

— Pashur was, it seems a distant son of, and the head of the course of Immer, the sixteenth course of the priests fell by lot of of 24 courses 1 Chronicles 24:14; this Pashur was the son of Malchiah, (Jeremiah 21:1);

— the Targum calls him the “sagan” of the priests. There was such an officer, who was called the “sagan” or deputy to the high priest, who upon certain occasions acted for him; and some think that this man was in the same office; though others take him to be the same with the captain of the temple, Acts 4:1

Then Pashhur smote Jeremiah the prophet, and put him in the stocks that were in the High Gate of Benjamin, which was by the house of the Lord. — then Pashur, by virtue of the police- and judicial power vested in him, which he believed he must exercise in this instance, smote Jeremiah, the prophet, whose office is here purposely mentioned, and put him in the stocks, a five-holed instrument of torture in which the neck, the two hands, and the two feet were thrust.

And it came to pass on the morrow that Pashhur brought forth Jeremiah out of the stocks. Then said Jeremiah unto him, “The Lord hath not called thy name Pashhur, but Magormissabib [that is, Fear round about]. — but Magormissabib; or, “fear round about”; signifying that terrors should be all around him, and he should be in the utmost fright and consternation;

— the Targum says, “but there shall be gathered together against thee those that kill with the sword round about;” meaning the Chaldeans, which would make him a “Magormissabib” – changing from place to place; that is, going into captivity; a stranger and wanderer.

For thus saith the Lord: ‘Behold, I will make thee a terror to thyself and to all thy friends; and they shall fall by the sword of their enemies, and thine eyes shall behold it; and I will give all Judah into the hand of the king of Babylon, and he shall carry them captive into Babylon and shall slay them with the sword. — for thus saith the Lord, behold, I will make thee a terror to thyself, and to all thy friends… this is an interpretation of the name given, “Magormissabib” and shows that it was not a mere name he had, but that he should be what that signifies;

— his conscience should be filled with terror at the judgements of God coming upon him for his sins; and which could not be concealed from others, but he should be seized with such tremblings and shakings, and be such a spectacle of horror, that his own familiar friends, instead of delighting in his company, should shun and run away from him.

Moreover I will deliver all the strength of this city and all the labors thereof, and all the precious things thereof, and all the treasures of the kings of Judah will I give into the hand of their enemies, who shall despoil them and take them and carry them to Babylon. — and all the precious things thereof; all their plate and jewels, the rich furniture of their houses, and whatsoever was laid up in their treasures as rare and valuable;

— and all the treasures of the kings of Judah will I give into the hand of their enemies; which they in successive reigns had been laying up in store for years together; see Isaiah 39:6.

And thou, Pashhur, and all that dwell in thine house shall go into captivity; and thou shalt come to Babylon, and there thou shalt die and shalt be buried there, thou and all thy friends to whom thou hast prophesied lies.’” — and thou, Pashur, and all that dwell in thine house, shall go into captivity… particularly he and his family should not escape;

— and thou shalt come to Babylon; though sore against thy will: and there thou shalt die, and shalt be buried there; even in a defiled land, and to be buried in such a land;

— to whom thou hast prophesied lies; not only because he had so ill used Jeremiah, a true prophet of the Lord; but because he was a false prophet, and his friends had hearkened to his lies, and disbelieved those prophecies that came from the Lord himself.

O Lord, Thou hast deceived me, and I was deceived; Thou art stronger than I, and hast prevailed. I am in derision daily; every one mocketh me. — O Lord, thou hast deceived me, and I was deceived… what follows from hence to the end of the chapter is thought to have been said by the prophet, when in the stocks, or in prison, and shows mixture of courage and weakness in him; a struggle between flesh and spirit, and the force of a temptation under which he laboured, arising from difficulties and discouragements in his work; and he not only complains to God, but of him; that he had deceived him;

— when he first called him to be a prophet, by telling him that he should be set over nations and kingdoms, to pull them down, Jeremiah 1:10; which he understood of foreign nations, but now found his own people were meant;

— or by giving him reason to expect honour and ease, whereas he met with nothing but disrespect and trouble; and that he should have divine protection and success against his opposers, Jeremiah 1:18; whereas he was now delivered into their hands, and used in the most reproachful manner; but be it so, this was all a mistake of the prophet, and no deception of God;

— I am in derision daily, everyone mocketh me; he was the laughing stock of everyone of the people of Israel, from the highest to the lowest; princes, priests, and people, all derided him and his prophecies, and that continually, every day, and all the day long, and especially when he was in the stocks; though it was not only his person they mocked, but the word of the Lord by him, as appears from Jeremiah 20:8.

For when I spoke, I cried out; I cried, “Violence and despoliation!” because the word of the Lord was made a reproach unto me and a derision daily. — because the word of the Lord was made a reproach unto me, and a derision daily; which is a reason either why he cried with grief and sorrow; or why he cried violence and spoil, ruin and destruction: or, “though the word of the Lord was” yet he went on proclaiming it;

— or, “surely the word of the Lord was made a reproach” either because of the matter of it, it not being believed, or the manner in which it was delivered; or because it was not immediately fulfilled.

Then I said, “I will not make mention of Him, nor speak any more in His name.” But His word was in mine heart as a burning fire shut up in my bones; and I was weary with forbearing, and I could not hold back. — then I said, I will not make mention of him, nor speak any more in his name… not that he publicly said this before his enemies, or privately to his friends, but he said it in his heart; he thought, nay, resolved, within himself, to prophesy no more; since no credit was given to him, but contempt cast on him;

— “there was in mine heart as a burning fire” which made him uneasy, and constrained him to break his former resolution: for the phrase, “his word” is not in the original text; though it is in like manner supplied by the Targum, “and his words became in mine heart as fire burning and overflowing my bones;” or, “and the word of the Lord was in my heart as fire burning;” or Rashi says prophecy was as fire, to which it is compared, Jeremiah 23:29.

10 For I heard the defaming of many, fear on every side. “Report,” say they, “and we will report it!” All in my company watched for my halting, saying, “Perhaps he will be enticed, and we shall prevail against him; and we shall take our revenge on him.” — for I heard the defaming of many, as they talked about him and his office in a derogatory manner: Fear on every side, or, “Terror round about!” an attempt to deride the prophecy against Pashur;

— report, say they, and we will report it, that is, they want people to bring any sort of accusation against Jeremiah, and they would immediately act upon such information in bringing the matter to the attention of the authorities and having him punished. All my familiars, men who enjoyed his confidence, whom he considered his friends, watched for my halting, for any indication of stumbling on his part, saying, 

— perhaps he will be enticed, be induced to commit some sin, and we shall prevail against him, getting the better of Jeremiah in this situation, and we shall take our revenge on him. Over against this behavior of his false friends the prophet states the firm conviction of his heart.

11 But the Lord is with me as a mighty, fearsome one; therefore my persecutors shall stumble, and they shall not prevail. They shall be greatly ashamed, for they shall not prosper; their everlasting confusion shall never be forgotten. — but the Lord is with me as a mighty terrible one, as a mighty hero to defend him; 

— therefore my persecutors shall stumble, come to grief in the very way in which they hoped to see the prophet humbled, and they shall not prevail, as they had hoped to; they shall be greatly ashamed, for they shall not prosper, have no success in their plotting and scheming against him; 

— their everlasting confusion shall never be forgotten, they would be heaped with eternal disgrace, the ignominy of which would attach to them forever. This confidence on the part of Jeremiah now finds expression in a fervent appeal to the Lord to take his part and defend his cause.

12 But, O Lord of hosts, who triest the righteous and seest the reins and the heart, let me see Thy vengeance on them, for unto Thee have I opened my cause. — let me see thy vengeance on them; his enemies and persecutors; he does not seek vengeance himself, but desires it of the Lord;

— he does not ask to see his vengeance, but the Lord’s vengeance on them, what he thought was just and proper to inflict on them; he knew that vengeance belonged to the Lord, and therefore left it with him, and prayed for it from him;

— the Targum says, “let me see the vengeance of thy judgements on them.”

13 Sing unto the Lord, praise ye the Lord; for He hath delivered the soul of the poor from the hand of evildoers. — for he hath delivered the soul of the poor from the hand of evil doers; or, “the life of the poor”; meaning himself, a poor destitute person, few or none to stand by him but the Lord, who had delivered him out of the hand of Pashur and his accomplices.

14 Cursed be the day wherein I was born; let not the day wherein my mother bore me be blessed. — cursed be the day wherein I was born… if this was said immediately upon the foregoing, it was a most strange and sudden change of frame indeed that the prophet came into, from praising God, to cursing the day of his birth; wherefore some have thought it was delivered at another time, when in great anguish of spirit; 

at this sudden change of the prophet’s discourse, it is not unlikely that these words of complaint were uttered before the foregoing, which are expressive of confidence in God and gratitude for deliverance.

15 Cursed be the man who brought tidings to my father, saying, “A manchild is born unto thee,” making him very glad.

16 And let that man be as the cities which the Lord overthrew, and repented not; and let him hear the cry in the morning and the shouting at noontide, — and let that man be as the cities which the Lord overthrew… in his fury, as the Targum and Septuagint add. Meaning the cities of Sodom and Gomorrah, who were utterly destroyed, and were never recovered;

— and repented not; whose sentence God never repented of, nor revoked: this was very severe and uncharitable, to wish for so sore a destruction upon an innocent person.

17 because he slew me not from the womb, or that my mother might have been my grave, and her womb to be always great with me.

18 Why came I forth out of the womb to see labor and sorrow, that my days should be consumed with shame? — that my days should be consumed with shame? through the bad usage of him, the reproach that was cast upon him, and the contempt he had to carry for prophesying in the name of the Lord;

— all this shows that there are fragilities and vulnerabilities in the best of men, and what they are when left to themselves; how weak, foolish and fragile they could be. And Jeremiah recording all his weaknesses and failings, is an argument of the uprightness and sincerity of the man Jeremiah; and of the truth and integrity of his records in the Scriptures.

Jeremiah (Ch 17-18)

•November 9, 2021 • Leave a Comment

Chapter 17 continues with more prophecies of the destruction of the house of Judah, their sins of idolatry, of Sabbaths breaking, both houses were notorious for their violations; of which they were sinners and both were send into captivity.

Jeremiah 17

1 “The sin of Judah is written with a pen of iron and with the point of a diamond. It is engraved upon the tablet of their heart and upon the horns of your altars, — with a pen of iron; this is an allegory; that is to say that it is deeply engraved, and cannot be erased with a pen of iron, with a diamond point;

— as expressed by Jeremiah, it’s called ‘an iron wall,’ and by Ezekiel, it was said (Ezekiel 3:9): “As a diamond, harder than flint have I made your forehead;”

— there is no need to limit the sin of Judah to idolatry, but it includes all other sins, like breaking the Sabbaths; and so the Targum expresses it in the plural number, “the sins of Judah;” though, if any particular sin is intended, its main one seems to be idolatry.

whilst their children remember their altars and their wooden idols by the green trees upon the high hills. — their children remember their altars… which is a further proof of their long continuance in idolatrous practices; they trained up their children in them; who, when grown up, imitated them, and went on in the same evil ways.

O My mountain in the field, I will give thy substance and all thy treasures to the spoil, and thy high places for sin throughout all thy borders. — O my mountain in the midst of the field… meaning either the temple, called the mountain of the house, and of the Lord’s house, Micah 3:12, or else Jerusalem, which stood on a hill in the midst of a plain, surrounded with fruitful fields and gardens; or in the midst of a land like a field;

— the Targum says, “because thou worshippest idols upon the mountains in the field:”

— I will give thy substance and all thy treasures to the spoil; all the riches of the city and temple to be the spoil and plunder of the enemy; and thy high places for sin, throughout all thy borders. 

And thou, even thyself, shalt discontinue from thine heritage that I gave thee; and I will cause thee to serve thine enemies in the land which thou knowest not; for ye have kindled a fire in Mine anger which shall burn for ever.” — I will cause thee to serve thine enemies in the land which thou knowest not; the Babylonians in Chaldea; or, later, the Romans.

Thus saith the Lord: “Cursed be the man that trusteth in man and maketh flesh his arm, and whose heart departeth from the Lord.

For he shall be like the heath (a tract of wasteland) in the desert, and shall not see when good cometh, but shall inhabit the parched places in the wilderness, in a salt land and not inhabited.

“Blessed is the man that trusteth in the Lord, and whose hope the Lord is. — blessed is the man that trusteth in the Lord; in the Word of the Lord, as the Targum says.

For he shall be as a tree planted by the waters, and that spreadeth out her roots by the river, and shall not see when heat cometh, but her leaf shall be green; and shall not be disquieted in the year of drought, neither shall cease from yielding fruit.”

The heart is deceitful above all things, and desperately wicked; who can know it? — and it is a common mistake among mankind to think their own hearts a great deal better than they really are; the truth is, the heart of man, in his corrupt and fallen state, is false and deceitful above all things.

10 “I, the Lord, search the heart; I try the reins, even to give every man according to his ways, and according to the fruit of his doings.” — I the Lord search the heart… the inward parts of it, every room and corner in it; and know the thoughts of it; all its intents, purposes, designs, contrivances, and imaginations; all the secret motions and emotions of it, and any wickedness that is in it.

11 As the partridge sitteth on eggs and hatcheth them not, so he that getteth riches, and not by right, shall leave them in the midst of his days, and at his end shall be a fool. — the partridge sitteth on eggs and hatcheth them not, or, a partridge hatching eggs which it has not laid;

— as the words may be more literally rendered, hatcheth eggs which she did not lay; so he that getteth riches, but not by his labour;

— the Targum says, “at his end he is called a wicked man;” because of the unjust manner in which he got his riches, and which appears by his end; every filthy rich is an abomination.

12 A glorious high throne from the beginning is the place of our sanctuary.

13 O Lord, the hope of Israel, all that forsake Thee shall be ashamed. “And they that depart from Me shall be written in the earth, because they have forsaken the Lord, the fountain of living waters.”

14 Heal me, O Lord, and I shall be healed; save me, and I shall be saved; for Thou art my praise.

15 Behold, they say unto me, “Where is the word of the Lord? Let it come now.”

16 As for me, I have not hastened from being a shepherd to follow Thee; neither have I desired the woeful day, Thou knowest; that which came out of my lips was right before Thee.

17 Be not a terror unto me; Thou art my hope in the day of evil.

18 Let them be confounded that persecute me, but let not me be confounded; let them be dismayed, but let not me be dismayed. Bring upon them the day of evil, and destroy them with double destruction. — bring upon them the day of evil; of punishment; which they put far away, and scoff at; though the prophet did not desire the woeful day to come upon the people in general, yet upon his persecutors in particular. 

19 Thus said the Lord unto me: “Go and stand in the gate of the children of the people, whereby the kings of Judah come in and by which they go out, and in all the gates of Jerusalem;

20 and say unto them, ‘Hear ye the word of the Lord, ye kings of Judah and all Judah, and all the inhabitants of Jerusalem that enter in by these gates.

21 Thus saith the Lord: Take heed for yourselves, and bear no burden on the Sabbath day, nor bring it in by the gates of Jerusalem; — neither carry forth a burden on the Sabbath, neither do ye any work; servile work is also forbidden to be done upon all solemn festivals, Leviticus 23:8; Leviticus 23:35, much more upon the sabbath days;

— but hallow ye the sabbath days; as the sabbath was instituted as a sign or token of God’s covenant with his people.

22 neither carry forth a burden out of your houses on the Sabbath day, neither do ye any work, but hallow ye the Sabbath day, as I commanded your fathers. — neither carry forth a burden out of your houses on the sabbath day… not of dirt and soil only, but of any ware or merchandise, in order to be sold in the city or elsewhere:

— neither do ye any work; any servile work, any kind of manufacture, either within doors or without; or exercise any kind of trade, or barter and merchandise, or do any sort of worldly business; nothing but what was of mere necessity, for the preservation of life; see Exodus 20:10;

— the penalty for breaking the Sabbath is death; but the gift of observing it is the identification of being of his chosen ones (more at the end)

23 But they obeyed not, neither inclined their ear, but made their neck stiff, that they might not hear nor receive instruction.

24 “‘And it shall come to pass, if ye diligently hearken unto Me, saith the Lord, to bring in no burden through the gates of this city on the Sabbath day, but hallow the Sabbath day to do no work therein, — but hallow ye the sabbath day; or, “sanctify it” by separating it from all worldly business, and devoting it to the worship of God in public and private, spending it wholly in acts of religion and piety:

— one part of the sanctification of the sabbath lay in a cessation from all servile work, though not wholly, but also in the observance of religious worship, and the one was in order to the other; for, unless they abstained from worldly business, they could not be at leisure to attend divine service.

25 then shall there enter into the gates of this city kings and princes sitting upon the throne of David, riding in chariots and on horses, they and their princes, the men of Judah and the inhabitants of Jerusalem; and this city shall remain for ever.

26 And they shall come from the cities of Judah, and from the places about Jerusalem, and from the land of Benjamin, and from the plain, and from the mountains, and from the South, bringing burnt offerings and sacrifices, and meat offerings and incense, and bringing sacrifices of praise unto the house of the Lord.

27 But if ye will not hearken unto Me to hallow the Sabbath day, and not to bear a burden, even entering in at the gates of Jerusalem on the Sabbath day, then will I kindle a fire in the gates thereof, and it shall devour the palaces of Jerusalem, and it shall not be quenched.’” — there should be no fire kindled on the sabbath, but where the sabbath is profaned, it was that Jerusalem was destroyed and its people carried away as captives because they profaned the sabbath;

— and the observance of it was the distinguishing character of a Jew, whereby he declared himself to be a worshipper of the true God, who made heaven and earth, and ordained the sabbath day as a memorial of the creation. So that for the Jews to profane the sabbath, was in effect to renounce their share in God’s covenant;

— the sabbath was instituted as a sign or token of God’s covenant with his people, Exodus 31:13; it was to identify the people to God “that ye may know that I am the Lord,” and God to his people “that I am the Lord who doth sanctify you.” It’s a two-way streets.

Jeremiah 18

The word which came to Jeremiah from the Lord, saying,

“Arise and go down to the potter’s house, and there I will cause thee to hear My words.” — and there I will cause thee to hear my words; there the Lord would tell him what he had further to say to him, and what he should say to the people; and by sensible objects before him, he would cause him to understand more clearly what he will say to them.

Then I went down to the potter’s house, and behold, he wrought a work on the wheels. — then I went down to the potter’s house, and, behold, he wrought a work on the wheels, literally, “on the disks,” for the potter’s lathe consisted of two horizontal wooden plates, the lower one larger than the upper, the clay being molded into shape on the upper disk.

And the vessel that he made of clay was marred in the hand of the potter; so he made it again another vessel, as it seemed good to the potter to make it.

Then the word of the Lord came to me, saying,

“O house of Israel, cannot I do with you as this potter?” saith the Lord. “Behold, as the clay is in the potter’s hand, so are ye in Mine hand, O house of Israel. — in previous chapters God’s words were usually directed against Jerusalem, the inhabitants of Jerusalem, their elders and priests, but here, it is to the house of Israel again;

— O house of Israel; this saying seems a bit late, since the house of Israel had been in exiled over a hundred years ago, so this renew warning must be prophetic, for the endtime;

— emphasis here is the house of Israel, which is repeated above, the lost ten tribes; but could also include the house of Judah, for they committed the same sins and would certainly share the same punishments.

At the instant I shall speak concerning a nation and concerning a kingdom, to pluck up and to pull down and to destroy it,

if that nation, against whom I have pronounced, turn from their evil, I will repent of the evil that I thought to do unto them.

And at the instant I shall speak concerning a nation and concerning a kingdom, to build and to plant it, — to build and to plant, the royal family of the house of David; which applied to the planting of Jewish princesses to Ireland;

— the destruction of Zedekiah’s Pharez line; to the planting of the Zarah line ruling in the British Isles! (for more see “Judah’s Sceptre and Joseph’s Birthright” by J.H. Allen).

10 if it do evil in My sight, that it obey not My voice, then I will repent of the good wherewith I said I would benefit them.

11 Now therefore go to speak to the men of Judah and to the inhabitants of Jerusalem, saying, ‘Thus saith the Lord: Behold, I frame evil against you and devise a device against you. Return ye now every one from his evil way, and make your ways and your doings good.’” — behold, I frame evil against you; as the potter frames his clay upon the wheel, to which the allusion is; which is to be understood of the evil of punishment, but not of any secret purpose, and settled determination, in the mind of God to bring it upon them;

— and devise a device against you; the same as before; by which it looked as if he had thought of the matter, and had contrived a scheme, which if he went on with, would issue in the subversion of their whole state.

12 And they said, “There is no hope; but we will walk after our own devices, and we will every one do the imagination of his evil heart.”

13 Therefore thus saith the Lord: “Ask ye now among the heathen: Who hath heard such things? The virgin of Israel hath done a very horrible thing.

14 Will a man leave the snow of Lebanon which cometh from the rock of the field? Or shall the cold flowing waters that come from another place be forsaken?

15 Because My people hath forgotten Me, they have burned incense to vanity; and they have caused them to stumble in their ways from the ancient paths, to walk in paths, on a road not cast up,

16 to make their land desolate and a perpetual hissing; every one that passeth thereby shall be astonished, and wag his head.

17 I will scatter them as with an east wind before the enemy; I will show them the back, and not the face, in the day of their calamity.” — I will scatter them as with an east wind, a violent wind from the desert, before the enemy;

— I will show them the back, and not the face, in the day of their calamity, the metaphor is taken from the custom of kings and princes, which is, to turn their backs on, that is, will not look upon them in a favourable way, nor with any pity and compassion for them, nor hear their cries; but turn his back upon them, and a deaf ear unto them.

18 Then said they, “Come, and let us devise devices against Jeremiah; for the law shall not perish from the priest, nor counsel from the wise, nor the word from the prophet. Come, and let us smite him with the tongue, and let us not give heed to any of his words.” — then said they, come, and let us devise devices against Jeremiah… being enraged at the warning messages threatening them, they propose to enter into a confederacy and consultation together, to think of ways and means to stop the mouth of the prophet, and even to take away his life;

— since he had told them that God had devised a device against them, they would scheme for devising devices against him; so that they might walk after their own devices, without being teased and tormented by this prophet:

— nor counsel from the wise; we have wise rulers and governors, and members of the Sanhedrin, and judges of all controversies, and who are capable of giving advice upon any occasion; does he think to know better than our statesmen and sages, our counsellors in the temple and state affairs?

— nor the word from the prophet; we have prophets among us, that prophesy as well as he; and whose words of prophecy shall be fulfilled, when his will not; who assure us that we shall have peace and prosperity; and therefore let us not regard what this man says, or be intimidated by his threats:

— and so the Targum says, “let us bear false witness against him;” or, “let us smite him in the tongue” cut it out; or stop his mouth, and hinder him from speaking any more in this manner to the people; or, “let us smite him for the tongue” because of the words he says, or the prophecies he delivers.

19 Give heed to me, O Lord, and hearken to the voice of them that contend with me.

20 Shall evil be recompensed for good? For they have dug a pit for my soul. Remember that I stood before Thee to speak good for them, and to turn away Thy wrath from them. — they have digged a pit for my soul; that is, they have laid snares for me as for a wild beast; for pits are digged for wild beasts to fall into, that they may be taken;

— for they have digged a pit for my soul, where they hoped to catch him unawares.

21 Therefore deliver up their children to the famine, and pour out their blood by the force of the sword; and let their wives be bereaved of their children and be widows; and let their men be put to death; let their young men be slain by the sword in battle. — and let their wives be bereaved of their children, and be widows; let them have neither husbands nor children; which latter might be a comfort to them, when they are being stripped of these men and children, their affliction and distress would be much greater.

22 Let a cry be heard from their houses, when Thou shalt bring a troop suddenly upon them; for they have dug a pit to take me, and hid snares for my feet. — let a cry be heard from their houses, as the attacking forces enter, when thou shalt bring a troop suddenly upon them, namely, the murderous hordes of the invaders; for they have digged a pit to take me and hid snares for my feet, as the fowler does for the bird.

23 Yet, Lord, Thou knowest all their counsel against me to slay me; forgive not their iniquity, neither blot out their sin from Thy sight, but let them be overthrown before Thee; deal thus with them in the time of Thine anger. — deal thus with them in the time of thine anger; the set time for thy wrath to come upon them to the uttermost; then do unto them according to all the imprecations or curses now being prepared; which the prophet foresaw, and believed he would do; and therefore thus spake.

~~~

More about keeping the Sabbaths:

“Speak thou also unto the children of Israel, saying, ‘Verily My Sabbaths ye shall keep; for it is a sign between Me and you throughout your generations, that ye may know that I am the Lord who doth sanctify you,” Exodus 31:13.

“Ye shall keep the Sabbath therefore, for it is holy unto you. Every one who defileth it shall surely be put to death; for whosoever doeth any work therein, that soul shall be cut off from among his people,” Exodus 31:14.

“Six days may work be done, but on the seventh is the Sabbath of rest, holy to the Lord. Whosoever doeth any work on the Sabbath day, he shall surely be put to death,” Exodus 31:15.

Keeping the Sabbaths identify the people to God “that ye may know that I am the Lord,” and God to his people “that I am the Lord who doth sanctify you.” It’s a two-way streets.

Even in the New Testament, Jews and Gentiles converted to Christianity, called Nazarenes, were meeting in synagogues on the Sabbath (Mark 6:2Luke 4:31Luke 13:10–16Acts 13:142742–4415:2116:1317:218:4). Obviously, with no work being done on the Sabbath day, the Sabbath day would be the ideal day to have organized worship services. This indicates early Christian believers still believe that the Sabbath be the day of rest as well as a day of worship. Besides being a sign of identity, of affiliation, before God and his chosen ones, the Sabbath is also the fourth of the Ten Commandments; and the penalty for profaning its observance is death.

Jeremiah (Ch 15-16)

•November 8, 2021 • Leave a Comment

In these chapters, God replies to the preceding supplications, the Lord’s answer to the prophet’s prayers, by declaring that not even the intercession of his favoured servants, Moses and Samuel, should divert him from executing his purpose of vengeance against Judah; which is denounced in terms of great severity to come.

The list of kings of Judah towards the end; in successive reigns, as Jehoahaz (reign 609), Jehoiakim (reign 609–598), Jehoiachin or Jechonias (reign 598–597), and Zedekiah (reign 597–586).

Jeremiah 15

1 Then said the Lord unto me, “Though Moses and Samuel stood before Me, yet My mind could not be toward this people. Cast them out of My sight, and let them go forth. — the meaning is, that even if Moses and Samuel were alive, and made intercession for the people, their prayers would not be regarded;

— yet my mind could not be towards this people; God could have no delight in them; could not be reconciled to them, that the favours asked for shouldn’t be granted or that they should be continued in their own land; and therefore it was in vain for the prophet to solicit on their account;

— cast them out of my sight; as persons loathsome and abominable; I cannot look upon them, or have anything to say to them, in a favourable way.

And it shall come to pass, if they say unto thee, ‘Whither shall we go forth?’ then thou shalt tell them, ‘Thus saith the Lord: “‘Such as are for death, to death; and such as are for the sword, to the sword; and such as are for the famine, to the famine; and such as are for the captivity, to the captivity.’ — then thou shall tell them, thus saith the Lord, such as for death, to death; such as were appointed to death, or to die by the pestilence, which is often signified by death; they shall go forth unto it; or it shall meet them, and seize upon them, and take them away:

— and such are for the sword, to the sword; who are appointed to die by the sword of the enemy, into whose hands they should fall by attempting to escape out of the city, shall perish by it:

— and such are for the famine, to the famine; such are appointed to die by that, shall die of it in the city, where they shall be besieged, and not be able to get out to fetch in any provisions, and where none can be brought, because of the enemy:

— and such are for the captivity, to captivity; such are spared from the pestilence, sword, and famine, and are designed to be carried captive into a strange land, shall be taken and carried thither; nor will it be in their power, or in any other’s, to hinder any of the above things, to which they are appointed of God. According to some experts, the latter of these is more grievous than the former; as the sword than death, and famine than the sword, so captivity than them all.

“And I will appoint over them four kinds,” saith the Lord: “the sword to slay, and the dogs to tear, and the fowls of the heaven and the beasts of the earth to devour and destroy. — the Targum says “four evil punishments;”

— the sword to slay: the first and chief of the four families or punishments, which had a commission from the Lord to sheath itself in his people, the Jews; even the sword of the enemy, the Chaldeans, drawn against them by a divine order and appointment:

— and the dogs to tear; the carcasses of those that are slain with the sword: or “to draw” as the word signifies; it being the usual way of dogs to draw and drag the flesh about they are feeding on;

— and the fowls of the heaven, and the beasts of the earth, to devour and destroy; or “to eat, and to corrupt”, the bodies of those that are slain by the sword. The meaning is, that such should not have a burial, but should be the food of fowls and wild beasts.

And I will cause them to be removed into all kingdoms of the earth, because of Manasseh the son of Hezekiah, king of Judah, for that which he did in Jerusalem. — and I will cause them to be removed into all the kingdoms of the earth… not only into Babylon, but into all other countries of the earth indicates this could be prophetic, yet in the future, and not just the house of Judah but also the house of Israel.

“For who shall have pity upon thee, O Jerusalem? Or who shall bemoan thee? Or who shall go aside to ask how thou doest?

Thou hast forsaken Me,” saith the Lord, “thou art gone backward; therefore will I stretch out My hand against thee and destroy thee; I am weary with repenting. — thou art gone backward; they had set up idols, and idol worship; and this was the cause of the sword, pestilence, famine, and captivity, and of all the evils that befell them:

— therefore will I stretch out mine hand against thee, and destroy thee; his hand of power and vengeance, which when stretched out, and falls with weight, whether on particular persons, or on a nation, brings inevitable ruin and destruction with it.

And I will winnow them with a fan in the gates of the land; I will bereave them of children; I will destroy My people, since they return not from their ways. — I will fan them with a fan in the gates of the land… either of their own land, the land of Judea; and so the Septuagint says, “in the gates of my people”; alluding to the custom of winnowing corn in open places;

— and by fanning is meant the dispersion of the Jews, and being carried captive out of their own land into other countries: or of the land of the enemy, into their cities, as the Targum paraphrases it; gates being put for them frequently; whither they should be scattered by the fan of the Lord; for what was done by the enemy, as an instrument, is ascribed to him:

— yet they return not from their ways; though fanned with the fan of affliction, bereaved of their children, and threatened with destruction: it expresses their obstinate continuance in their evil ways, and the reason of God’s dealing with them as above.

Their widows are increased to Me above the sand of the seas; I have brought upon them, against the mother of the young men, a despoiler at noonday; I have caused him to fall upon it suddenly, and terrors upon the city. — their widows are increased to me above the sand of the seas… their husbands being slain; not only in the times of Ahaz, when a hundred and twenty thousand men were slain in one day in Judah, by Pekah the son of Remaliah, 2 Chronicles 28:6;

— but in the times of Zedekiah, at the siege of Jerusalem, and the taking of it, and during the Assyrian captivity before predicted. The children of Israel were to be as the sand of the sea; and here the widows are said to be so too; their husbands being dead;

— mention is made of “seas”, in the plural; there being many in or near Judea, as the Red sea, the sea of Galilee, and the Mediterranean sea.

10 Woe is me, my mother, that thou hast borne me, a man of strife and a man of contention to the whole earth! I have neither lent on usury, nor have men lent to me on usury; yet every one of them doth curse me. — woe is me, my mother, that thou hast borne me a man of strife to the whole earth! that is, one with whom the whole world, all men with whom he came into contact, were anxious to pick a quarrel for no other reason than for his faithful discharge of his office.

11 The Lord said, “Verily it shall be well with thy remnant; verily I will cause the enemy to deal with thee well in the time of evil and in the time of affliction. — the Lord promised, Verily it shall be well with thy remnant; the latter words of this verse expound the former: for by remnant, or residue, is meant the remnant of days that Jeremiah had to live;

— Nebuzaradan, the captain of the guard, begged him, “If it pleases you to come with me to Babylon:”

“And now behold, I loose thee this day from the chains which were upon thine hand. If it seem good unto thee to come with me into Babylon, come, and I will look well after thee; but if it seem ill unto thee to come with me into Babylon, forbear. Behold, all the land is before thee. Wherever it seemeth good and convenient for thee to go, thither go,” Jeremiah 40:4.

— or another explanation: it could be a remnant of Jeremiah’s close family; although he had no wife, thus no children; but the king’s daughters, who could be his nieces entrusted to him for care and protection.

12 “Shall iron break the northern iron and the steel? can iron break iron, especially that which comes from the north, which was harder than the common iron; or steel, the hardest of them all? though the Jews were as hard as iron, they could not prevail against and overcome those iron from the north.

13 Thy substance and thy treasures will I give as the spoil without price, and that for all thy sins, even in all thy borders. — thy substance and thy treasures, all the temple’s treasure, all the wealth of Judah, even all within thy borders, will I give to the spoil without price, they will be theirs to take away, and all because of thy sins.

14 And I will make thee to pass with thine enemies into a land which thou knowest not; for a fire is kindled in Mine anger, which shall burn upon you.” — for a fire is kindled in mine anger; meaning the wrath of God, compared to fire, which was kindled and excited by their sins, and which would continue upon them until it had destroyed them.

15 O Lord, Thou knowest; remember me and visit me, and avenge me on my persecutors. Take me not away in Thy longsuffering; know that for Thy sake I have suffered rebuke. — and visit me; in mercy for good; and so the Targum adds, “that thou mayest do well unto me.”

16 Thy words were found, and I ate them; and Thy word was unto me the joy and rejoicing of mine heart; for I am called by Thy name, O Lord God of hosts. — for I am called by Thy name, O Lord God of hosts, it was revealed to Jeremiah, he was called as a servant or messenger of His Word. He had, therefore, devoted himself to this calling with all seriousness.

17 I sat not in the assembly of the mockers, nor rejoiced; I sat alone because of Thy hand, for Thou hast filled me with indignation.

18 Why is my pain perpetual and my wound incurable, which refuseth to be healed? Wilt Thou be altogether unto me as a liar and as waters that fail?

19 Therefore thus saith the Lord: “If thou return, then will I bring thee back, and thou shalt stand before Me; and if thou take forth the precious from the vile, thou shalt be as My mouth. Let them return unto thee, but return not thou unto them. — let them return unto thee, but return not thou unto them; this is said of the people of the Jews, to whom the prophet was sent; and the sense is, that he should not at all comply with them, or conform to their humours, or flatter and sooth them in their sins, as the false prophets did.

20 And I will make thee unto this people a fortified brazen wall, and they shall fight against thee; but they shall not prevail against thee, for I am with thee to save thee and to deliver thee,” saith the Lord. — they will still continue their opposition; and contradict his prophecies; or so as to take away his life, but they shall not prevail.

21 “And I will deliver thee out of the hand of the wicked, and I will redeem thee out of the hand of the terrible.” — and I will deliver thee out of the hand of the wicked… the wicked Jews, Zedekiah and his courtiers, who imprisoned him:

— the power of the terrible Chaldeans, into whose hands thou shalt come, but shalt be preserved from any harm by the workings of my providence in thy favour.

Jeremiah 16

1 The word of the Lord came also unto me, saying,

“Thou shalt not take thee a wife, neither shalt thou have sons or daughters in this place.” — thou shall not take thee a wife… not because it was unlawful; for it was lawful for prophets to marry, but because it was on account of the calamities and distresses which were coming upon the nation; which would be more bearable by him alone, than if he had a wife and children.

For thus saith the Lord concerning the sons and concerning the daughters who are born in this place, and concerning their mothers who bore them, and concerning their fathers who begot them in this land:

“They shall die of grievous deaths; they shall not be lamented, neither shall they be buried, but they shall be as dung upon the face of the earth. And they shall be consumed by the sword and by famine, and their carcasses shall be meat for the fowls of heaven and for the beasts of the earth.” — they shall die of grievous deaths, such as the sword, famine, and pestilence;

— but they shall be as dung upon the face of the earth; lie and rot there, and be dung to the earth; which would be a just retaliation, for their filthy and abominable actions committed in the land:

— the Targum particularly adds famine. It may be rendered, “deaths of diseases, or sicknesses” such are brought on by long sickness and lingering contagious diseases; by which a man suffers slowly, as by famine, and is not snatched away at once; and which are more grievous to bear.

For thus saith the Lord: “Enter not into the house of mourning, neither go to lament nor bemoan them; for I have taken away My peace from this people,” saith the Lord, “even lovingkindness and mercies. — neither go to lament nor bemoan them; neither go to the house of mourning, or the mourning feast; to the houses of the deceased to express sorrow, by shedding tears or shaking the head, or by any other gesture or ceremony as mentioned;

— for I have taken away my peace from this people; all peace or prosperity is of God, and therefore called his, and which he can take away from a people when he pleases; and having determined to take it away from this people because of their sins;

— they had turned “justice into wormwood, and cast righteousness to the ground” (Amos 5:7).

Both the great and the small shall die in this land. They shall not be buried, neither shall men lament for them, nor cut themselves, nor make themselves bald for them. — both the great and the small shall die in this land… the nobles as well as the common people, high and low, rich and poor; none shall be exempted from the grievous deaths by the sword, famine, and pestilence.

Neither shall men tear themselves for them in mourning to comfort them for the dead; neither shall men give them the cup of consolation to drink for their father or for their mother. — neither shall men give them the cup of consolation to drink for their father or for their mother: but now these drinks should be omitted; the calamity would be so great and so universal that there wouldn’t be any time left to perform such ordinances.

Thou shalt not also go into the house of feasting to sit with them to eat and to drink.” — thou shall not also go into the house of feasting… which was lawful to do, and which the prophet doubtless had done at other times; but now a time of calamity coming on, it was not proper he should; and that he was to abstain from such places.

For thus saith the Lord of hosts, the God of Israel: “Behold, I will cause to cease out of this place, in your eyes and in your days, the voice of mirth and the voice of gladness, the voice of the bridegroom and the voice of the bride.

10 “And it shall come to pass, when thou shalt show this people all these words, and they shall say unto thee, ‘Why hath the Lord pronounced all this great evil against us? Or what is our iniquity? Or what is our sin that we have committed against the Lord our God?’

11 Then shalt thou say unto them, ‘Because your fathers have forsaken Me,’ saith the Lord, ‘and have walked after other gods and have served them, and have worshiped them, and have forsaken Me, and have not kept My law. — and have walked after other gods and have served them and have worshipped them; were guilty of gross idolatry, serving and worshipping the creature more than their Creator; even idols of gold, silver, brass, wood, and stone which were no gods;

— for there is no other true God besides the Lord Yehovah; and which they were well informed of, and therefore their sin was the greater to leave him and worship them; and which sin, because of the heinousness of it, is repeated.

12 And ye have done worse than your fathers, for behold, ye walk every one after the imagination of his evil heart, that they may not hearken unto Me. — and ye have done worse than your fathers… not only committed the same sins, but greater, or, however, attended with more aggravating circumstances; they were wilfully and impudently done, and obstinately persisted in; and therefore deserving of the great evil of punishment pronounced against them.

13 Therefore will I cast you out of this land into a land that ye know not, neither ye nor your fathers; and there shall ye serve other gods day and night, where I will not show you favor.’ — therefore will I call you out of this land… by force, and against their wills, whether they would or not, and with abhorrence and contempt: it is to be understood of their captivity, which was but a just punishment for the above sins; for since they had cast off the Lord and his worship, it was but just that they should be cast off by him, and cast out of their land, which they held by their obedience to him:

— the Targum says, “and there shall ye serve people that worship idols day and night”; that as they had served idols, now they should serve the people, the worshippers of those idols; the former was their sin, the latter their punishment.

14 “Therefore behold, the days come,” saith the Lord, “that it shall no more be said, ‘The Lord liveth who brought up the children of Israel out of the land of Egypt,’

15 but, ‘the Lord liveth who brought up the children of Israel from the land of the north, and from all the lands whither He had driven them.’ And I will bring them back into their land that I gave unto their fathers. — the Targum says: “that brought up the children of Israel from the land of the north”; that is, from Babylon, which lay north of Judea. 

16 “Behold, I will send for many fishers,” saith the Lord, “and they shall fish them; and after will I send for many hunters, and they shall hunt them from every mountain and from every hill, and out of the holes of the rocks. — though some interpret this, and what follows, of the deliverance of the Jews by the Medes and Persians under Cyrus, who searched for them in all places, and sent them into their own land; or of Zerubbabel, and others with him, who used all means to persuade the Jews in the captivity to go with them, to return to Judea and to build the house of the Lord in Jerusalem.

17 For Mine eyes are upon all their ways. They are not hid from My face, neither is their iniquity hid from Mine eyes.

18 And first I will recompense their iniquity and their sin double, because they have defiled My land; they have filled Mine inheritance with the carcasses of their detestable and abominable things.”

19 O Lord, my strength and my fortress, and my refuge in the day of affliction, the nations shall come unto Thee from the ends of the earth and shall say, “Surely our fathers have inherited lies, vanity, and things wherein there is no profit.” — and nations shall come; eventually, the nations will come to you and worship you of one accord, and they will say, “How did they make gods of woods and stones for themselves, as if they have no God?”

20 Shall a man make gods unto himself, and they are no gods?

21 “Therefore behold, I will this once cause them to know, I will cause them to know Mine hand and My might; and they shall know that My name is the Lord. — they shall know that my name is Yehovah, a name which implies absolute and necessary existence, the real source and origin of all creation.

Jeremiah (Ch 13-14)

•November 7, 2021 • Leave a Comment

Years could have passed and now Jeremiah was asked to prophecy again, probably in the year 602 BC during the reign of Jehoiakim.

This chapter contains a single and distinct prophecy, which, under two symbols, a linen girdle left to rot, and all vessels being filled with wine, foretells the utter destruction that was destined to fall upon the whole Jewish nation, including the individuals of every rank and denomination.

Jeremiah 13

1 Thus saith the Lord unto me, “Go and get thee a linen girdle, and put it upon thy loins, and put it not in water.” — go and get thee a linen gird; this girdle represents the people of Judah with their corruption, when they were a people near unto the Lord, when they cleaved unto him, and served him: “and put it upon thy loins”; near the reins, the seat of affection, and that it might be visible and ornamental;

— the prophet was commanded not to put the girdle in water, that is, not to wash it, but to leave it in that state of filthiness which it had contracted in wearing it.

So I got a girdle according to the word of the Lord and put it on my loins.

And the word of the Lord came unto me the second time, saying,

“Take the girdle that thou hast got, which is upon thy loins, and arise, go to the Euphrates and hide it there in a hole of the rock.” — and arise, go to Euphrates, and hide it there in a hole of the rock; by the river side, where the waters, coming and going, would reach and wet it, and it drying again, would rot the sooner;

— this signifies the carrying of the Jews captive to Babylon, by which city the river Euphrates ran, and the obscure state and condition they would be in there; and where all their pride and glory would be marred, as afterwards declared.

So I went and hid it by the Euphrates, as the Lord commanded me. — so I went and hid it by Euphrates… or, “in” it; in a hole of the rock, upon the banks of it.

And it came to pass after many days, that the Lord said unto me, “Arise, go to the Euphrates and take the girdle from thence, which I commanded thee to hide there.” — that the Lord said unto me, arise, go to Euphrates, and take the girdle from thence, which I commanded thee to hide there; which may denote the return of these people from captivity, according to the prophecy of Jeremiah; see Jeremiah 25:11;

though this seems to be visionally done, in order to express the wretched state and condition these people were in; especially before the captivity, which was the chief cause for their captivity.

Then I went to the Euphrates and dug, and took the girdle from the place where I had hid it; and behold, the girdle was marred (rotten); it was profitable for nothing. — and, behold, the girdle was marred; or “corrupted” it become rotten by the washing of the water over it, and its long continuance in such a place:

— it was profitable for nothing; it could not be put upon a man’s loins, or be wore any more; nor was it fit for any other use, it was so sadly spoiled and so thoroughly rotten. It was not fit for anything.

Then the word of the Lord came unto me, saying,

“Thus saith the Lord: ‘In this manner will I mar (destroy) the pride of Judah and the great pride of Jerusalem. — will I destroy the pride of Judah, and the great pride of Jerusalem; or their glory, or excellency; that which they gloried in, and were proud of; their city which was burnt, and their temple which was destroyed by the Chaldeans; their king, princes, and nobles, who were carried captive into Babylon, by the river Euphrates, and stripped of all their grandeur, honour, and glory;

— the Targum says, “so will I corrupt the strength of the men of Judah, and the strength of the inhabitants of Jerusalem;” meaning the proud or haughty men of Judah, and the many haughty men of Jerusalem would be destroyed.

10 This evil people, who refuse to hear My words, who walk in the stubbornness of their heart, and walk after other gods to serve them and to worship them, shall even be as this girdle which is good for nothing. — this evil people, which refuse to hear my words… sent by the prophets, to whom they turned a deaf ear; and though they pressed them, and desired them to give a hearing, they refused; and this showed them to be a bad people, very degenerate and wicked;

— shall even be as this girdle, which is good for nothing: as they were corrupt in their practices, and were useless and unserviceable to God; so they would be carried captive into a foreign country, where they would be inglorious or shameful, and unprofitable, uncomfortable in themselves, and of no use to one another.

11 For as the girdle cleaveth to the loins of a man, so have I caused to cleave unto Me the whole house of Israel and the whole house of Judah,’ saith the Lord, ‘that they might be unto Me as a people, and as a name, and as praise, and as glory; but they would not hear.’ — so have I caused the whole house of Israel, and the whole house of Judah to cleave unto me; whom God had chosen above all people to dwell in his courts; whom he favoured with his presence, and cleave to him; so that they were a people near unto him as a man’s girdle is to his loins;

— but they would not hear the words of the Lord, nor obey his voice; but served other gods, departed from the Lord, to whom they should have cleaved, and so became like this rotten girdle.

12 “Therefore thou shalt speak unto them this word: ‘Thus saith the Lord God of Israel: Every bottle shall be filled with wine.’ And they shall say unto thee, ‘Do we not certainly know that every bottle shall be filled with wine?’ — every bottle shall be filled with wine; God’s judgements are often represented under the figure of a cup full of intoxicating liquor: see this metaphor pursued at large, Jeremiah 25:15.

13 Then shalt thou say unto them, ‘Thus saith the Lord: Behold, I will fill all the inhabitants of this land — even the kings that sit upon David’s throne, and the priests, and the prophets, and all the inhabitants of Jerusalem — with drunkenness. — behold, I will fill all the inhabitants with drunkenness; there is a wine of astonishment and confusion, Psalms 60:3;

— with that wine, saith God, I will fill all orders of persons, kings, priests, prophets, and all the inhabitants of Jerusalem. And I will dash them one against another I will permit an evil spirit of strife and division to arise among them; a sort of civil strife out of nothing;

— with drunkenness; as wine brings on a state of intoxication, so the effect of God’s wrath and judgements upon the entire nation would be to reduce all its members to a state of helpless distraction, which would cause them to rush to their own ruin, with tribulation;

— with drunkenness; as the Targum interprets by adding, “and shall be like a drunken man;” giddy, stupid, unable to help themselves, or to advise one another.

14 And I will dash them one against another, even the fathers and the sons together,’ saith the Lord. ‘I will not pity, nor spare, nor have mercy, but shall destroy them.’” — and I will dash them one against another; I will permit an evil spirit of civil strife and division to arise among them, as Judges 9:23, so that they shall be set one against another, fathers against their sons, and sons against their fathers, and family against family; 

— I will not pity, nor spare, nor have mercy, but destroy them: the Lord’s hand was in all this; everything was according to his will; he would not prevent the enemy’s invading, besieging, and taking them, nor hinder themselves from destroying one another; but suffer from one calamity to another, without showing the least mercy to them, so great were their sins, and the provocation in hastening the destruction of their kingdom.

15 Hear ye, and give ear; be not proud, for the Lord hath spoken.

16 Give glory to the Lord your God before He cause darkness, and before your feet stumble upon the dark mountains, and, while ye look for light, He turn it into the shadow of death, and make it gross darkness. — and before your feet stumble; before the time come when ye shall be forced to flee by night unto the mountains for fear of your enemies;

— or, more generally, before you find yourselves overtaken by the pursuing judgements of God, notwithstanding all your endeavours to outrun and escape from them;

— the Targum says, “before tribulation comes upon you, and ye be like to those that walk in darkness.”

17 But if ye will not hear it, my soul shall weep in secret places for your pride; and mine eye shall weep sore, and run down with tears, because the Lord’s flock is carried away captive. — my soul shall weep in secret places for your pride; your haughtiness, stubbornness, and vain confidence; and mine eye shall weep sore; because the Lord’s flock His people, and the sheep of his pasture; are carried away captive.

18 Say unto the king and to the queen, “Humble yourselves, sit down; for your principalities shall come down, even the crown of your glory.” — humble yourselves, sit down; or, “sit down humbled”; come down from your thrones, and sit in the dust; humble yourselves before the Lord for your own sins, and the sins of the people;

— in times of general corruption, and which threatens a nation with ruin, it becomes kings and princes to set an example of repentance, humiliation, and reformation; that they should descend from their throne, and lose their grandeur, and be in a low and abject condition, than an exhortation to what was their usual dominance;

— even the crown of their glory; or glorious crown, which should fall from their heads, or be taken from them, when they should be no more served, or treated as crowned heads.

19 The cities of the South shall be shut up, and none shall open them. Judah shall be carried away captive, all of it; it shall be wholly carried away captive. — the cities of the South shall be shut up, and none shall open them… meaning the walls of the cities of the South were closed even before those coming upon them from the north because of their fear of Nebuchadnezzar.

20 Lift up your eyes, and behold them that come from the north. Where is the flock that was given thee, thy beautiful flock? — the state and whole body of the people being called upon to observe the Chaldean army, which came from the north; and is on the march, just at hand to invade, besiege, take, and carry them captive;

— the Septuagint renders it, “lift up thine eyes, O Jerusalem”; or as the Targum interprets it, “O Israel: where is the flock that was given thee, thy beautiful flock?” that is, the people, which were committed to the care and charge of the king,

— as sheep into the hands of a shepherd; and were a fine body of people, chosen of God; a precious and distinguished above all others by their righteous laws and statutes, with special privileges; a people who were to be a kingdom of priests, a holy nation, and a peculiar people, the glory and a light to the whole earth;

— but now carried, or about to be carried, captive. It is no unusual thing to represent a king as a shepherd, and his people as a flock, guided, governed, and protected by him.

21 What wilt thou say when He shall punish thee? For thou hast taught them to be captains, and as chief over thee. Shall not sorrows take thee, as a woman in travail? — the Targum says, “when he shall visit on thee thy sin;” when God shall punish thee for thy sins;

— for thou hast taught them to be captains, and as chief over thee; some Jews showed the Chaldeans the way into their country, and taught them how to conquer them, and be masters over them; or, “hast taught them against thee”; to thy hurt and detriment;

Hezekiah even who showed the emissaries of Merodachbaladan of the Chaldeans his entire treasure house:

And Hezekiah was glad with them, and showed them the house of his precious things — the silver and the gold, and the spices and the precious ointment, and all the house of his armor, and all that was found in his treasures. There was nothing in his house nor in all his dominion that Hezekiah showed them not; Isaiah 39:2;

And Hezekiah hearkened unto them, and showed them all the house of his precious things: the silver, and the gold, and the spices, and the precious ointment, and all the house of his armor, and all that was found in his treasuries. There was nothing in his house nor in all his dominion that Hezekiah showed them not, II Kings 20:13.

— shall not sorrows take thee as a woman in travail? denoting the suddenness of their calamities; the sharpness and severity of them; and that they would be inevitable, even all the treasures of the temple to be carried away, and could no longer be prevented.

22 And if thou say in thine heart, “Why come these things upon me?”—for the greatness of thine iniquity are thy skirts uncovered, and thy heels made bare. — the phrases are expressive of captivity, the cause of which was the greatness and multitude of their sins; the Targum says, “because thy sins are multiplied, thy confusion is revealed, thy shame is seen;”

— are thy skirts uncovered, and thy heels made bare; being obliged to walk naked and barefoot, their buttocks uncovered, and their legs and feet naked, without stockings or shoes, as captives used to be led, to their great shame and disgrace; see Isaiah 20:2.

23 Can the Ethiopian change his skin, or the leopard his spots? Then may ye also do good, that are accustomed to do evil. — can the Ethiopian change his skin, turning it to a white color, or the leopard his spots, characteristic as they have become of him? 

— then may ye also do good that are accustomed to do evil; the one was practically as impossible as the other; they were entirely given over to wickedness.

24 “Therefore will I scatter them as the stubble that passeth away by the wind of the wilderness. — by the wind of the wilderness; which blows freely and strongly; so the Chaldean army is compared to a dry wind of the high places in the wilderness, even a full wind that should scatter and destroy, Jeremiah 4:11;

— or, “to the wind of the wilderness”; and so may denote the wilderness of the people, or the land of Babylon, whither they should be carried captive, and from whence the wind should come that should bring them.

25 This is thy lot, the portion of thy measures from Me,” saith the Lord; “because thou hast forgotten Me, and trusted in falsehood.

26 Therefore will I uncover thy skirts upon thy face, that thy shame may appear. — the Targum says, “and I also will reveal the confusion of thy sin upon thy face, and thy shame shall be seen;” that their sins might appear to themselves and others, of which they had reason to be ashamed.

27 I have seen thine adulteries and thy neighings, the lewdness of thy whoredom and thine abominations on the hills in the fields. Woe unto thee, O Jerusalem! Wilt thou not be made clean? When shall it once be?” — wilt thou not be made clean? When shall it once be? The Lord is still stretching out arms of mercy to an apostate nation, a proof of the greatness of His love and patience for sinners.

Jeremiah 14

The word of the Lord that came to Jeremiah concerning the dearth:

“Judah mourneth, and the gates thereof languish; they are black unto the ground, and the cry of Jerusalem is gone up. — the Targum says; these mourned because of the drought and famine that were upon the land:

— they are black unto the ground; that is, the inhabitants of the cities, and those that sit in the gates, their faces are black through famine; see Lamentations 4:8, so the Targum says “their faces are covered with blackness, they are black as a pot.”

And their nobles have sent their little ones to the waters; they came to the pits and found no water; they returned with their vessels empty; they were ashamed and confounded, and covered their heads. — they came to the pits and found no water; their servants came according to order to the pools and cisterns, or to the deep wells, and to such places where there used to be a great confluence of water, and plenty of it, but now they could find none:

— and covered their heads; as persons ashamed, or as mourners used to do, being full of anguish and distress because of the drought.

Because the ground is chapped, for there was no rain in the earth, the plowmen were ashamed; they covered their heads.

Yea, the hind also calved in the field and forsook it, because there was no grass. — because there was no grass; for the hind to feed upon, and so had no milk to suckle its young with; and therefore left it to seek for grass elsewhere, that it might have food for itself, and milk for its young.

And the wild asses stood in the high places; they snuffed up the wind like dragons; their eyes failed, because there was no grass.”

O Lord, though our iniquities testify against us, do Thou it for Thy name’s sake; for our backslidings are many; we have sinned against Thee.

O the Hope of Israel, the Savior thereof in time of trouble, why shouldest Thou be as a stranger in the land, and as a wayfaring man that turneth aside to tarry for a night? — why shouldest thou be as a stranger in the land; or, a “sojourner” who abides but for a while; and it not being his native place, is not so solicitous for the welfare of it. 

Why shouldest Thou be as a man amazed, as a mighty man that cannot save? Yet Thou, O Lord, art in the midst of us, and we are called by Thy name; leave us not. — yet thou, O Lord, art in the midst of us; having his residence and dwelling in the temple at Jerusalem; and therefore was not a stranger and foreigner among them;

— and this carries in it an entreaty and an argument that he would not in his providence conduct towards them in such manner as though he was: leave us not in our distress and trouble, but deliver us out of it.

10 Thus saith the Lord unto this people: “Thus have they loved to wander; they have not restrained their feet. Therefore the Lord doth not accept them; He will now remember their iniquity and visit their sins.”

11 Then said the Lord unto me, “Pray not for this people for their good. — pray not for this people for their good; or “for good things”, as the Septuagint says, for rain, that the famine might cease; and for deliverance from their enemies, that they might not go into captivity; for these things were determined by the Lord.

12 When they fast, I will not hear their cry; and when they offer burnt offering and an oblation, I will not accept them; but I will consume them by the sword, and by the famine, and by the pestilence.” — but I will consume them by the sword, and by the famine, and by the pestilence; the Lord not only determines the continuance of the famine, notwithstanding the prayers of the prophet; but adds two other judgements, the sword and pestilence, by which he was resolved to consume them; and therefore it was to no purpose to pray to him on their behalf, he was inexorable.

13 Then said I, “Ah, Lord God! Behold, the prophets say unto them, ‘Ye shall not see the sword, neither shall ye have famine, but I will give you assured peace in this place.’” — behold, the prophets say unto them; that is, the false prophets, who were influencing the people for evil.

14 Then the Lord said unto me, “The prophets prophesy lies in My name. I sent them not, neither have I commanded them, neither spoke unto them. They prophesy unto you a false vision and divination, and a thing of nought and the deceit of their heart. — the prophets prophesy lies in my name; it is a wicked thing to tell lies; it is more so to foretell them, and that in the name of the Lord; pretending they have his authority, and are under the influence and guidance of his Spirit;

— and it was sinful for the people to give credit to them, and the more so in that they were forewarned of these prophets and their lies, and had the reverse told them by a true prophet of the Lord, and therefore were inexcusable.

15 Therefore thus saith the Lord concerning the prophets that prophesy in My name, whom I sent not, yet they say, ‘Sword and famine shall not be in this land’: By sword and famine shall those prophets be consumed. — yet they say, sword and famine shall not be in the land; though the Lord by his true prophet had said there should be both; which proves that they were not sent by the Lord, since what they said was in direct opposition to the word of the Lord; wherefore their doom in righteous judgement follows:

— by sword and famine shall these prophets be consumed; they should be some of the first, if not the first that should perish by these calamities; which would abundantly prove the falsehood of their predictions, and show that their lies could neither secure themselves nor others from the judgements which the Lord had said should come upon them.

16 And the people to whom they prophesy shall be cast out in the streets of Jerusalem because of the famine and the sword; and they shall have none to bury them — them, their wives, nor their sons, nor their daughters — for I will pour their wickedness upon them. — shall be cast out in the streets of Jerusalem, because of the famine and the sword; they dying of the famine and of the sword, their carcasses should be cast out of their houses into the open streets, and there lie unburied, as a punishment for disbelieving the words of the Lord, and giving heed to the lies of the false prophets:

— them: their wives, their sons, their daughters; or rather, “they” – “their wives, and their sons, and their daughters”: these shall die by the famine and the sword, and shall be cast out in the streets of Jerusalem.

17 “Therefore thou shalt say this word unto them: ‘Let mine eyes run down with tears night and day, and let them not cease; for the virgin daughter of my people is broken with a great breach, with a very grievous blow. — the Septuagint, “bring down upon your eyes tears night and day, and let them not cease;”

— for the virgin daughter of my people is broken with a great breach; cities are sometimes called virgins, which were never taken; and so Jerusalem have never been taken since it was in the hands of the people of Judah; nor were its inhabitants as yet carried captive, but now together with the famine and the sword, by which many should perish, resulting in sorrows and mournings.

18 If I go forth into the field, then behold, the slain with the sword! And if I enter into the city, then behold, them that are sick with famine! Yea, both the prophet and the priest go about into a land that they know not.’” — then behold them that are sick with the famine! just ready to die, being starved for want of provisions; and multitudes dead, and their carcasses lying in the streets unburied; the prophet does not make mention of the dead indeed, only of the sick with famine; the reason of which is because the sick were more than the dead.

19 Hast Thou utterly rejected Judah? Hath Thy soul loathed Zion? Why hast Thou smitten us, and there is no healing for us? We looked for peace, and there is no good; and for the time of healing, and behold, trouble! — hast thou utterly rejected Judah?…. the prophet, though forbid, proceeds to prayers and expostulations on account of this people, the people of the two tribes of Judah and Benjamin: or, “in rejecting hast thou rejected Judah?” from being a nation, from being under thy care and protection? hast thou cast them away, and wilt thou suffer them to go into captivity as the ten tribes?

20 We acknowledge, O Lord, our wickedness and the iniquity of our fathers; for we have sinned against Thee. — we acknowledge, O Lord, our wickedness, and the iniquity of our fathers… this is said by the prophet, in the name of the few faithful that were among this people, who were sensible of their own sins, the sins of their ancestors, and which they ingenuously confess; their fathers had sinned, and they had imitated them;

— and continued in the same, and therefore might justly expect the displeasure of the Lord, and his controversy with them; for we have sinned against thee; Jeremiah 14:7.

21 Do not abhor us, for Thy name’s sake; do not disgrace the throne of Thy glory; remember, break not Thy covenant with us. — do not abhor us, for thy name’s sake… which was called upon them, and which they called upon; they deserved to be abhorred, they had done those things which might justly render them abominable, being what was abhorrent to him; and they deprecate this, not, for their own sake, who were unworthy of any favour, but for his own sake, for the sake of his honour and glory, which, as it is dear to the Lord, so to his people.

22 Are there any among the vanities of the Gentiles that can cause rain? Or can the heavens give showers? Art not Thou He, O Lord our God? Therefore we will wait upon Thee, for Thou hast made all these things. — art not Thou He, O Lord, our God? Since He had sent the dreadful droughts under whose hardships the land was groaning, therefore He alone could provide relief. 

Jeremiah (Ch 11-12)

•November 6, 2021 • 2 Comments

Jeremiah’s message were written about a hundred years after the house of Israel had been exiled to Assyria, when God called upon Jeremiah to deliver his message against the elders of Jerusalem of an enemy coming out from the north and an impending exile to follow if they continue with all their wickedness and idolatries, but his message was also for the house of Israel at the endtime.

Jeremiah 11

1 The word that came to Jeremiah from the Lord, saying,

“Hear ye the words of this covenant, and speak unto the men of Judah and to the inhabitants of Jerusalem;

and say thou unto them, ‘Thus saith the Lord God of Israel: Cursed be the man that obeyeth not the words of this covenant, — cursed be the man that obeyeth not the words of this covenant; which the prophet, it may be, had in his hands, even the book of the law, and held it forth unto them, while he was speaking; the language of which is, cursed is everyone that does not constantly and perfectly perform what is contained in it, Deuteronomy 27:26.

which I commanded your fathers in the day that I brought them forth out of the land of Egypt from the iron furnace, saying, “Obey My voice, and do them, according to all which I command you; so shall ye be My people and I will be your God,” — according to all I command you; everything was to be done that was commanded, and a perfect and uniform obedience is to be yielded to the law, in order to enjoy the blessing, or a penalty is incurred.

that I may perform the oath which I have sworn unto your fathers to give them a land flowing with milk and honey, as it is this day.’” Then answered I, and said, “So be it, O Lord.” — that I may perform the oath which I have sworn unto your fathers, the special promises given to Abraham, Isaac, and Jacob, Deuteronomy 7:8;

— to give them a land flowing with milk and honey, as it is this day, this beautiful and rich land being still in the possession of the children of Israel. 

Then the Lord said unto me, “Proclaim all these words in the cities of Judah and in the streets of Jerusalem, saying, ‘Hear ye the words of this covenant and do them. — proclaim all these words in the cities of Judah, and in the streets of Jerusalem: with a loud voice, and openly, that all may hear.

For I earnestly protested unto your fathers in the day that I brought them up out of the land of Egypt, even unto this day, rising early and protesting, saying, “Obey My voice.”

Yet they obeyed not, nor inclined their ear, but walked every one in the imagination of their evil heart. Therefore I will bring upon them all the words of this covenant, which I commanded them to do, but they did them not.’”

And the Lord said unto me, “A conspiracy is found among the men of Judah and among the inhabitants of Jerusalem.

10 They have turned back to the iniquities of their forefathers, who refused to hear My words, and they went after other gods to serve them. The house of Israel and the house of Judah have broken My covenant which I made with their fathers. — in previous verses God’s words were usually directed against Jerusalem, the inhabitants of Jerusalem, their elders and priests, but here, it is to the house of Israel again.

11 Therefore thus saith the Lord: ‘Behold, I will bring evil upon them, which they shall not be able to escape; and though they shall cry unto Me, I will not hearken unto them. — and though they shall cry unto me, I will not hearken unto them: because their prayers were hypocritical, and not attended true repentance; otherwise, when men cry to God, under a sense of sin, being truly sorry for it, he hears them, and delivers them;

— but these would be concerned only for the evil that was come upon them, and not the evil they had been guilty of; and such sinners, when they pray to him, the Lord hears not;

— the Targum says, “and they shall pray before me, and I will not receive their prayers.”

12 Then shall the cities of Judah and inhabitants of Jerusalem go and cry unto the gods unto whom they offer incense; but they shall not save them at all in the time of their trouble. — go and cry unto the gods unto whom they offer incense; Baal; to Astarte, the queen of heaven; to a Christianised Mithra, the Persian sun-god, who was born on December 25th, on the winter solstice; to the moon, planets, and other hosts of heaven.

13 For according to the number of thy cities were thy gods, O Judah; and according to the number of the streets of Jerusalem have ye set up altars to that shameful thing, even altars to burn incense unto Baal.’ — for according to the number of thy cities were thy gods, O Judah, practically a different idol for every city; and according to the number of the streets of Jerusalem have ye set up altars, a different one for every open place;

— to that shameful thing, to the idol which is the essence of all that is shameful and even altars to burn incense unto Baal, this idol being the chief abomination of the Canaanite nations since remote times. The Lord, having thus set forth the wickedness of Judah, turns to His prophet with the command that he should not interfere with His just punishment upon the apostate nation.

14 “Therefore pray not thou for this people, neither lift up a cry or prayer for them; for I will not hear them in the time that they cry unto Me for their trouble. — the Targum understands this of the prayers of the prophet for them, paraphrasing the words thus,”for there is no acceptance before me (or it is not pleasing to me) when thou shall pray for them before me, in the time of their evil;”

— neither their prayers, nor the prophet’s for them, would be acceptable to God, or of any avail, he being determined to bring evil upon them.

15 What hath My beloved to do in Mine house, seeing she hath wrought lewdness with many, and the holy flesh is passed from thee? When thou doest evil, then thou rejoicest.

16 The Lord called thy name, ‘A Green Olive Tree,’ fair and of goodly fruit. With the noise of a great tumult He hath kindled fire upon it, and the branches of it are broken.

17 For the Lord of hosts, who planted thee, hath pronounced evil against thee for the evil of the house of Israel and of the house of Judah, which they have done against themselves to provoke Me to anger in offering incense unto Baal.” — for the evil of the house of Israel; the ten tribes, who had committed sin, and for which the evil pronounced had been executed on them already, being some time ago carried captive:

— a message to the house of Israel again; this reminder could be historic but more probably, it is prophetic: the evil of whose heinous sins shall be followed with most dreadful punishments.

18 And the Lord hath given me knowledge of it, and I know it; then Thou showed me their doings.

19 But I was like a lamb or an ox that is brought to the slaughter; and I knew not that they had devised devices against me, saying, “Let us destroy the tree with the fruit thereof, and let us cut him off from the land of the living, that his name may be no more remembered.” — like a lamb or an ox; the Targum translates it “as a choice lamb;”

— that is brought to the slaughter; to be sacrificed or killed by the butcher; so ignorant was the prophet of the designs of his townsmen against him, and not at all jealous that they wished him ill; since he meant none to them, but sought their good:

— let us destroy the tree with the fruit thereof and let us cut him off from the land of the living that his name may be no more remembered; they wanted to bring ruin, if possible, death, to Jeremiah and his family and cause his warning be buried; or be forgotten. Therefore the prophet calls upon the Lord for vengeance in his just cause.

20 But, O Lord of hosts, who judgest righteously, who triest the reins and the heart, let me see Thy vengeance on them, for unto Thee have I revealed my cause. — but, O Lord of hosts, that judgest righteously… this is the prophet’s appeal to God, as the Judge of the whole earth, who will do right; he found there was no justice to be done him among men; he therefore has recourse to a righteous God, who he knew judged righteous judgement:

— let me see thy vengeance on them; the Targum says “I shall see the vengeance of thy judgement on them;”

— for unto thee have I revealed my cause; as a client to his patron; told his whole case, and left it with him, believing he would execute justice for him.

21 “Therefore thus saith the Lord of the men of Anathoth, who seek thy life, saying, ‘Prophesy not in the name of the Lord, that thou die not by our hand’ — saying, prophesy not in the name of the Lord; without their leave, and such hard things as he did, unless he would prophesy smooth things, and then he might go on, otherwise he must expect to die:

— that thou die not by our hand; or means; they intimate, that, should he persist in prophesying, they should not stay to carry on a judicial process against him, before a judge or the Sanhedrin, but should do as those called zealots in later times did; lay violent hands upon him.

22 therefore thus saith the Lord of hosts: ‘Behold, I will punish them: the young men shall die by the sword, their sons and their daughters shall die by famine. — the young men shall die by the sword, being cut down by the enemy in battle, their sons and their daughters shall die by famine, the result of the unmerciful siege begun by the enemies.

23 And there shall be no remnant of them; for I will bring evil upon the men of Anathoth, even the year of their visitation.’” — And there shall be no remnant of them, the Lord being determined to carry out His sentence of extermination upon them;

— this seems more prophetic than historical; for during their historical moment their remnants were carried off to either Assyria for the house of Israel or to Babylon for the house of Judah; so if there is no remnant left then it has to be prophetic, into our time;

— but in the book of Ezekiel more details were given about putting an end to even the remnants. Ezekiel 11:13 And it came to pass when I prophesied, that Pelatiah the son of Benaiah died. Then fell I down upon my face, and cried with a loud voice and said, “Ah, Lord God! Wilt Thou make a full end of the remnant of Israel?” — the conditions around Israel would be so bad that those few, if any, who survive would ask, “Would God make a full end to the remnant of Israel?”

Jeremiah 12

1 Righteous art Thou, O Lord, when I plead with Thee; yet let me talk with Thee of Thy judgements: Why doth the way of the wicked prosper? Why are all they happy that deal very treacherously? — yet let me talk with thee of thy judgements; of his laws, statutes, word, and ordinances;

— the Targum says, “but I will ask a question of judgements before thee;” things that are right; that are agreeable to the word of God and sound reason; things that are consistent with God, particularly his justice;

— why doth the way of the wicked prosper? Why is it that they seem to be fortunate in all their dealings?  Why are their designs and projects successful? 

— why are they all happy that deal very treacherously? How may the fact be explained that the very ones who are guilty of the worst perfidy, who practice the basest knavery, live in peace?

Thou hast planted them, yea, they have taken root; they grow, yea, they bring forth fruit. Thou art near in their mouth, but far from their reins. — thou art near in their mouth; they often made use of the name of God, either in swearing by it, or praying to him in an external manner; they called themselves the Lord’s people, and boasted of being his priests, and employed in his service; they took his covenant, and the words of his law, into their mouths, and taught them the people, and yet had no sincere regard for these things:

— and far from their reins; from the affections of their hearts, and the desires of their souls; they had no true love for God, nor fear of him, nor faith in him. The Targum says, “near are the words of thy law in their mouth, and far is thy fear from their reins.”

But Thou, O Lord, knowest me; Thou hast seen me and tried mine heart toward Thee. Pull them out like sheep for the slaughter, and prepare them for the day of slaughter. — prepare them for the day of slaughter; or, “sanctify them”; set them apart for it: this, doubtless, refers to the time of Jerusalem’s destruction by the Chaldeans.

How long shall the land mourn and the herbs of every field wither, for the wickedness of them that dwell therein? The beasts are consumed, and the birds, because they said, “He shall not see our last end.”

“If thou hast run with the footmen and they have wearied thee, then how canst thou contend with horses? And if in the land of peace, wherein thou trusted, they wearied thee, then how wilt thou do in the swelling of the Jordan?

For even thy brethren and the house of thy father, even they have dealt treacherously with thee; yea, they have called a multitude after thee; believe them not, though they speak fair words unto thee.

“I have forsaken Mine house, I have left Mine heritage; I have given the dearly beloved of My soul into the hand of her enemies. — I have forsaken my house… the temple, where the Lord took up his residence; this was fulfilled in the first temple, when it was destroyed by the Chaldeans; and more fully in the second, when that voice was heard in it, a little before the destruction of Jerusalem, as Josephus relates, “let us go hence;”

— the Targum says, “I have forsaken the house of my sanctuary.”

Mine heritage is unto Me as a lion in the forest: it crieth out against Me; therefore have I hated it.

Mine heritage is unto Me as a speckled bird: the birds round about are against her. Come ye, assemble all the beasts of the field; come to devour.

10 Many shepherds have destroyed My vineyard, they have trodden My portion under foot, they have made My pleasant portion a desolate wilderness. — many shepherds have destroyed my vineyard… this is a metaphor not just applying to the heathens, Nebuchadnezzar and his generals, but often apply to the elders and princes of Israel and Judah; shepherds that destroyed them are from with their own elders, princes or governors, civil or religious;

— the Targum paraphrases it, “many kings slay my people.”

11 They have made it desolate, and being desolate it mourneth unto Me; the whole land is made desolate, because no man layeth it to heart.

12 The despoilers are come upon all high places through the wilderness; for the sword of the Lord shall devour from the one end of the land even to the other end of the land. No flesh shall have peace. — the spoilers are come upon all high places through the wilderness… of Judea; or which lay between Chaldea and Judea, through which the Chaldean army came; called here the “spoilers”, because they spoiled and plundered all places where they came;

— for the sword of the Lord shall devour from the one end; of the land even the other end of the land; the sword of the Chaldeans is called the sword of the Lord, because it was drawn by his order and appointment, and by him to do execution, and the calamity thereof;

— no flesh shall have peace; no inhabitant of Judea shall be in safety, but be exposed to the sword, or to captivity.

13 They have sown wheat, but shall reap thorns; they have put themselves to pain, but shall not profit; and they shall be ashamed of your produce because of the fierce anger of the Lord.

14 “Thus saith the Lord against all Mine evil neighbours, who touch the inheritance which I have caused My people Israel to inherit: Behold, I will pluck them out of their land, and pluck out the house of Judah from among them. — “evil neighbours”: the Egyptians, Philistines, Moabites, Ammonites, Edomites, Tyre, and Sidon; whom the Lord calls his neighbours, because they were near the land of Canaan, where his people dwelt, his presence, and where the temple was in which he took up his residence; and his “evil” neighbours, because they often distressed and afflicted his people;

— behold, I will pluck them out of their land; cause them to be carried captive into other lands, or be destroyed on their own; see Jeremiah chapters forty six through forty nine: and pluck out the house of Judah from among them; such of the Jews they had formerly carried captive, or who had fled to them upon the Chaldean invasion; these the Lord would cause to come forth from among them, and return them to their own land.

15 And it shall come to pass after I have plucked them out, I will return and have compassion on them, and will bring them back, every man to his heritage and every man to his land. — and will bring them again every man to his heritage; thus, after God had threatened severe judgements upon several countries, he promises of their return from their captivity in the latter days; which probably relates chiefly to their conversion seems to indicate the conversion of the Gentiles in the latter day, when the fullness of them shall be brought in.

16 And it shall come to pass, if they will diligently learn the ways of My people, to swear by My name, ‘The Lord liveth,’ as they taught My people to swear by Baal, then shall they be built in the midst of My people. — then shall they be built in the midst of my people; become part of the building of God’s physical and spiritual government; being laid upon the same foundation of the patriarchs, the prophets and the apostles;

— the Targum says, “and they shall be established in the midst of my people.”

17 But if they will not obey, I will utterly pluck up and destroy that nation,” saith the Lord. — I will utterly pluck up and destroy that nation, saith the Lord: root it up from being a nation, strip it of all its privileges and enjoyments, and destroy it with an everlasting destruction; see Zechariah 14:16.

Jeremiah (Ch 9-10)

•November 5, 2021 • Leave a Comment

In the next two chapters, Jeremiah sympathises with the calamities of his people, that they should humble themselves before the mighty hand of God. It begins with an exhortation to hear the word of the Lord, and not to learn the way of the heathens, since their customs were in vain, which lead on to expose their idols, and against the greatness and glory of God.

The list of kings of Judah towards the end; in successive reigns, as Jehoahaz (reign 609), Jehoiakim (reign 609–598), Jehoiachin or Jechonias (reign 598–597), and Zedekiah (reign 597–586).

Jeremiah 9

1 Oh, that my head were waters and mine eyes a fountain of tears, that I might weep day and night for the slain of the daughter of my people!

Oh, that I had in the wilderness a lodging place for wayfaring men, that I might leave my people, and go from them! For they are all adulterers, an assembly of treacherous men.

“And they bend their tongues like their bow for lies, but they are not valiant for the truth upon the earth; for they proceed from evil to evil, and they know not Me,” saith the Lord. — and they bend their tongues like their bow for lies… their tongues were like bows, and their lying words like arrows, which they directed against persons to their injury; see Psalms 11:2, or, “like their deceitful bow” to which the Targum agrees, “they teach their tongues words of falsehood, they are like to a deceitful bow.”

— the words may be rendered, “they bend their tongues, their bow is a lie” either deceitful, or carries a lie in it, and shoots one out of it.

“Take ye heed every one of his neighbor, and trust ye not in any brother; for every brother will utterly supplant, and every neighbor will walk with slanders.

And they will deceive every one his neighbor, and will not speak the truth. They have taught their tongue to speak lies, and weary themselves to commit iniquity. — they have taught their tongue to speak lies; the tongue, as it were, being almost compelled, as though unwilling to become guilty of so much wickedness, and become so accustomed to lying that they cannot do otherwise; it is as it were natural to them:

— Ephraim compasseth me about with lies, and the house of Israel with deceit; but Judah yet ruleth with God, and is faithful with the saints, Hosea 11:12;

— Ephraim is prone to telling lies, or a chronic liar; full of deceits (more at the end)

Thine habitation is in the midst of deceit; through deceit they refuse to know Me,” saith the Lord.

Therefore thus saith the Lord of hosts: “Behold, I will melt them and try them; for how else shall I do for the daughter of My people?

Their tongue is as an arrow shot out; it speaketh deceit: one speaketh peaceably to his neighbor with his mouth, but in heart he lieth in wait.

Shall I not visit them for these things?” saith the Lord. “Shall not My soul be avenged on such a nation as this?”

10 For the mountains will I take up a weeping and wailing, and for the habitations of the wilderness a lamentation, because they are burned up, so that none can pass through them; neither can men hear the voice of the cattle; both the fowl of the heavens and the beast have fled; they are gone.

11 “And I will make Jerusalem heaps and a den of dragons; and I will make the cities of Judah desolate, without an inhabitant.”

12 Who is the wise man that may understand this? And who is he to whom the mouth of the Lord hath spoken, that he may declare it? For why has the land perished and burned up like a wilderness, that none passeth through? — nobody seems to understand the various symbols and riddles in the book of Ezekiel to put all the puzzles into a cohesive and coherent picture;

— Jews couldn’t understand what or how the house of Israel could have any relevance since the days they went into exile; Christians taught themselves that they have already replaced the Israelites and God’s graceful promises of eternity are now theirs! Hence neither understand the meaning in “The crown of pride, the drunkards of Ephraim, shall be trodden under feet” Isaiah 28:3.

13 And the Lord saith, “Because they have forsaken My law which I set before them, and have not obeyed My voice, neither walked therein,

14 but have walked after the imagination of their own heart, and after the Baalim, which their fathers taught them.”

15 Therefore thus saith the Lord of hosts, the God of Israel: “Behold, I will feed them, even this people, with wormwood and give them water of gall to drink. — the word rendered wormwood here, it seems, signifying an herb which is not only bitter and nauseous, but also noxious; hence the Targum says, “I will bring tribulation upon them, bitter as wormwood:”

— and give them water of gall to drink; meaning either of the entrails of a beast so called, or of the juice of the herb hemlock, as the word is rendered in Hosea 10:4, as poison of a serpent, and so the Targum says, “and I will give them the cup of cursing to drink as the heads of serpents:” signifying that their punishment would be very severe, though just;

— thus they believe in fantasies; of bunnies and eggs, or a Santa ho-ho-ho, or praying to a non existent holy ghost in their foreheads.

16 I will scatter them also among the nations, whom neither they nor their fathers have known; and I will send a sword after them till I have consumed them.” — yes, this enemy is coming from the SOUTH:

Ezekiel 20:45 Moreover the word of the Lord came unto me, saying,
46 “Son of man, set thy face toward the south, and drop thy word toward the south, and prophesy against the forest of the southland.
47 And say to the forest of the south: ‘Hear the word of the Lord. Thus saith the Lord God: Behold, I will kindle a fire in thee, and it shall devour every green tree in thee and every dry tree. The flaming flame shall not be quenched, and all faces from the south to the north shall be burned therein.
48 And all flesh shall see that I, the Lord, have kindled it; it shall not be quenched.’”
49 Then said I, “Ah, Lord God! They say of me, ‘Doth he not speak parables?’”
Ezekiel 21: And the word of the Lord came unto me, saying,
2 “Son of man, set thy face toward Jerusalem, and drop thy word toward the holy places, and prophesy against the land of Israel;
3 and say to the land of Israel, ‘Thus saith the Lord: Behold, I am against thee, and will draw forth My sword out of his sheath and will cut off from thee the righteous and the wicked.
4 Seeing then that I will cut off from thee the righteous and the wicked, therefore shall My sword go forth out of his sheath against all flesh from the south to the north,
5 that all flesh may know that I, the Lord, have drawn forth My sword out of his sheath. It shall not return any more.’

Q: Who is this enemy from the SOUTH, and it warns “My sword out of his sheath and will cut off from thee the righteous and the wicked” and should we be curious how such scenarios would be played out?

17 Thus saith the Lord of hosts: “Consider ye, and call for the mourning women, that they may come; and send for skillful women, that they may come.

18 And let them make haste and take up a wailing for us, that our eyes may run down with tears and our eyelids gush out with waters.

19 For a voice of wailing is heard out of Zion: ‘How are we despoiled! We are greatly confounded, because we have forsaken the land, because our dwellings have cast us out.’”

20 Yet hear the word of the Lord, O ye women, and let your ear receive the word of His mouth, and teach your daughters wailing, and every one her neighbor lamentation.

21 For death is come up into our windows, and is entered into our palaces, to cut off the children from without, and the young men from the streets.

22 Speak, “Thus saith the Lord: ‘Even the carcasses of men shall fall as dung upon the open field, and as the handful after the harvestman, and none shall gather them.’”

23 Thus saith the Lord: “Let not the wise man glory in his wisdom, neither let the mighty man glory in his might; let not the rich man glory in his riches. — thus saith the Lord, let not the wise man glory in his wisdom, not in his natural wisdom, or knowledge of natural things: this is often but an appearance of wisdom, but to a true knowledge of God; 

— let not the rich man glory in his riches; these come of the hand of God, and these cannot profit in a day of wrath, nor deliver from death, corporeal, spiritual, or eternal;

— the Targum paraphrases them thus, “thus saith the Lord, let not Solomon the son of David the wise man praise (or please himself) in his wisdom; nor let Samson the son of Manoah the mighty man please himself in his might.”

24 But let him that glorieth glory in this: that he understandeth and knoweth Me, that I am the Lord who exercise lovingkindness, judgement, and righteousness in the earth; for in these things I delight,” saith the Lord.

25 “Behold, the days come,” saith the Lord, “that I will punish all them that are circumcised with the uncircumcised—

26 Egypt, and Judah, and Edom, and the children of Ammon, and Moab, and all that are in the utmost corners, that dwell in the wilderness. For all these nations are uncircumcised, and all the house of Israel are uncircumcised in the heart.” — the house of Judah and the house of Israel are listed among the heathens here.

Jeremiah 10

1 Hear ye the word which the Lord speaketh unto you, O house of Israel. — in previous chapters God’s words were usually directed against Jerusalem, the elders of Judah and priests, but pop here, it is to the O house of Israel;

— but other chapters were also directed at Israel: “Hear ye the word of the Lord, O house of Jacob, and all the families of the house of Israel,” (Jeremiah 2:4,26). So the rest of Jeremiah should be read in this context.

Thus saith the Lord: “Learn not the way of the heathens, and be not dismayed at the signs of heaven; for the heathen are dismayed at them. — of the nations round about them, particularly the Chaldeans, whom the Jews were destined to live in captivity; meaning their religious ways, their ways of worship, their superstition and idolatry, and yet they learn from them; from the Samaritans to the Chaldeans;

— and be not dismayed at the signs of heaven; the Chaldeans were addicted to astrology, and attributed to the heavenly bodies a considerable influence over human affairs. This naturally tended to beget a religious dread and awe of those objects: the sun, moon, and planets are said to have been set in the firmament for signs; from the eclipse of the sun to the eclipse of the moon.

For the customs of the people are vain; for one cutteth a tree out of the forest, the work of the hands of the workman, with the ax. — while it is true that many ancient pagans started with just a palm tree and progressed to any associated evergreen trees with the supernatural and decorating their homes with cuttings from them, it is also clear that further association of evergreen trees with the Christmas holiday is a continuous development into our more sophisticated Christian era;

They deck it with silver and with gold; they fasten it with nails and with hammers, that it move not.

They are upright as the palm tree, but speak not; they must be borne, because they cannot go. Be not afraid of them, for they cannot do evil, neither also is it in them to do good.” — according to History.com, “Germany is credited with starting the Christmas tree tradition as we now know it in the 16th century when devout Christians brought decorated trees into their homes. Some built Christmas pyramids of wood and decorated them with evergreens and candles if wood was scarce. It is a widely held belief that Martin Luther, the 16th-century Protestant reformer, first added lighted candles to a tree. Walking toward his home one winter evening, composing a sermon, he was awed by the brilliance of stars twinkling amidst evergreens. To recapture the scene for his family, he erected a tree in the main room and wired its branches with lighted candles,” see History of Christmas Trees;

today, we worship Mithra or Mitra (the Sun-God whose birthday many drunks honor and celebrate on December 25th which we christianised as Christmas), Zeus and others; called “gods of the earth” in distinction from the God of heaven; and men shall worship these earthly gods, acknowledging their supremacy, everyone from his place today, Protestants or Catholics alike.

— thus saith the Lord: “Learn not the way of the heathens. . .” verse 2 above; His wrath and subsequent judgement is the central theme of Jeremiah’s message against idolatrous worship!

Inasmuch as there is none like unto Thee, O Lord—Thou art great, and Thy name is great in might”

who would not fear Thee, O King of nations? For to Thee doth it appertain, inasmuch as among all the wise men of the nations and in all their kingdoms, there is none like unto Thee. — the Targum renders it, “King of all people;”

— among all the wise men of the nations and in all their kingdoms there is none like unto Thee; no matter where a person searches for a god who might stand a comparison with Yehovah, the quest will be useless: He, Yehovah alone, is the only Being worthy of worship.

But they are altogether brutish and foolish; the stock is a doctrine of vanities.

Silver beaten into plates is brought from Tarshish, and gold from Uphaz, the work of the workman and of the hands of the founder. Blue and purple is their clothing; they are all the work of skillful men.

10 But the Lord is the true God; He is the living God and an everlasting King. At His wrath the earth shall tremble, and the nations shall not be able to abide His indignation. — at His wrath the earth shall tremble, shrinking back in terror before His living wrath, as the children of Israel had experienced at Mount Sinai.

11 “Thus shall ye say unto them: ‘The gods that have not made the heavens and the earth, even they shall perish from the earth and from under these heavens.’”

12 He hath made the earth by His power; He hath established the world by His wisdom, and hath stretched out the heavens by His discretion.

13 When He uttereth His voice, there is a multitude of waters in the heavens; and He causeth the vapors to ascend from the ends of the earth. He maketh lightning with rain, and bringeth forth the wind out of His treasuries.

14 Every man is brutish in his knowledge; every founder is confounded by the graven image; for his molten image is falsehood, and there is no breath in them.

15 They are vanity and the work of errors; in the time of their visitation they shall perish. — and the work of errors, of deceit and mockery, causing their worshipers to be mocked and derided when the nothingness of the idols becomes evident; 

— in the time of their visitation they shall perish, that is, when God shall punish the idol-worshippers, the idols themselves shall likewise perish.

16 The portion of Jacob is not like them, for He is the Former of all things; and Israel is the rod of His inheritance; the Lord of hosts is His name.

17 Gather up thy wares out of the land, O inhabitant of the fortress.

18 For thus saith the Lord: “Behold, I will sling out the inhabitants of the land this once, and will distress them, that they may find it so.”

19 Woe is me for my hurt! My wound is grievous; but I said, “Truly this is a grief, and I must bear it.”

20 My tabernacle is despoiled, and all my cords are broken; my children are gone forth from me, and they are no more; there is none to stretch forth my tent any more, and to set up my curtains.

21 For the pastors are become brutish, and have not sought the Lord; therefore they shall not prosper, and all their flocks shall be scattered.

22 Behold, the noise of the clamor is come, and a great commotion out of the north country, to make the cities of Judah desolate, and a den of dragons. — here in Jeremiah, the house of Judah had been constantly warned of an enemy coming out from the North, but in Ezekiel 20-21, the house of Israel had been warned of a yet ‘unknown’ enemy of the future coming from the opposite direction, the South.

23 O Lord, I know that the way of man is not in himself; it is not in man that walketh to direct his steps.

24 O Lord, correct me, but with judgment, not in Thine anger, lest Thou bring me to nothing.

25 Pour out Thy fury upon the nations that know Thee not, and upon the families that call not on Thy name; for they have eaten up Jacob, and devoured him and consumed him, and have made his habitation desolate.

~~~

Ephraim is prone to telling lies; full of deceits:

Below are some classic examples of lying and deceits in the house of Ephraim for reflection:

The Gulf of Tonkin incident was a perceived confrontation that led to the United States engaging in the Vietnam War. It involved a falsely claimed clash between ships of North Vietnam and the United States in the waters of the Gulf of Tonkin. The original American report blamed North Vietnam for an attack on the USS Maddox, but the Pentagon Papers, the memoirs of Robert McNamara, and NSA publications from 2005, proved that the US government lied to justify a war against Vietnam. 

The outcome of this deception was the passage by US Congress of the Gulf of Tonkin Resolution, which granted President Lyndon Johnson the authority and justification for deploying US forces against “communist aggression”. 

“But I want to say one thing to the American people. I want you to listen to me. I’m going to say this again: I did not have sexual relations with that woman, Miss Lewinsky. I never told anybody to lie. Not a single time. Never,” Bill Clinton testified before the nation, Jan. 26, 1998. For his deceit, Clinton became the second president in American history impeached by the House of Representatives.

In an August 2002 speech that kicked off the Bush White House administration’s campaign for war against Iraq, Cheney asserted, “Simply stated, there’s no doubt that Saddam Hussein now has weapons of mass destruction. There is no doubt he is amassing them to use against our friends, against our allies, and against us.”

In October 2002, the late Defense Secretary Donald Rumsfeld claimed he had “bullet-proof” evidence that Saddam was tied to Osama bin Laden. And a National Intelligence Estimate said Iraq had “continued its weapons of mass destruction program.”

“However, there is no doubt at all that the development of weapons of mass destruction by Saddam Hussein poses a severe threat not just to the region, but to the wider world.” – Tony Blair, House of Commons, 10 April 2002.

Prime Minister Tony Blair defended himself in 2005: “I have never told a lie. No. I don’t intend to go telling lies to people. I did not lie over Iraq.”

Colin Powell, the former and late Secretary of State and Joint Chiefs of Staff in an interview on CNN’s “State of the Union” on June 7, 2020, called Donald Trump a chronic liar. “The one word I have to use with respect to what he’s been doing for the last several years is the word I would never have used before, never would have used with any of the four presidents I worked for, he lies,” said Colin Powell. “He lies about things. And he gets away with it because people will not hold him accountable.”

Jeremiah (Ch 7-8)

•November 4, 2021 • 1 Comment

We have read of the house of Israel and the house of Judah both have idolatries, but what are they? Perhaps, the following chapters could shed further light giving us more details about what walking after other gods means. (1) Astarte, the queen of heaven; from whom Easter is derived; (2) worshipping of heavenly bodies, especially the Sun, hence professing Christians have shifted the Sabbath from Saturday to Sunday by outlawing the keeping of the Sabbath.

Jeremiah 7

The word that came to Jeremiah from the Lord, saying:

“Stand in the gate of the Lord’S house, and proclaim there this word and say, ‘Hear the word of the Lord, all ye of Judah, who enter in at these gates to worship the Lord! — stand in the gate of the Lord’s house… that is, of the temple, and the court of it. This gate is believed to be the eastern gate, which was the principal gate of all; see Jeremiah 26:2:

— and proclaim there this word, and say; with a loud voice, as follows: hear ye the word of the Lord, all ye of Judah; the inhabitants of the several parts of Judea, which came to the temple to worship; very probably it was a feast day, either the Passover, or Pentecost, or feast of Tabernacles, when all the males in Israel appeared in court:

— that enter in at these gates to worship the Lord; there were seven gates belonging to the court, three on the north, three on the south, and one in the east, the chief of all;

— the names of them were these; on the south side were these three, the watergate, the gate of the firstlings; or the gate of offering, and the gate of kindling;

— on the north were these three, the gate Nitzotz, called also the gate of the song, the gate Korban, sometimes called the gate of women, and Beth Moked;

— and the gate in the east was the gate Nicanor, and this gate was the most frequented; and therefore Jeremiah was ordered to stand here, and deliver his message.

Thus saith the Lord of hosts, the God of Israel: Amend your ways and your doings, and I will cause you to dwell in this place.

Trust ye not in lying words, saying, “The temple of the Lord, the temple of the Lord, the temple of the Lord are these.” — these were the lying words on which they trusted, and against trusting in which the prophet here solemnly cautions them;

— the three-fold repetition of the words, the temple of the Lord, was, because every Jew was obliged to visit the temple thrice a year. But it seems more likely that they are thus repeated, to express the confident and reiterated boasts of the temple;

— trust ye not in lying words… in the words of the lying prophets, as the Targum, “do not trust in lying words, for the false prophets do not profit you in anything;”

— the Septuagint version is, “trust not in yourselves, in lying words.”

For if ye thoroughly amend your ways and your doings, if ye thoroughly execute judgement between a man and his neighbor,

if ye oppress not the stranger, the fatherless, and the widow, and shed not innocent blood in this place, neither walk after other gods to your hurt,

then will I cause you to dwell in this place, in the land that I gave to your fathers, for ever and ever.

“‘Behold, ye trust in lying words that cannot profit.

Will ye steal, murder, and commit adultery, and swear falsely, and burn incense unto Baal, and walk after other gods whom ye know not,

10 and come and stand before Me in this house which is called by My name, and say, “We are delivered” — to do all these abominations?

11 Has this house, which is called by My name, become a den of robbers in your eyes? Behold, even I have seen it, saith the Lord.

12 “‘But go ye now unto My place which was in Shiloh, where I set My name at the first, and see what I did to it because of the wickedness of My people Israel. — but go ye now unto my place, which was in Shiloh, a city in the tribe of Ephraim, on the north of Bethel, and not far from Shechem;

— here were the tabernacle, the ark and altar of the Lord, and the sacrifices; and therefore the tabernacle is called the tabernacle of Shiloh; and here the Lord calls it his place; the place of the house of his Shekinah.

13 And now, because ye have done all these works, saith the Lord, and I spoke unto you, rising up early and speaking, but ye heard not, and I called you, but ye answered not,

14 therefore will I do unto this house, which is called by My name, wherein ye trust, and unto the place which I gave to you and to your fathers, as I have done to Shiloh.

15 And I will cast you out of My sight, as I have cast out all your brethren, even the whole seed of Ephraim.’ — as I have cast out all your brethren, even the whole seed of Ephraim; or as the Targum says, the ten tribes; so called because Ephraim was their principal tribe and Jeroboam was their first king of the ten tribes;

— as Ephraim were carried captive off into Assyria, so would the two tribes of Judah and Benjamin; who could not expect to fare better than their brethren, who were more in number than they; and both were guilty of the same sins.

16 Therefore pray not thou for this people, neither lift up cry nor prayer for them, neither make intercession to Me; for I will not hear thee.

17 “Seest thou not what they do in the cities of Judah and in the streets of Jerusalem? — and in the streets of Jerusalem? these words, with what is said next, show the reason why the prophet was forbidden to pray for this people, and the Lord was so provoked with them as to cast them out of his sight;

— and he appeals to the prophet, and to what he saw; for what was done was done not in secret, but openly, in the very streets of the city; by which he might be sufficiently convinced it was what God wanted to do and what he determined to do with them.

18 The children gather wood, and the fathers kindle the fire, and the women knead their dough to make cakes to the queen of heaven, and to pour out drink offerings unto other gods, that they may provoke Me to anger. — the whole family involved; the children gather wood, and the fathers kindle the fire, and the women knead their dough to make cakes to the queen of heaven, the female goddess Ashtoreth, or Astarte, the counterpart of the male idol Baal, in whose honor the cakes, made of honey, fine flour, and other ingredients, bore a round, flat surface to resemble the disk of the moon,

— and to pour out drink-offerings, the libations made as sacrifices, unto other gods that they may provoke Me to anger, the expression implying design on their part, the deliberate intention to arouse His wrath;

— from the queen of heaven, Astarte; to Easter today (more at the end)

19 Do they provoke Me to anger? saith the Lord. Do they not provoke themselves to the confusion of their own faces?

20 Therefore thus saith the Lord God: Behold, Mine anger and My fury shall be poured out upon this place — upon man and upon beast, and upon the trees of the field, and upon the fruit of the ground; and it shall burn and shall not be quenched. — behold, mine anger and my fury shall be poured out upon this place; as the flood of waters was poured upon the old world, or the shower of fire and brimstone upon Sodom.

22 For I spoke not unto your fathers nor commanded them, in the day that I brought them out of the land of Egypt, concerning burnt offerings or sacrifices.

23 But this thing commanded I them, saying, “Obey My voice, and I will be your God, and ye shall be My people; and walk ye in all the ways that I have commanded you, that it may be well unto you.”

24 But they hearkened not nor inclined their ear, but walked in the counsels and in the imagination of their evil heart, and went backward and not forward. — and went backward, and not forward; they went backwards from the ways of God, and walked not in them. The Targum says, “they turned the back in my worship, and did not put my fear before their face.”

25 Since the day that your fathers came forth out of the land of Egypt unto this day, I have even sent unto you all My servants the prophets, daily rising up early and sending them.

26 Yet they hearkened not unto Me nor inclined their ear, but hardened their neck; they did worse than their fathers.’

27 “Therefore thou shalt speak all these words unto them, but they will not hearken to thee; thou shalt also call unto them, but they will not answer thee.

28 But thou shalt say unto them, ‘This is a nation that obeyeth not the voice of the Lord their God, nor receiveth correction. Truth has perished and is cut off from their mouth. — but thou shalt say unto them, this is a nation that obeyeth not the voice of the Lord, their God, being therefore classed with the heathens;

— nor receiveth correction, hardened to the point that all rebukes make no impression upon them; truth is perished, all reliability, all fidelity is lost, and is cut off from their mouth. There is a fine bit of sarcasm in this phrase, for the Jews confessed the Lord (like professing Christians today) with their mouths only, and not with their hearts.

29 “‘Cut off thine hair, O Jerusalem, and cast it away, and take up a lamentation on high places; for the Lord hath rejected and forsaken the generation of His wrath.

30 “‘For the children of Judah have done evil in My sight, saith the Lord. They have set their abominations in the house which is called by My name, to pollute it.

31 And they have built the high places of Tophet, which is in the Valley of the Son of Hinnom, to burn their sons and their daughters in the fire, which I commanded them not, neither came it into My heart. — and they have built the high places of Tophet… where was the idol Moloch; that the parents of the children that were burnt might not hear the cry of them: which is in the valley of the son of Hinnom; a valley near Jerusalem, and lay to the south of it.

32 Therefore behold, the days come, saith the Lord, that it shall no more be called Tophet, nor the Valley of the Son of Hinnom, but the Valley of Slaughter; for they shall bury in Tophet till there be no place.

33 And the carcasses of this people shall be meat for the fowls of the heaven and for the beasts of the earth; and none shall frighten them away.

34 Then will I cause to cease from the cities of Judah and from the streets of Jerusalem the voice of mirth and the voice of gladness, the voice of the bridegroom and the voice of the bride; for the land shall be desolate.

~~~

More on Astarte, Easter:

Easter (which is how you pronounce Ishtar) is originally the celebration of Ishtar, the Assyrian and Babylonian goddess of fertility and sex. Vine’s Complete Expository Dictionary of Old and New Testament Words, in its entry “Easter,” states:

“The term ‘Easter’ is not of Christian origin. It is another form of Astarte, one of the titles of the Chaldean goddess, the queen of heaven. The festival of Pasch [Passover] held by Christians in post-apostolic times was a continuation of the Jewish feast . . . From this Pasch the pagan festival of ‘Easter’ was quite distinct and was introduced into the apostate Western religion, as part of the attempt to adapt pagan festivals to Christianity” (W.E. Vine, 1985).

Ishtar was an ancient Mesopotamian goddess of war, fertility, and sex. She is featured in the Epic of Gilgamesh, and the “Ishtar Gate” was part of Nebuchadnezzar’s Babylon. Her worship involved animal sacrifices; objects made of her sacred stone, lapis lazuli; and temple prostitution.

Superimposed over an image of Ishtar are these words: “This is Ishtar: pronounced ‘Easter.’ From Ishtar the name Easter was derived. It’s well known that Easter was originally the celebration of Ishtar, the Assyrian and Babylonian goddess of fertility and sex. Her symbols (like the egg and the bunny) were and still are fertility and sex symbols.

Back at the Council of Nicaea in 325 AD, Constantine read out the letter that he would subsequently send to churches everywhere: “When the question arose concerning the most holy day of Easter it was decreed by common consent to be expedient, that this festival should be celebrated on the same day by all, in every place… Let us then have nothing in common with … the Jews” sums up one of the key movement for the establishment of Easter to be celebrated in the Church today.

After Constantine decided to Christianize the Empire, Easter was changed to represent Jesus. And everything Jewish were understood to be totally incompatible with Christianity. But at its roots, Easter is outwardly all about celebrating fertility and sex but inwardly it’s paying homage to a Mesopotamian goddess, the queen of heaven, Ishtar.

Jeremiah 8

1 “‘At that time, saith the Lord, they shall bring out the bones of the kings of Judah, and the bones of his princes, and the bones of the priests, and the bones of the prophets, and the bones of the inhabitants of Jerusalem out of their graves.

And they shall spread them before the sun and the moon and all the host of heaven, whom they have loved, and whom they have served, and after whom they have walked, and whom they have sought, and whom they have worshipped. They shall not be gathered nor be buried: they shall be for dung upon the face of the earth. — worshipping of heavenly bodies are forbidden, Deuteronomy 17:3-5, whose penalty is death;

— a parallel Scripture is in Ezekiel 8:16 “And He brought me into the inner court of the Lord’S house, and behold, at the door of the temple of the Lord, between the porch and the altar, were about five and twenty men with their backs toward the temple of the Lord and their faces toward the east; and they worshipped the sun toward the east,” thus they worshipped the sun;

— the heads of the twenty-four courses of the priesthood, led by the high priest, making up the “twenty five men” were not only worshipping the sun: they were doing so in the very temple of God, with their backs turned upon the presence of God! (more at the end)

And death shall be chosen rather than life by all the residue of them that remain of this evil family, who remain in all the places whither I have driven them, saith the Lord of hosts.’

“Moreover thou shalt say unto them, ‘Thus saith the Lord: “‘Shall they fall and not arise? Shall he turn away and not return?

Why then has this people of Jerusalem slidden back by a perpetual backsliding? They hold fast deceit, they refuse to return.

I hearkened and heard, but they spoke not aright; no man repented of his wickedness, saying, “What have I done?” Every one turned to his course, as the horse rusheth into the battle.

Yea, the stork in the heaven knoweth her appointed times; and the turtle and the crane and the swallow observe the time of their coming; but My people know not the judgement of the Lord. — as was true in those days, and so much more true today;

— Jews and Christians don’t know the the significance of the events leading to the 70 AD inferno in Jerusalem; why did the Sadducees and Essenes died in the inferno while the Pharisees and Nazarenes escaped?

— Christians don’t know what are the Oracles of God; what are the components; some claim, “we don’t need the oral law” is this true?

— Jews don’t know that the Messiah they look so much for had came, but he went off and will come again; and they will morn for him one day as one morns for his firstborn; from Sabbath to Sabbath, they read the Scriptures diligently but couldn’t identify the second person in Psalm 110:1-5;

— no body seems to understand the various symbols and riddles in the book of Ezekiel to put all the puzzles into a big picture; Jews couldn’t neither do Christians!

— nobody knows who Ephraim is, neither anyone knows about the United States; and who or where her enemy will come from and what her destination is. All are written in a coded language by Ezekiel; hence God says “but My people know not the judgement of the Lord.”

“‘How do ye say, “We are wise, and the law of the Lord is with us”? Lo, certainly in vain made he it; the pen of the scribes is in vain. — (MEV and many other translations) How do you say, “We are wise, and the law of the Lord is with us”? Certainly the lying pen of the scribes has made it into a lie.

— examples are (1) Isaiah 7:14 – a “virgin” shall conceive and bear a Son – changed to a young woman which renders the text meaningless as any young woman could have a child; (2) Isaiah 9:6 “the Everlasting Father” – the Son has never been known as the father; this lying pen is just to run contrary to the characteristic of the Son; who would be the Messiah in the name of Yeshua which the Orthodox have blinded themselves in a amaze.

The wise men are ashamed; they are dismayed and taken. Lo, they have rejected the word of the Lord: and what wisdom is in them?

10 Therefore will I give their wives unto others, and their fields to them that shall inherit them. For every one from the least even unto the greatest is given to covetousness; from the prophet even unto the priest every one dealeth falsely.

11 For they have healed the hurt of the daughter of My people slightingly, saying “Peace, peace,” when there is no peace.

12 Were they ashamed when they had committed abomination? Nay, they were not at all ashamed, neither could they blush. Therefore shall they fall among them that fall; in the time of their visitation they shall be cast down, saith the Lord.

13 “‘I will surely consume them, saith the Lord. There shall be no grapes on the vine, nor figs on the fig tree, and the leaf shall fade; and the things that I have given them shall pass away from them.’”

14 Why do we sit still? Assemble yourselves, and let us enter into the fortified cities, and let us be silent there. For the Lord our God hath put us to silence, and given us water of gall to drink, because we have sinned against the Lord.

15 We looked for peace, but no good came; and for a time of health, and behold, trouble!

16 The snorting of His horses was heard from Dan; the whole land trembled at the sound of the neighing of His strong ones. For they have come and have devoured the land and all that is in it, the city and those that dwell therein.

17 “For behold, I will send serpents, cockatrices, among you, which will not be charmed, and they shall bite you,” saith the Lord.

18 When I would comfort myself against sorrow, my heart is faint within me.

19 Behold the voice of the cry of the daughter of my people, because of them that dwell in a far country: “Is not the Lord in Zion? Is not her King in her?” “Why have they provoked Me to anger with their graven images and with strange vanities?”

20 “The harvest is past, the summer is ended, and we are not saved!”

21 For the hurt of the daughter of my people am I hurt; I am black; astonishment hath taken hold on me.

22 Is there no balm in Gilead? Is there no physician there? Why then is not the health of the daughter of my people recovered?

~~~

Facing the East, worshipping the Sun:

— the worship of heavenly bodies was against God’s will which Moses had warned the people (Deuteronomy 4:19, 17:3, whose penalty is to be stoned to death, Deuteronomy 17:5 ’till they die). Those 25 men in Ezekiel 8:16 corrupted themselves by worshipping the sun; and so the Targum renders it, “and, lo, they corrupted themselves, worshipping facing the east the sun; their backs toward the temple of the Lord” — they turned their backs against the most holy place; which is an aggravation of their impiety; casting the utmost contempt for God:

Moses’ warnings in Deuteronomy 17

3 And [if you] hath gone and served other gods and worshipped them, either the sun or moon or any of the host of heaven, which I have not commanded, 4 and it be told thee, and thou hast heard of it and inquired diligently, and behold, it be true and the thing certain that such abomination is wrought in Israel, 5 then shalt thou bring forth that man or that woman who has committed that wicked thing unto thy gates, even that man or that woman, and shalt stone them with stones till they die. Deuteronomy 17:3-5

The following quotation show that the first Christians understood the Sabbath but were made forbidden and gathered for worship on Sunday: “Christians should not Judaize and should not be idle on the Sabbath, but should work on that day; they should, however, particularly reverence the Lord’s day and, if possible, not work on it, because they were Christians” (Canon 29 AD 360);

— also, Days of the Week Names: “Sunday” is the Sun’s day and “Monday” is the Moon’s day. “Tuesday” is Tiw’s day; Tiw is an Anglo-Saxon god of war. “Wednesday” comes from Woden, the Anglo-Saxon king of the gods; in Saxon the name is Wodnesdaeg. “Thursday” is Thursdaeg, Thor’s day; Thor is a Norse god of thunder, lightning and storms. “Friday” is Frigedaeg, Frigga’s day; Frigg is a Norse goddess of home, marriage and fertility. “Saturday” is Saeterndaeg, Saturn’s day; Saturn is an ancient Roman god of fun and feasting;

— Months of the Year Names: January (derived from the Latin Januarius) is to honor their Roman gods Janus; and March, named for Mars, is the Roman mighty god of war; February is derived from the Februa festival or its eponymous februa (“purifications, expiatory offerings”); April relates to what the Romans called the month Aprilis; from a word meaning “to open” and further back from Aphrodite, the Greek name for the goddess of love. May – named for Maia, is the Roman goddess of spring and growth;

— June is a name attributed to Juno, the female mighty wife of Jupiter in Roman mythology. She is also called the “Queen of Heaven” and “Queen of Mighty Ones.” July is to honor Julius Caesar; the Roman Senate named it “Julius” in honor of Roman emperor Julius Caesar. August honor Julius Caesar’s successor, the emperor Augustus; and the months September, October, November, and December are archaic adjectives derived from the ordinal numbers 7 to 10;

— today, more than 98.5 percent of Christians are honouring the Sun by observing Sunday worship. They have “their backs toward the temple of the Lord and their faces toward the east; and they worshipped the SUN toward the east; whose Godly penalty is to be stoned to death – ’till they die.

— also, following the SUN-worshipping Samaritans, most Church of God Communities are showing their contempt for God by having their “wavesheaf offering” and Pentecost on a Sunday; always on a Sunday. And these are supposedly in God’s Sanctuary, but God says He is a jealous God, so these pretentious Christians could be spewed out of His mouth! A death penalty – ’till they die!

Jeremiah (Ch 5-6)

•November 3, 2021 • Leave a Comment

The following chapters were written around 628 BC, which is about a hundred years after the house of Israel had been exiled to Assyria, when God called upon Jeremiah to deliver his message against the elders of Jerusalem of the house of Israel of an enemy coming out from the north and an impending exile to follow if they continue with all their wickedness and idolatries.

The list of kings of Judah towards the end; in successive reigns, as Jehoahaz (reign 609), Jehoiakim (reign 609–598), Jehoiachin or Jechonias (reign 598–597), and Zedekiah (reign 597–586).

Jeremiah 5

1 “Run ye to and fro through the streets of Jerusalem, and see now and know, and seek in the broad places thereof if ye can find a man, if there be any that executeth judgement, that seeketh the truth, and I will pardon it. — run ye to and fro through the streets of Jerusalem… these are the words of the Lord to Jeremiah to go through the whole city of Jerusalem, every street of it, and that backwards and forwards, not once only, but over and over again;

— and see and seek in the broad places thereof, in the wider streets and intersections of streets, where many people come together, if ye can find a man, if there be any that executeth judgement, carrying out justice and righteousness;

— if he could find one righteous, one who executeth justice, God will grant a pardon to all the inhabitants of Jerusalem.

2 And though they say, ‘The Lord liveth,’ surely they swear falsely.”

3 O Lord, are not Thine eyes upon the truth? Thou hast stricken them, but they have not grieved; Thou hast consumed them, but they have refused to receive correction. They have made their faces harder than a rock; they have refused to return.

4 Therefore I said, “Surely these are poor, they are foolish; for they know not the way of the Lord, nor the judgement of their God. — therefore I said, Surely these are poor, their shepherds are interrupting themselves to voice an objection to the Lord; they are foolish, acting foolishly on account of their ignorance; 

— for they know not the way of the Lord nor the judgement of their God. The elites assume that only the untaught poor are guilty of such depravity, and that a better state of affairs may be expected in the higher ranks of society;

— and the on-going of today’s stories of Jeffrey Epstein, Virginia Giuffre, Ghislaine Maxwell, UK royal Prince Andrew with protection from the Queen; and those hovering around in Epstein’s private airplane: ex presidents Clinton and Trump; how are they going to face judgement from God?

5 I will get me unto the great men, and will speak unto them; for they have known the way of the Lord, and the judgment of their God.” But these have altogether broken the yoke, and burst the bonds. — I will get me unto the great men, and speak unto them… the princes, nobles, and judges, the elders of the people, the scribes and doctors of the law:

— for they have known the way of the Lord, and the judgement of their God; it might be reasonably expected that they had, having had a good education, and being at leisure from worldly business to attend to the law, and the knowledge of it, and whatsoever God had revealed in his word, both in a way of doctrine and duty.

6 Therefore a lion out of the forest shall slay them, and a wolf of the evenings shall despoil them; a leopard shall watch over their cities. Every one that goeth out thence shall be torn in pieces, because their transgressions are many, and their backslidings are increased. — wherefore a lion out of the forest shall slay them and a wolf of the evenings, one of those found in the great steppes and deserts, shall spoil them, a leopard shall watch over their cities, lurking for his prey nearby, the strongest, the most ravenous, and the swiftest of the beasts of prey being chosen as types to represent the formidable character of the Babylonian invaders; 

— every one that goeth out thence shall be torn in pieces, because their transgressions are many, and their backslidings are increased, their acts of rebellion against God had become a great multitude. That is the feature which ever makes sin so reprehensible: it always amounts to a rebellion against God, the Father of all mankind.

7 “How shall I pardon thee for this? Thy children have forsaken Me, and sworn by them that are no gods. When I had fed them to the full, they then committed adultery and assembled themselves by troops in the harlots’ houses. — how shall I pardon thee for this? It would obviously be inconsistent with God’s holiness to overlook the transgressions of Israel, to let their wickedness go unpunished. Thy children have forsaken Me and sworn by them that are no gods, or, more emphatic, “by that which is no god,” worshipping a creature of their own imagination;

— when I had fed them to the full, in distributing the blessings of His bounty, or, “I bound them by the oath of allegiance and loyalty,” but they then committed adultery, transgressing the Sixth Commandment in the most flagrant manner, probably in connection with the idolatrous customs which they accepted, 

— and assembled themselves by troops in the harlots’ houses, rushing forward in companies in their eagerness to commit this beastly sin.

8 They were as fed horses in the morning; every one neighed after his neighbor’s wife.

9 Shall I not visit for these things?” saith the Lord. “And shall not My soul be avenged on such a nation as this? — shall I not visit for these things, punishing the guilty ones to the limit, saith the Lord, and shall not my soul be avenged on such a nation as this? 

— how could His anger be withheld under such circumstances? The Lord therefore turns to the Chaldeans, calling upon them to carry out His punishment upon Israel.

10 “Go ye up upon her walls and destroy, but make not a full end; take away her battlements, for they are not the Lord’S.

11 For the house of Israel and the house of Judah have dealt very treacherously against Me,” saith the Lord. — for the house of Israel and the house of Judah, the entire nation of God’s chosen people, have dealt very treacherously against Me, saith the Lord, their faithlessness being the Lord’s chief reason for complaint.

12 They have belied the Lord, and said, “It is not He; neither shall evil come upon us, neither shall we see sword nor famine. — they have belied the Lord, denying Jehovah, the God of the covenant, and said, It is not He, insisting that He was not the true and only God;

— neither shall evil come upon us, neither shall we see sword nor famine, thus both denying and challenging the threat of the Lord regarding the punishment which He had threatened for apostasy of every kind.

13 And the prophets shall become wind, and the word is not in them; thus shall it be done unto them.”

14 Therefore, thus saith the Lord God of hosts: “Because ye speak this word, behold, I will make My words in thy mouth fire, and this people wood, and it shall devour them. — wherefore, thus saith the Lord God of hosts, the mighty Captain of the heavenly armies, because ye speak this word, behold, I will make My words in thy mouth fire, Jeremiah being given a sharp and scathing message to the rebellious people whom the Lord here puts far from Him;

— and this people wood, fuel which is easily kindled, and it shall devour them, they would be consumed as a consequence of the denunciation which Jeremiah would make by God’s command.

15 Lo, I will bring a nation upon you from afar, O house of Israel,” saith the Lord. “It is a mighty nation, it is an ancient nation, a nation whose language thou knowest not, neither understandest what they say. — O house of Israel; this saying seems a bit late, since the house of Israel had been in exiled over a hundred years ago, so this renew warning must be prophetic, for the endtime.

16 Their quiver is as an open sepulcher; they are all mighty men.

17 And they shall eat up thine harvest and thy bread, which thy sons and thy daughters should eat; they shall eat up thy flocks and thine herds; they shall eat up thy vines and thy fig trees. They shall impoverish thy fortified cities, wherein thou trusted, with the sword. — and they shall eat up thine harvest, the standing grain, and thy bread, which thy sons and thy daughters should eat, which was intended for their food;

— they shall eat up thy flocks and thine herds; they shall eat up thy vines and thy fig-trees, everything that in any manner yielded food; they shall impoverish thy fenced cities, destroying all of Israel’s proud fortresses, wherein thou trustedst, with the sword.

18 “Nevertheless in those days,” saith the Lord, “I will not make a full end with you. — nevertheless, in those days; this seems futuristic, a prophecy that when this severe punishment strikes the nation, saith the Lord, I will not make a full end with you, He would not yet bring total annihilation upon them. 

19 And it shall come to pass when ye shall say, ‘Why doeth the Lord our God all these things unto us?’ Then shalt thou answer them, ‘As ye have forsaken Me and served strange gods in your land, so shall ye serve strangers in a land that is not yours.’

20 “Declare this in the house of Jacob, and publish it in Judah, saying: — this warning is prophetic; it is meant for our time; or the lost ten tribes, it could be for those who were carried captive into Assyria before this prophecy; it is meant for the house of Israel today, yet it also have a message for the Jews, now in the land of Judea;

21 Hear now this, O foolish people and without understanding, who have eyes and see not, who have ears and hear not: — which have eyes, and see not; which have ears, and hear not; like the idols they served, Psalms 115:4 this is an upbraiding of them with their folly and stupidity, their want of common sense, their blindness and ignorance; notwithstanding they had the means of light and knowledge, the law, and the prophets.

22 Fear ye not Me?” saith the Lord. “Will ye not tremble at My presence, who have placed the sand for the bound of the sea by a perpetual decree, that it cannot pass it; and though the waves thereof toss themselves, yet can they not prevail; though they roar, yet can they not pass over it?

23 But this people hath a revolting and a rebellious heart; they have revolted and gone.

24 Neither say they in their heart, ‘Let us now fear the Lord our God, who giveth rain, both the former and the latter in his season; He reserveth unto us the appointed weeks of the harvest.’

25 Your iniquities have turned away these things, and your sins have withheld good things from you.

26 For among My people are found wicked men; they lie in wait as he that setteth snares; they set a trap, they catch men. — they lay wait as he that setteth snares; or, “they look about”; that is, every man looks in the ways, to see if a man passed by, that he might rob him of what he had; as a man that lays snares, or sets a trap to catch birds.

27 As a cage is full of birds, so are their houses full of deceit; therefore they have become great and have waxed rich. — the Targum renders it, a house or place of fattening. The word is rendered a “basket” in Amos 8:1 and may here design one in which birds taken in snares, or by hawking, were put;

— the Septuagint version, and those that follow it, render it, “a snare”: which agrees with what goes before. It seems to intend a decoy, in which many birds are put to allure others; and, what with them, and those that are drawn in by them.

28 They have waxed fat, they shine; yea, they surpass the deeds of the wicked; they judge not the cause, the cause of the fatherless, yet they prosper; and the right of the needy do they not judge.

29 Shall I not visit for these things?” saith the Lord. “Shall not My soul be avenged on such a nation as this?

30 “An astonishing and horrible thing is committed in the land:

31 The prophets prophesy falsely, and the priests bear rule by their means; and My people love to have it so. And what will ye do in the end thereof? — the prophets prophesied falsely… proclaiming lies, that the people would have peace and prosperity, and not be carried captive into Babylon, as Jeremiah and other prophets of the Lord had predicted:

— these messages are for both the house of Israel, or the lost ten tribes, and the house of Judah, who has returned to dwell in the land of Judea, names the state of Israel.

Jeremiah 6

1 “O ye children of Benjamin, gather yourselves to flee out of the midst of Jerusalem! And blow the trumpet in Tekoa, and set up a sign of fire in Bethhaccerem! For evil appeareth out of the north, and great destruction. — O ye children of Benjamin, the tribe of Benjamin was with the tribe of Judah, and Jerusalem, at least part of it, was in the tribe of Benjamin, and particularly Anathoth, which was Jeremiah’s birth place, was in that tribe; and this could be a reason why the children of Benjamin are so distinctly addressed;

— today, Tekoa is an Israeli settlement in the West Bank, located 20 km northeast of Hebron, 16 km south of Jerusalem; and Bethhaccerem; this place lay between Jerusalem and Tekoa; 

— the trumpets be blown, that it might be heard far and near; so the warning is generally to the inhabitants of Jerusalem;

— during Jeremiah’s time, he warned of an enemy coming from the North, but Ezekiel waned of an enemy coming from the South; so what is it? (more at the end)

I have likened the daughter of Zion to a comely and delicate woman. — the daughter of Zion is a comely and delicate woman; that dwells at home and lives in pleasure, in peace and quietness, in ease and security, in no fear of enemies, or apprehension of danger; and so it describes the secure state of Israel. 

The shepherds with their flocks shall come unto her; they shall pitch their tents against her round about; they shall feed every one in his place.” — the Targum says, “everyone shall help his neighbour.” The sense is, one king or general shall lay siege against a city, or against cities, and so another, until they have consumed and subdued the whole land.

“Prepare ye war against her! Arise, and let us go up at noon. Woe unto us! For the day goeth away, for the shadows of the evening are stretched out.

Arise, and let us go by night, and let us destroy her palaces.”

For thus hath the Lord of hosts said: “Hew ye down trees, and cast a mound against Jerusalem. This is the city to be visited; she is wholly oppression in the midst of her. — hew ye down trees, and cast a mount against Jerusalem: the reason is because there were ditches around the city; and into these they poured in stones, dirt, trees, pieces of wood and so filled them up, and cast up a mount, on which they could raise their batteries, and demolish the walls, making Jerusalem defenceless.

As a fountain casteth out her waters, so she casteth out her wickedness. Violence and spoil are heard in her; before Me continually are grief and wounds.

Be thou instructed, O Jerusalem, lest My soul depart from thee; lest I make thee desolate, a land not inhabited.”

Thus saith the Lord of hosts: “They shall thoroughly glean the remnant of Israel as a vine; turn back thine hand as a grapegatherer into the baskets.”

10 To whom shall I speak and give warning, that they may hear? Behold, their ear is uncircumcised and they cannot hearken; behold, the word of the Lord is unto them a reproach; they have no delight in it. — behold, their ear is uncircumcised, closed against all admonitions by their own carnal-mindedness, and they cannot hearken, owing to the hardness of their hearts, brought on by their stubborn opposition;

— behold, the Word of the Lord is unto them a reproach, a mockery and a derision; they have no delight in it.

11 Therefore I am full of the fury of the Lord; I am weary with holding in. “I will pour it out upon the children abroad, and upon the assembly of young men together; for even the husband with the wife shall be taken, the aged with him that is full of days. — I am weary with holding in, restraint was no longer a virtue; I will pour it out upon the children abroad, those playing in the streets and lanes;

— and upon the assembly of young men together; for even the husband with the wife shall be taken, the aged, the one who is just growing old, with him that is full of days. Thus the sentence of the Lord would strike all classes of people and every age without exception, the whole nation being included in the outpouring of His wrath.

12 And their houses shall be turned unto others, with their fields and wives together; for I will stretch out My hand upon the inhabitants of the land,” saith the Lord.

13 “For from the least of them even unto the greatest of them, every one is given to covetousness; and from the prophet even unto the priest, every one dealeth falsely. — from the prophet even unto the priest everyone dealeth falsely; the false prophet, as the Septuagint and other versions; the priest of Baal, both acted deceitfully; the one in prophesying lies to the people, the other in drawing them off from the pure worship of God;

— the Targum says, “from the scribe to the priest” from the lowest order of teachers to the highest in ecclesiastical office; the whole shows a most general and dreadful corruption.

14 They have healed also the hurt of the daughter of My people slightingly, saying, ‘Peace, peace,’ when there is no peace.

15 Were they ashamed when they had committed abomination? Nay, they were not at all ashamed, neither could they blush. Therefore they shall fall among them that fall; at the time that I visit them they shall be cast down,” saith the Lord.

16 Thus saith the Lord: “Stand ye in the highways and see, and ask for the old paths, where is the good way; and walk therein, and ye shall find rest for your souls. But they said, ‘We will not walk therein.’

17 Also I set watchmen over you, saying, ‘Hearken to the sound of the trumpet!’ But they said, ‘We will not hearken.’

18 Therefore hear, ye nations, and know, O congregation, what is among them. — what is among them; what sins and transgressions are committed by them; which were the cause of the Lord’s threatening them with sore judgements, and bringing them upon them; so the Targum says “and let the congregation of Israel know their sins.”

19 Hear, O earth: Behold, I will bring evil upon this people, even the fruit of their thoughts, because they have not hearkened unto My words nor to My law, but rejected it. — even the fruit of their thoughts; the Targum renders it, “the retribution or reward of their works.”

20 To what purpose cometh there to Me incense from Sheba, and the sweet cane from a far country? Your burnt offerings are not acceptable, nor your sacrifices sweet unto Me.” — your burnt offerings are not acceptable nor your sacrifices sweet unto Me; because the Lord was not deceived by outward appearances which were not in agreement with the true condition of the heart.

21 Therefore thus saith the Lord: “Behold, I will lay stumbling blocks before this people, and the fathers and the sons together shall fall upon them; the neighbor and his friend shall perish.”

22 Thus saith the Lord: “Behold, a people cometh from the north country, and a great nation shall be raised from the sides of the earth. — during Jeremiah’s time, he warned of an enemy coming from the North, but more relevant for us today, Ezekiel waned of an enemy coming from the South; so what is it? (more at the end)

— and a great nation shall be raised; that is, by the Lord, who would stir them up to this undertaking; the Targum says, “many people shall come openly.”

23 They shall lay hold on bow and spear; they are cruel and have no mercy. Their voice roareth like the sea; and they ride upon horses set in array as men for war against thee, O daughter of Zion.” — they shall lay hold on bow and spear… that is, everyone of them should be furnished with both these pieces of armour, that they might be able to fight near and afar off; they had bows to shoot arrows at a distance, and spears to strike with when near. 

24 We have heard the fame thereof; our hands wax feeble. Anguish hath taken hold of us, and pain as of a woman in travail.

25 Go not forth into the field nor walk by the way, for the sword of the enemy and fear is on every side. — and fear is on every side; all round the city, being encompassed by the Babylon army: or, the enemy’s sword “is fear on every side”; causes fear in all parts round the city;

— the Targum says, “because the sword of the enemy kills those who are gathered round about;” or on every side.

26 O daughter of my people, gird thee with sackcloth, and wallow thyself in ashes. Make thee mourning, as for an only son, most bitter lamentation; for the despoiler shall suddenly come upon us.

27 “I have set thee as a tower and a fortress among My people, that thou mayest know and try their way.

28 They are all grievous revolters, walking with slanders; they are brass and iron; they are all corrupters.

29 The bellows are burned, the lead is consumed by the fire; the founder melteth in vain, for the wicked are not plucked away.

30 Reprobate silver shall men call them, because the Lord hath rejected them.”

~~~

More on a prophecy of an “enemy” coming from the SOUTH:

Ezekiel 20:45 Moreover the word of the Lord came unto me, saying,
46 “Son of man, set thy face toward the south, and drop thy word toward the south, and prophesy against the forest of the southland.
47 And say to the forest of the south: ‘Hear the word of the Lord. Thus saith the Lord God: Behold, I will kindle a fire in thee, and it shall devour every green tree in thee and every dry tree. The flaming flame shall not be quenched, and all faces from the south to the north shall be burned therein.
48 And all flesh shall see that I, the Lord, have kindled it; it shall not be quenched.’”
49 Then said I, “Ah, Lord God! They say of me, ‘Doth he not speak parables?’”
Ezekiel 21: And the word of the Lord came unto me, saying,
2 “Son of man, set thy face toward Jerusalem, and drop thy word toward the holy places, and prophesy against the land of Israel;
3 and say to the land of Israel, ‘Thus saith the Lord: Behold, I am against thee, and will draw forth My sword out of his sheath and will cut off from thee the righteous and the wicked.
4 Seeing then that I will cut off from thee the righteous and the wicked, therefore shall My sword go forth out of his sheath against all flesh from the south to the north,
5 that all flesh may know that I, the Lord, have drawn forth My sword out of his sheath. It shall not return any more.’

Q: Who is this enemy from the SOUTH, and it warns “My sword out of his sheath and will cut off from thee the righteous and the wicked” and should we be curious how such scenarios would be played out?

Jeremiah (Ch 3-4)

•November 3, 2021 • Leave a Comment

In Chapter 2 (Jeremiah 2:2), God’s words were directed against Jerusalem, the elders of Judah and priests: “Go and cry in the ears of Jerusalem,” but later in the chapter it was also directed at Israel: “Hear ye the word of the Lord, O house of Jacob, and all the families of the house of Israel,” (Jeremiah 2:4,26). So Chapter 3 continues in that context.

Rashi is the acronym for Rabbi Shlomo Yitzchaki, a well respected medieval French rabbi and author of a comprehensive commentary on the Hebrew Bible and the Talmud; hence his opinion is often quoted here.

Jeremiah 3

1 “They say, ‘If a man put away his wife, and she go from him and become another man’s, shall he return unto her again? Shall not that land be greatly polluted?’ But thou hast played the harlot with many lovers; yet return again to Me,” saith the Lord. — but thou hast played the harlot with many lovers, none of them her lawful husband; yet, in spite of the fact that it is not in accordance with legal regulations, return to Me, saith the Lord, for He was ready to show mercy even under such adverse conditions.

“Lift up thine eyes unto the high places, and see where hast thou not been lain with. By the wayside hast thou sat for them, as the Arabian in the wilderness; and thou hast polluted the land with thy whoredoms and with thy wickedness. — and see where thou hast not been lien with; see if there is a hill or mountain or any high place, where thou hast not committed idolatry;

— their harlotry was so notorious, and the facts and instances so many, there was no denying it; every hill and mountain witnessed to their idolatry;

— to which the Targum says, “see where thou hast not joined thyself to worship idols,” in the ways hast thou sat for them; for the idolaters, waiting for them, to join in their idolatries as harlots used to sit by the wayside to solicit their lovers.

Therefore the showers have been withheld, and there hath been no latter rain. And thou had a whore’s forehead; thou refused to be ashamed. — the showers have been withdrawn according to God’s warning, Leviticus 26:19Deuteronomy 28:23-24; that is, droughts were sent upon their land as a punishment in a judgement against her.

Wilt thou not from this time cry unto Me, ‘My Father, Thou art the guide of my youth? — Rashi: will you not from now: if only you repent of your evil and call me “My Father.” If you do so, will your Lord bear a grudge forever for what you have sinned? Will He keep it to eternity? He will not keep it;

— thou art the Guide of my youth? She uses the endearing term “Companion of my youth,” in speaking to the Lord, as though to win Him back.

Will He reserve His anger for ever? Will He keep it to the end?’ Behold, thou hast spoken, and done evil things as thou couldest.” — the Targum says, “is it possible that thy sins should be kept for thee for ever, or the stroke (of punishment) be strengthened upon thee to the end?”

The Lord said also unto me in the days of Josiah the king: “Hast thou seen that which backsliding Israel hath done? She hath gone up upon every high mountain and under every green tree, and there hath played the harlot. — hast thou seen that which backsliding Israel hath done? the ten tribes; that is, hast thou not heard? or dost thou not know the idolatry of the ten tribes, which was the cause of their captivity?

— for the facts, or the idolatrous actions of the ten tribes, were not done in Josiah’s and Jeremiah’s time; for they were carried captive in the sixth year of Hezekiah, ninety years or more before Jeremiah began to prophesy, and their idolatry was before their captivity, and therefore the house of Judah should have taken note, as a warning, and stopped following the path that the house of Israel had taken, least they should also be taken into captivity.

And I said after she had done all these things, ‘Return thou unto Me.’ But she returned not, and her treacherous sister Judah saw it. — and I said after she had done all these things, these were the thoughts which filled the Lord’s heart. Turn thou unto Me, but the northern kingdom consistently rejecting the Lord’s call; and though her sister Judah saw it, being influenced by Israel’s evil example, she treacherously rejected any return.

And I saw that for all the causes for which backsliding Israel committed adultery, I had put her away and given her a bill of divorce; yet her treacherous sister Judah feared not, but went and played the harlot also. — the Targum says, “I caused them to go into captivity, as those that give a bill of divorce (to their wives) and dismiss them:”

— yet her treacherous sister Judah feared not: committed idolatry and offended the Lord, nor stood in awe of his judgements; but went and played the harlot; committed idolatry, as the ten tribes did, taking no warning by what befell them.

And it came to pass, because she made so light of her whoredom, that she defiled the land and committed adultery with stones and with stocks. — and committed adultery with stones and with stocks; that is, with images made of stone and wood, which they served and worshipped as gods; and is the adultery or idolatry they are charged with, and by which the land was defiled;

— the Targum says, “she erred or committed idolatry with the worshippers of stone and wood.”

10 And yet for all this her treacherous sister Judah hath not turned unto Me with her whole heart, but feignedly,” saith the Lord. — there was a show of reformation in Josiah’s time, but it was but a outward show; there was no true, hearty cordial repentance for the sin of idolatry, only a feigned one;

— there was an outward reformation, but inwardly the desires of the heart were to continue their idolatry; though Josiah was a good king, with a few others, were hearty in its reformation, the greater part of the people played the hypocrites;

— Rashi: but falsely: Josiah’s generation would show themselves as righteous although the others were wicked. They would make forms of pagan deities on the inside of their doors, half on this door and half on this one, and when the destroyers of idols would inspect, the door would be open, and they would not notice it.

— Rashi is the acronym for Rabbi Shlomo Yitzchaki, a well respected medieval French rabbi and author of a comprehensive commentary on the Hebrew Bible and the Talmud.

11 And the Lord said unto me, “The backsliding Israel hath justified herself more than treacherous Judah. — the backsliding Israel hath justified herself more than treacherous Judah; that is, was comparatively more righteous of the two; though neither of them could vindicate their conduct, or justify themselves before God;

— Judah was more to blame because after Israel committed idolatry and was carried captive, Judah took no warning, but fell into the same trap; and in Manasseh’s time committed greater idolatries than ever Israel did; and more than even the Amorites or other heathen nations had done, 2 Kings 21:6;

12 Go and proclaim these words toward the north, and say: “‘Return, thou backsliding Israel,’ saith the Lord, ‘and I will not cause Mine anger to fall upon you; for I am merciful,’ saith the Lord, ‘and I will not keep anger for ever. — and I will not cause Mine anger to fall upon you, not continue to frown upon them in wrath and displeasure; for I am merciful, saith the Lord, preferring to show grace and mercy rather than indignation.

13 Only acknowledge thine iniquity: that thou hast transgressed against the Lord thy God, and hast scattered thy ways to the strangers under every green tree, and ye have not obeyed My voice,’ saith the Lord. — only acknowledge thine iniquity, freely confessing her transgressions and her guilt, that thou hast transgressed against the Lord, thy God, against whom in the last analysis every sin is directed;

— Rashi: and spreading her private parts to strangers under every leafy tree, wandering back and forth in her harlotry, and have not obeyed My voice, saith the Lord.

14 ‘Turn, O backsliding children,’ saith the Lord, ‘for I am married unto you; and I will take you, one from a city and two from a family, and I will bring you to Zion. — the Targum says, “for I am well pleased with you;” to which Rashi adds “because I am your Lord, and it is not my honour to leave you in the hand of my enemies.”

15 And I will give you pastors according to Mine heart, who shall feed you with knowledge and understanding.’ — and I will give you good shepherds, leaders in both the spiritual and the civil domain, as Zerubbabel and Nehemiah, according to Mine own heart, which shall feed you with knowledge and understanding.

16 “And it shall come to pass when ye be multiplied and increased in the land, in those days,” saith the Lord, “they shall say no more, ‘The ark of the covenant of the Lord.’ Neither shall it come to mind, neither shall they remember it; neither shall they visit it, neither shall that be done any more. — Rashi: they will no longer say, “The ark of the Lord’s covenant”: For your entire assembly will be holy, and I will dwell therein as though it were an ark;

— in the days when Israelites would be gathered; the sense is, that worship belonging to it, shall cease, Christ having came and been sacrificed, who was the substance of what the ark and all other rites did and a shadow for a time; and even during the Millennium, when there would have Passover and other Feasts with all the rites and ceremonies, they are only seen as memorial;

— neither shall that be done any more; the Targum paraphrases the last clause, “neither shall they make war with it any more.”

17 At that time they shall call Jerusalem the Throne of the Lord, and all the nations shall be gathered unto it, to the name of the Lord, to Jerusalem; neither shall they walk any more after the imagination of their evil heart. —

18 In those days the house of Judah shall walk with the house of Israel, and they shall come together out of the land of the north to the land that I have given for an inheritance unto your fathers. — in those days the two houses of Israel shall walk together, all true Israelites being united in the land of Israel, 

— and they shall come together out of the land of the North, from all the countries of the dispersion, to the land that I have given for an inheritance unto your fathers, to enjoy their blessings together.

19 “But I said, ‘How shall I put thee among the children and give thee a pleasant land, a goodly heritage of the hosts of nations?’ And I said, ‘Thou shalt call Me “My Father,” and shalt not turn away from Me.’ — but I said, how shall I put thee among the host of other children, and give thee a pleasant land, a goodly heritage compared to all the other hosts of nations? 

— and I said, thou shall call Me, My Father, returning once more to the true God; and shall not turn away from Me, fully restored to the favor of Yehovah.

20 Surely as a wife treacherously departeth from her husband, so have ye dealt treacherously with Me, O house of Israel,” saith the Lord. — surely as a wife treacherously departeth from her husband, forsaking the companion of her youth, so have ye dealt treacherously with Me, O house of Israel, saith the Lord. Upon this final accusation of the Lord the sorrow of the people and their confession of sins is brought out with dramatic intensity;

— emphasis here is the house of Israel, the lost ten tribes; but could also include the house of Judah, for they committed the same sins and share the same destination.

21 A voice was heard upon the high places, weeping and supplications of the children of Israel; for they have perverted their way, and they have forgotten the Lord their God. — again, the emphasis here is the house of Israel, who have perverted their ways, went into captivity and now known as the lost ten tribes;

— here at least of a contrast to the house of Judah who had always remember the Sabbath, thus always known as God’s people to the outside world, and were never considered lost as the house of Israel is.

22 “Return, ye backsliding children, and I will heal your backslidings.” “Behold, we come unto Thee, for Thou art the Lord our God. — the Targum says, “I will forgive you when ye return;”

— and I will heal your backslidings; that is, I will forgive your sins; sins are the breaking of God’s commandments, and the wounds that resulted from it; and pardoning them is healing them.

23 Truly in vain is salvation hoped for from the hills and from the multitude of mountains. Truly in the Lord our God is the salvation of Israel. — truly, in vain they awaited salvation from the hills and the mountains where they worshipped idols there, but it is a delusion and a snare to expect help from them; for truly, in the Lord our God, is the salvation of Israel; He alone can bring about the deliverance of His people.

24 For shame hath devoured the labor of our fathers from our youth — their flocks and their herds, their sons and their daughters. — the idolatry with which they occupied themselves and had turned themselves into a shameful thing from the days of their fathers in their youth; the idols, whose worship brought shame and disgrace upon themselves;

— because of the iniquity of idols worship, their toil of the flocks and herds were pillaged, or as a steady stream of sacrifices, but their worship also brought down by which their children were torn from them; or that evils have befallen upon their sons and daughters.

25 We lie down in our shame, and our confusion covereth us; for we have sinned against the Lord our God, we and our fathers, from our youth even unto this day, and have not obeyed the voice of the Lord our God.” — their consciences for the sins against God have surrounded them and filled them with shame, from the days of their fathers, from their youth even unto this day, and have not obeyed the voice of the Lord, our God;

— a full and unequivocal confession of sins, a complete acknowledgement of guilt, is the first step in true repentance; he that covereth his sins shall not prosper; but whosoever confesseth and forsaketh them shall have mercy.

Jeremiah 4

The first two verses of this chapter seem to be closely connected with the preceding, being directed to Israel, the ten tribes, by way of reply to their compliance with God’s call, encouraging them to keep and execute their resolution. The rest of the chapter concerns Judah and Jerusalem.

1 “If thou wilt return, O Israel,” saith the Lord, “return unto Me; and if thou wilt put away thine abominations out of My sight, then shalt thou not be removed. — if you return to Me, O Israel, you shall not be exiled;

— and if you remove your detestable things, you will return to your former glory and greatness.

And thou shalt swear, ‘The Lord liveth,’ in truth, in judgement, and in righteousness; and the nations shall bless themselves in Him, and in Him shall they glory.” — and thou shalt swear, the Lord liveth, in truth, not in hypocrisy; and in righteousness, in a just cause and with genuine uprightness of heart;

— and the nations under the influence of this confession shall bless Him, and in Him shall they be glorified, thereby becoming partakers of the blessings which were promised to the patriarchs.

For thus saith the Lord to the men of Judah and Jerusalem: “Break up your fallow ground, and sow not among thorns. — unless the fallow ground is broken up, it will be no better than sowing among thorns;

— and unless the hearts of men are opened to God, they will not attend to the things that are spoken; preaching and eating the word will be like sowing among thorns; the cares of this world, the deceitfulness of riches, are comparable to thorns.

Circumcise yourselves to the Lord, and take away the foreskins of your heart, ye men of Judah and inhabitants of Jerusalem, lest My fury come forth like fire, and burn that none can quench it, because of the evil of your doings. — lest my fury come forth like fire; to which the wrath of God is sometimes compared, Nahum 1:6 and is sometimes signified by a furnace and lake of fire, even his eternal wrath and vengeance.

“Declare ye in Judah and publish in Jerusalem, and say, ‘Blow ye the trumpet in the land!’ Cry, gather together and say, ‘Assemble yourselves, and let us go into the fortified cities!’ — declare ye in Judah, announcing it, making it known widely and publish in Jerusalem and say, Blow ye the trumpet in the land, as a signal calling the inhabitants to arms; 

— cry, gather together, and say, rather, “cry fully,” that is, with a loud voice, shouting; assemble yourselves and let them go into the fortified cities behind their strongest fortresses.

Set up the standard toward Zion. Retire, stay not! For I will bring evil from the north, and a great destruction.” — set up the standard toward Zion, raising their banners as a signal to make the city of God their refuge; retire, stay not, but flee, do not try to make a stand;

— for I will bring evil from the North, from Babylon, followed by a great destruction.

The lion has come up from his thicket (thick wood), and the destroyer of the nations is on his way. He has gone forth from his place to make thy land desolate; and thy cities shall be laid waste, without an inhabitant. — the lion is come up from his thicket… meaning Nebuchadnezzar from Babylon who is compared to a lion for his strength, fierceness and cruelty; see Jeremiah 50:17;

— he is gone forth from his place, to make thy land desolate; from Babylon, where his royal palace was, in order to lay waste the land of Judea; and he is represented as being on the road to strike the inhabitants of Judea with great terror, their destruction being determined and certain.

For this, gird you with sackcloth, lament and howl; for the fierce anger of the Lord is not turned back from us. — for the fierce anger of the Lord . . . although Josiah repented wholeheartedly, others were not (II Kings 23:26)…“the Lord did not turn back from his great wrath… because of all the provocations that Manasseh had provoked Him.”

“And it shall come to pass at that day,” saith the Lord, “that the heart of the king shall perish, and the heart of the princes; and the priests shall be astonished, and the prophets shall wonder.” — Rashi: and it shall be on that day: On the day of Josiah they will wonder why so much befell him, for they do not know that his generation did not repent properly. When he came to abolish idolatry, what did the scorners of the generation do? They would engrave an image of a pagan deity on their doors, half of it on this door and half of it on this door. When he would open it, it was not discernible, and when he went away from there, he would close it, and it would join together;

— that the heart of the king shall perish; meaning Zedekiah king of Judah, who should be in the utmost fright and consternation, not knowing what to do, being devoid both of wisdom and courage; see Jeremiah 39:4;

— and the heart of the princes; who being seized with the same panic, and at their wits’ end, would not be able to give any advice and counsel to the king; so that the people would have no help from the king and his nobles, in whom they put their confidence.

10 Then said I, “Ah, Lord God! Surely Thou hast greatly deceived this people and Jerusalem, saying, ‘Ye shall have peace,’ whereas the sword reacheth unto the soul.” — then said I, Ah, Lord God! The Hebrew word, Aha, is a word expressive both of admiration and lamentation;

11 At that time shall it be said to this people and to Jerusalem: “A dry wind of the high places in the wilderness toward the daughter of My people — toward the daughter of My people, the children of God’s chosen nation, not to fan nor to cleanse, not the gentle breeze which ordinarily carried off the chaff as the threshed grain was winnowed;

— the Targum says, “as the south wind upon the heads of floods of water in the wilderness, so is the way of the congregation of my people; but rather the north wind is designed, since that is a dry one, and the south wind a moist one; and the rather, since this wind intends Nebuchadnezzar and his army, which should come from Babylon, from the north.

12 even a full wind from those places shall come unto Me. Now also will I give sentence against them.” — a wind full of those punishments which God had threatened, and determined to bring upon this people, and would not turn from, nor repent of: and the phrase “shall come unto me.”

13 Behold, he shall come up as clouds, and his chariots shall be as a whirlwind. His horses are swifter than eagles! Woe unto us, for we are despoiled! — the metaphor denotes the swiftness of the lion, Nebuchadnezzar’s coming, and the multitudes he should come with, and that darkness and distress he should bring with him upon the house of Judah.

14 O Jerusalem, wash thine heart from wickedness, that thou mayest be saved. How long shall thy vain thoughts lodge within thee? — O Jerusalem, wash thine heart from wickedness, for a mere outward change of behavior is not sufficient; heart and mind and soul must undergo a complete transformation,

— that thou may be saved, for only he who truly repents may partake of the Lord’s deliverance. How long shall thy vain thoughts lodge within thee? It was high time for all sinful thoughts to be dismissed.

15 For a voice declareth from Dan, and publisheth affliction from Mount Ephraim: — and publish affliction from Mount Ephraim: which lay on the border of the tribe of Benjamin, and near to Jerusalem; and this publication represents the enemy as advancing nearer, and being just at hand;

— the word for “affliction” signifies “iniquity” and it denotes that the affliction spoken of, which is the destruction of the house of Judah, and their captivity in Babylon, were occasioned by their sins. Some think that Dan and Ephraim are mentioned, because of the calves that were worshipped in Dan and in Bethel, which was in the tribe of Ephraim;

— thus the Targum paraphrases the words, “for the voice of the prophets that prophesied against them that go into captivity, because they worshipped the calf, which is at Dan; and they that bring evil tidings, shall come upon them, because they served the image which Micah set up in the mount of the house of Ephraim.”

— Q: who was Micah? Wasn’t he Jeroboam? Perhaps Jeroboam set the alters in Dan and Bethel, but a later Micah came and set up another idol in one of the mountains of Ephraim, hence Mount Ephraim?

16 “Make ye mention to the nations. Behold, publish against Jerusalem that watchers come from a far country and give out their voice against the cities of Judah. — the Targum says, “the army of a rapacious people, like the grape gatherers, come from a far country:”

— and give out their voice against the cities of Judah; threaten the ruin of them; blow the trumpet, the alarm of war; give the orders to besiege; and being sure of victory, triumph before the attack is made.

17 As keepers of a field are they against her round about, because she hath been rebellious against Me,” saith the Lord.

18 “Thy way and thy doings have procured these things unto thee: this is thy wickedness, because it is bitter, because it reacheth unto thine heart.”

19 My heart, my heart! I am pained at my very heart! My heart maketh a noise in me; I cannot hold my peace, because thou hast heard, O my soul, the sound of the trumpet, the alarm of war. — I writhe in pain; an expression of writhing in pain and shuddering;

— my heart makes a noise in me; palpitates, beats and throbs, being filled with fears and dread, with sorrow and concern, at what was coming on; it represents an aching heart, all in disorder and confusion;

— the sound of the trumpet, the alarm of war, the shout of battle, as the enemy advances to subdue the land of Israel.

20 Destruction upon destruction is cried, for the whole land is despoiled; suddenly are my tents despoiled, and my curtains in a moment. — suddenly are my tents spoiled, and my curtains in a moment: meaning either the armies of his people, which dwelt in tents, and were destroyed at once; or the cities, towns, and habitations of his countrymen, which he compares to tents, as being easily beat down or overthrown;

— and so the Targum interprets it of cities; and the prophet seems to intimate that this destruction would reach to Anathoth, where his tent; cottage, and curtains were. So sudden destruction some times comes, when men are crying “Peace, Peace.”

21 How long shall I see the standard, and hear the sound of the trumpet?

22 “For My people are foolish, they have not known Me; they are sottish children, and they have no understanding. They are wise to do evil, but to do good they have no knowledge.” — they are wise to do evil; cunning inventors of evil things, crafty schemers that way, may be full of all wicked subtlety,

— and expert at over reaching and defrauding their brethren; when professors of religion especially ought to be wise unto that which is good, and simple concerning evil;

23 I beheld the earth, and lo, it was without form, and void; and the heavens, and they had no light.

24 I beheld the mountains, and lo, they trembled, and all the hills moved lightly. — I beheld the mountains, and, lo, they trembled, because the very foundations of the earth were shaken, 

— and all the hills moved, as heavy bodies which shake with the slightest disturbance.

25 I beheld, and lo, there was no man, and all the birds of the heavens had fled. — and all the birds of the heavens had fled; at the sound of the trumpet, the alarm of war; at the blackness of the heavens, filled with smoke; at the barrenness of the earth, there being no seed sown; and the earth, as at the first creation, having no herb, nor trees bearing fruit, and so no food for birds; and therefore they went elsewhere, both wild and tame.

26 I beheld, and lo, the fruitful place was a wilderness, and all the cities thereof were broken down at the presence of the Lord and by His fierce anger. — and behold, the fruitful field: the land, planted with all good like a forest, has become like a desert.

27 For thus hath the Lord said: “The whole land shall be desolate; yet will I not make a full end. — yet will I not make a full end; God would not bring about a total annihilation at this time.

28 For this shall the earth mourn, and the heavens above be black, because I have spoken it; I have purposed it and will not repent, neither will I turn back from it.

29 The whole city shall flee for the noise of the horsemen and bowmen; they shall go into thickets and climb up upon the rocks; every city shall be forsaken, and not a man dwell therein. — the whole city, or, “every city,” all the cities of the land, shall flee for the noise of the horsemen and bowmen as the invading army draws near; 

— they shall go into thickets, their hiding-places, and climb up upon the rocks, seeking refuge before the attacking hordes; every city shall be forsaken and not a man dwell therein.

30 And when thou art despoiled, what wilt thou do? Though thou clothest thyself with crimson, though thou deckest thee with ornaments of gold, though thou rendest thy face with painting, in vain shalt thou make thyself fair. Thy lovers will despise thee; they will seek thy life. — though thou clothest thyself with crimson, in garments of the most expensive material, though thou deckest thee with ornaments of gold, in decking herself for the purpose of coquetting with heathen nations;

— though thou rentest thy face with painting, applying antimony black to the eyelids, in order to increase the luster of the eyes, a custom still followed by harlots and vain women, all arts exercised to procure the aid of foreign nations would be useless; thy lovers will despise thee, no longer attracted by such artifices, they will seek thy life.

31 For I have heard a voice as of a woman in travail, and the anguish as of her that bringeth forth her first child, the voice of the daughter of Zion that bewaileth herself, that spreadeth her hands, saying, ‘Woe is me now, for my soul is wearied because of murderers!’ — for I have heard a voice as of a woman in travail and the anguish as of her that bringeth forth her first child, heartrending wails and moans, the voice of the daughter of Zion, of the Lord’s own chosen people, that bewaileth herself, that spreadeth her hands, saying, panting in her agony;

— Woe is me now! for my soul is as one who yields to murderers, unable to withstand any longer. Such is the usual fate of men who disregard the warnings and pleadings of the Lord: when it is too late, they begin to mourn and lament, bewailing their fate. But as far as God is concerned, love is still with Him even in the height of His anger.

Jeremiah (Ch 1-2)

•November 1, 2021 • Leave a Comment

Around 629 BC, which is about a hundred years after the house of Israel had been exiled to Assyria, the words of the Lord came to Jeremiah the son of Hilkiah; hence Jeremiah is the general title of this prophecy, and includes all his discourses and sermons; and designs not in Jeremiah’s own words, but the words of the Lord which were put into his mouth, and he delivered under divine inspiration.

The Septuagint version renders it, “the word of God”; the Targum says, “the words of the prophecy of Jeremiah;” who is described by his descent and parentage, “the son of Hilkiah.” This Hilkiah could be the same high priest, who in the days of king Josiah, of the southern house of Judah, found the book of the law.

The Targum is another source of the Bible, much like the Masoretic Text and the Septuagint. The Targum was started by Ezra for those returning from the Babylon exile and for these returnees they could only understand the Scriptures in Aramaic. Hence the Targum is as if Ezra is speaking to us from the Hebrew Bible quoted.

Jeremiah 1

1 The words of Jeremiah the son of Hilkiah, of the priests who were in Anathoth in the land of Benjamin, — Jeremiah was of a priestly family; also a Levite, but he lived in Anathoth in the land of Benjamin; Jerusalem was designated to Benjamin, not Judah, which is further south, centred around Bethlehem;

— to be more specific, Anathoth was a city about three miles north of Jerusalem in the tribe of Benjamin, but designated and belonged to the priests, Joshua 21:18.

to whom the word of the Lord came in the days of Josiah the son of Amon, king of Judah, in the thirteenth year of his reign. — in the thirteenth year of his reign: in the twenty first of Josiah’s age, for he began to reign when he was eight years old, and he reigned eighteen years after, for he reigned in all thirty one years; and it was five years after this that the book of the law was found by Hilkiah the high priest;

— king Josiah was said to have reigned 640–609 BC; so the thirteenth year of his reign would be around 628 BC.

It came also in the days of Jehoiakim the son of Josiah, king of Judah, unto the end of the eleventh year of Zedekiah the son of Josiah, king of Judah, unto the carrying away of Jerusalem captive in the fifth month. — and it came also in the days of Jehoiakim (reign: 609–598 BC), the son of Josiah king of Judah… in the beginning of his reign, and in the fourth year of his reign; see Jeremiah 25:1.

Then the word of the Lord came unto me, saying,

“Before I formed thee in the belly I knew thee, and before thou camest forth out of the womb I sanctified thee, and I ordained thee a prophet unto the nations.” — before I formed thee in the belly I knew thee not merely by his omniscience, but knows Jeremiah before his conception and birth; in the sense the Lord knows those that are his.

Then said I, “Ah, Lord God! Behold, I cannot speak, for I am a child.” — then said I, Ah, Lord God!…. the word אהה, “Ah” is used in distress and grief, showing that the prophet was troubled and uneasy at his call, and would gladly have been excused on the following account;

— behold, I cannot speak; or, “I know not how to speak” properly, politely and eloquently, especially before great personages, kings and princes, and the citizens of Jerusalem; a similar excuse Moses made, Exodus 4:10;

— the Targum says, “I know not to prophesy: for I am a child”; meaning either in knowledge and understanding, or in years; not a mere child, but a “junior” as the Septuagint version renders it: a “young man.”

— the Targum is an indispensable source of understanding the Bible. Started by Ezra for those returning Jews from Babylon and for these returnees they could only understand the Sacred Text in Aramaic; hence the Targum is as if Ezra is speaking to them in ancient times and to us from the Sacred Text.

But the Lord said unto me, “Say not, ‘I am a child,’ for thou shalt go to all whom I shall send thee, and whatsoever I command thee thou shalt speak. — for thou shall go to all that I shall send thee; either to “every place”, as the Targum paraphrases: “to all persons to whom” he should be sent;

— or as the Septuagint renders the words; or “to all things for which” he should send him. The sense is, that he should go everywhere, and to every person, and on every errand and message he should be sent unto and with.

Be not afraid of their faces, for I am with thee to deliver thee,” saith the Lord. — be not afraid of their faces… their stern looks, their frowning brows, and angry countenances, which would threaten him with destruction and death;

— for I am with thee, to deliver thee, saith the Lord; out of their hands, when in the most imminent danger. 

Then the Lord put forth His hand and touched my mouth. And the Lord said unto me, “Behold, I have put My words in thy mouth. — behold, I have put my words in thy mouth; by the seeing of this symbolical action in his vision, and the hearing of these words, Jeremiah could not but be assured that he should be able to speak in the proper language of a prophet.

10 See, I have this day set thee over the nations and over the kingdoms to root out and to pull down, and to destroy and to throw down, to build and to plant.” — to root out, and to pull down, and to destroy, and to throw down; that is, to foretell that such a kingdom and nation should be rooted out;

— as a tree or plant that is plucked up by the roots; and that such an one should be pulled, and thrown down, and destroyed, as may be understood of the destruction of the Jews by Nebuchadnezzar, of their temple, city, and nation;

— to build, and to plant, the royal family of the house of David; which applied to the planting of Jewish princesses to Ireland;

— the destruction of Zedekiah’s Pharez line; to the planting of the Zarah line ruling in the British Isles! (for more see “Judah’s Sceptre and Joseph’s Birthright” by J.H. Allen).

11 Moreover the word of the Lord came unto me, saying, “Jeremiah, what seest thou?” And I said, “I see a rod of an almond tree.” — and I said, I see a rod of an almond tree; a dry stick, without leaves or fruit upon it, and yet he knew it to be an almond tree stick; though some think it had leaves and fruit on it, by which it was known;

— the Targum says, “and I said, a king hastening to do evil I see;” meaning Nebuchadnezzar, king of Babylon, hastening to bring destruction upon the house of Judah.

12 Then said the Lord unto me, “Thou hast well seen, for I will hasten My word to perform it.” — for l will hasten my word to perform it; the name of the almond tree in Hebrew; which is so called because it is quick and early, and hastens to bring forth its flowers, leaves, and fruit; in like manner the Lord says he would hasten to perform what he had said or should say by him concerning the destruction of Jerusalem, and the captivity of the people.

13 And the word of the Lord came unto me the second time, saying, “What seest thou?” And I said, “I see a seething pot, and the face thereof is toward the north.” — the Targum paraphrases the words thus, “and I said, I see a king boiling as a pot, and the banner of his army, which was brought and came from the north;”

— a boiling pot or a boiling cauldron denoting Judea or Jerusalem, expressed by the same figure, Ezekiel 11:3Ezekiel 11:7Ezekiel 24:3.

— much like the four angel asked to let loose the river of Euphrates, for the 200 million on horseback to ride over in Revelation 9:15-16 to slay a third part of men.

14 Then the Lord said unto me, “Out of the north an evil shall break forth upon all the inhabitants of the land. — out of the north an evil shall break forth upon all the inhabitants of the land; that is, out of Babylon, which lay north, and so the Talmud says: northeast to the land of Israel; from hence came Nebuchadnezzar and his army, which are meant by “the evil” that should break forth, or be opened and let loosed, which before were bound and hindered by the providence of God;

— here in Jeremiah, the house of Judah had been constantly warned of an enemy coming out from the NORTH, but in Ezekiel 20-21, the house of Israel had been warned of a yet ‘unknown’ enemy of the future coming from the SOUTH (more at the end).

15 For lo, I will call all the families of the kingdoms of the north,” saith the Lord; “and they shall come and they shall set every one his throne at the entrance of the gates of Jerusalem, and against all the walls thereof round about, and against all the cities of Judah. — and against all the walls thereof round about, and against all the cities of Judah; not only besiege Jerusalem, and take that, but also all the rest of the cities of the land.

16 And I will utter My judgements against them concerning all their wickedness, who have forsaken Me, and have burned incense unto other gods, and worshipped the works of their own hands. — and I will utter my judgements against them… not against the kingdoms of the north, but against the people of the house of Judah. The sense is, that God would enter into judgement with this people, and pass sentence upon them, and execute it;

— for they worshipped the works of their own hands: idols of gold, silver, brass, and wood, which their own hands formed and carved, and which argued great stupidity and ignorance.

17 Thou therefore gird up thy loins, and arise and speak unto them all that I command thee. Be not dismayed at their faces, lest I confound thee before them. — and arise; and go from Anathoth to Jerusalem; and arise and speak unto them all that I command thee, the fact of his being the Lord’s messenger and envoy once more being stressed;

— be not dismayed at their faces, shrinking back before them, lest I confound thee before them, so that he would be rejected, crushed, and overcome before them.

18 For behold, I have made thee this day a fortified city, and an iron pillar, and brazen walls against the whole land — against the kings of Judah, against the princes thereof, against the priests thereof, and against the people of the land. — against the whole land of Judea, against all its inhabitants and the kings of Judah; in successive reigns, as Jehoahaz (reign 609), Jehoiakim (reign 609–598), Jehoiachin or Jechonias (reign 598–597), and Zedekiah (reign 597–586);

— against the priests who all of them dealt falsely, and were given to covetousness, Jeremiah 8:10; and against the people of the land; who were grievously addicted to idolatry, and all manner of wickedness.

19 And they shall fight against thee; but they shall not prevail against thee, for I am with thee,” saith the Lord, “to deliver thee.” — and they shall fight against thee… the Targum adds, “that they may hide the words of thy prophecy;”

— for I am with thee, saith the Lord, to deliver thee; as he did; he hid him when they sought for him, and delivered him out of the dungeon and bonds into which he was cast by them.

~~~

More on a prophecy of an “enemy” coming from the SOUTH:

Ezekiel 20:45 Moreover the word of the Lord came unto me, saying,
46 “Son of man, set thy face toward the south, and drop thy word toward the south, and prophesy against the forest of the southland.
47 And say to the forest of the south: ‘Hear the word of the Lord. Thus saith the Lord God: Behold, I will kindle a fire in thee, and it shall devour every green tree in thee and every dry tree. The flaming flame shall not be quenched, and all faces from the south to the north shall be burned therein.
48 And all flesh shall see that I, the Lord, have kindled it; it shall not be quenched.’”
49 Then said I, “Ah, Lord God! They say of me, ‘Doth he not speak parables?’”
Ezekiel 21: And the word of the Lord came unto me, saying,
2 “Son of man, set thy face toward Jerusalem, and drop thy word toward the holy places, and prophesy against the land of Israel;
3 and say to the land of Israel, ‘Thus saith the Lord: Behold, I am against thee, and will draw forth My sword out of his sheath and will cut off from thee the righteous and the wicked.
4 Seeing then that I will cut off from thee the righteous and the wicked, therefore shall My sword go forth out of his sheath against all flesh from the south to the north,
5 that all flesh may know that I, the Lord, have drawn forth My sword out of his sheath. It shall not return any more.’

Q: Who is this enemy from the SOUTH, and how would such scenarios be played out?

Jeremiah 2

1 Moreover the word of the Lord came to me, saying, — the Targum calls it, “the word of the prophecy from the Lord.”

“Go and cry in the ears of Jerusalem, saying, ‘Thus saith the Lord: “‘I remember thee, the kindness of thy youth, the love of thine espousals, when thou wentest after Me in the wilderness, in a land that was not sown. — in the wilderness, in a land that had not been cultivated; where they passed through many difficulties;

— the Targum says, “and they walked after my two messengers, after Moses and Aaron, in the wilderness forty years without food, in a land that was not sown;”

— and lived upon the providence of God, which, in a wonderful manner, supported them with the necessaries of life, which otherwise they could not have had.

Israel was holiness unto the Lord, and the firstfruits of His increase. All that devour him shall offend; evil shall come upon them,’” saith the Lord. — evil shall come upon them, saith the Lord; His punishment descended upon the Amalekites, the Amorites, and upon all other nations that interfered with His plans for His chosen people. Such were the manifestations of God’s mercy and kindness to Israel, and therefore His rebuke certainly came with good reason.

Hear ye the word of the Lord, O house of Jacob, and all the families of the house of Israel. — this in respects the two tribes of Judah and Benjamin, and the ten tribes had long been carried away captives to Assyria.

Thus saith the Lord: “What iniquity have your fathers found in Me, that they are gone far from Me, and have walked after vanity, and have become vain? — the Targum says, “what falsehood have your fathers found in my word?” None at all; God is a covenant keeping God.

Neither said they, ‘Where is the Lord that brought us up out of the land of Egypt, that led us through the wilderness, through a land of deserts and of pits, through a land of drought and of the shadow of death, through a land that no man passed through and where no man dwelt?’ — the Lord that brought them out through a land of deserts and of pits, through a land of drought, and of the shadow of death; where there were scorpions, fiery serpents, drought,

— and no water, and so very dangerous as well as uncomfortable travelling; and yet through all these obstacles they were led and wonderfully supplied and preserved.

And I brought you into a plentiful country to eat the fruit thereof and the goodness thereof; but when ye entered, ye defiled My land and made Mine heritage an abomination. — the Targum paraphrases it; with wheat, barley, vines, fig trees, pomegranates and olives; a land flowing with milk and honey, Deuteronomy 8:8;

— but when ye entered ye defiled my land; which the Lord had chosen above all lands, where he would have a temple built for his worship, and where he would cause his Shekinah to dwell; but this they defiled by their sins, and particularly by their idolatry.

The priests said not, ‘Where is the Lord?’ And they that handle the law knew Me not; the pastors also transgressed against Me; and the prophets prophesied by Baal, and walked after things that do not profit. — and they that handle the law knew me not; and according to Rashi, the Sanhedrin, the lawyers and scribes, the rabbis and doctors of the law, whose business it was to read and explain it; these they did not understand;

— and the prophets prophesied by Baal; in his name; pretending to be inspired by that idol, and to receive the spirit of prophecy from him.

“Therefore I will yet plead with you,” saith the Lord, “and with your children’s children will I plead. — wherefore I will yet plead with you, saith the Lord… either verbally, by reasoning with them, and reproving them for their ignorance, stupidity, and idolatry; or by deeds, inflicting punishment upon them;

— so the Targum, “therefore I will take vengeance on you, or punish you, saith the Lord.”

10 For pass over to the isles of Chittim and see; and send unto Kedar and consider diligently, and see if there be such a thing. — and send unto Kedar; which was in Arabia, and lay to the east, as Chittim to the west; and so the Targum paraphrases it, “send to the provinces of the Arabians.”

11 Hath a nation changed their gods, which are yet no gods? But My people have changed their Glory for that which doth not profit. — hath a nation changed their gods, which are yet no gods? In spite of the fact that their idols were false gods, the heathen at least had the pride and the decency of clinging to their gods; 

— but My people have changed their glory for that which doth not profit, exchanging their possession of their true God, for vain idols, with less consistency than that shown by the ignorant and despised heathen.

12 Be astonished, O ye heavens, at this, and be horribly afraid; be ye very desolate,” saith the Lord. — in astonishment and horror the Lord cries out: Be horribly afraid, be ye very desolate,” saith the Lord; all which may be signified by storms and tempests, by thunder and lightning, and by the sun’s withdrawing its light.

13 “For My people have committed two evils: They have forsaken Me, the fountain of living waters, and hewn them out cisterns—broken cisterns that can hold no water. — for My people have committed two evils, thus exceeding even the heathen with their one transgression of foolish idolatry: (1) they have forsaken Me, the Fountain of living waters, the only true and living God, 

— and (2) hewed them out cisterns, whose waters lack the freshness and the sparkle of spring- or well-water, broken cisterns, that can hold no water. Putting aside the one and only Source of spiritual life and power, they placed their trust in gods which belied even the outward appearance that men had given them.

14 “Is Israel a servant? Is he a home born slave? Why is he despoiled? — is Israel a servant?… that he does not abide in the house, in his own land, but is carried captive, becomes subject to others, and is used as a slave.

15 The young lions roared at him and yelled, and they made his land waste; his cities are burned without inhabitant. — the young lions roared upon him, and yelled… or, “gave out their voice”; meaning the kings of the nations, as the Targum explains it; and are to be understood of the kings of Assyria and Babylon, and particularly of Nebuchadnezzar; see Jeremiah 50:17.

16 Also the children of Noph and Tahpanhes have broken the crown of thy head.

17 Hast thou not procured this unto thyself, in that thou hast forsaken the Lord thy God when He led thee by the way? — hast thou not procured this unto thyself, the Israelites having brought this calamity upon themselves, in that thou hast forsaken the Lord, thy God, when He led thee by the way? on the good path of His will, on the road of righteousness.

18 And now what hast thou to do in the way of Egypt, to drink the waters of Sihor? Or what hast thou to do in the way of Assyria, to drink the waters of the river? — Or what hast thou to do in the way of Assyria; to send to them for help; for this was the usual method of first the house of Israel and later the house of Judah;

when the Assyrians oppressed them, then they sent to Egypt for help; and when the Egyptians were upon them, then they applied to the Assyrians; and in both cases acted wrong, for they ought to have sought the Lord their God only.

19 Thine own wickedness shall correct thee, and thy backslidings shall reprove thee. Know therefore and see that it is an evil thing and bitter that thou hast forsaken the Lord thy God, and that the fear of Me is not in thee,” saith the Lord God of hosts. — thine own wickedness shall correct thee… that is, either their wickedness in going to Egypt and Assyria, and the ill success they had in so doing might be an instruction to them to act otherwise, and a correction of their sin and folly; or that their wickedness was a reason, and a very just one, why they were chastened and corrected by the Lord.

20 “For of olden time I have broken thy yoke and burst thy bonds; and thou saidst, ‘I will not transgress,’ when upon every high hill and under every green tree thou wanderest, playing the harlot. — upon every high hill, and under every green tree, thou wanderest, playing the harlot; that is, committing spiritual whoredom or idolatry with idols, set on high hills and mountains, and under green trees, groves, and shady places; going from one idol to another, as harlots go from one stew to another; or as whoremongers go from harlot to harlot.

21 Yet I had planted thee, a noble vine, wholly a right seed. How then art thou turned into the degenerate plant of a strange vine unto Me? — yet I had planted thee a noble vine, wholly a right seed… it is usual to compare the children of Israel to a vineyard, and to vines; and their settlement in the land of Canaan to the planting of vines in a vineyard; see Isaiah 5:1.

22 For though thou wash thee with soda and take thee much soap, yet thine iniquity is marked before Me,” saith the Lord God. — the sense is, let this backsliding and degenerate people take whatever methods they need to cleanse themselves from their sins, as by their ceremonial ablutions and sacrifices, which was the usual method they had recourse to, to purify themselves, and in which they rested:

— yet thine iniquity is marked before me, saith the Lord God; or, “will retain its spots” these remain; the filth are not washed away; their iniquities are not hidden and covered; they appears very plain and manifest;

— the Targum says, “for if you think to be cleansed from your sins, as they cleanse with nitre, or make white with “borith”, or soap; lo, as the mark of a spot which is not clean, so are your sins multiplied before me, saith the Lord God.”

23 “How canst thou say, ‘I am not polluted; I have not gone after the Baalim’? See thy way in the valley; know what thou hast done. Thou art a swift dromedary traversing her ways, — I have not gone after Baalim? or, “the Baalim”; the idols of the people, as the Targum interprets it; for there were many Baals, as Baalzephon, Baalpeor, Baalzebub, and others.

24 a wild ass used to the wilderness, that snuffeth up the wind at her pleasure. In her need who can turn her away? All they that seek her will not weary themselves; in her month they shall find her.

25 Withhold thy foot from being unshod, and thy throat from thirst. But thou saidst, ‘There is no hope; no, for I have loved strangers, and after them will I go.’

26 “As the thief is ashamed when he is found, so is the house of Israel ashamed—they, their kings, their princes, and their priests and their prophets, — as the thief is ashamed when he is found, put to shame by the evidences of his guilt, so is the house of Israel ashamed; they, their kings, their princes, and their priests, and their prophets, leaders and people in the same condemnation.

27 saying to a stock, ‘Thou art my father,’ and to a stone, ‘Thou hast brought me forth.’ For they have turned their back unto Me, and not their face; but in the time of their trouble they will say, ‘Arise, and save us!’

28 But where are thy gods that thou hast made thee? Let them arise if they can save thee in the time of thy trouble; for according to the number of thy cities are thy gods, O Judah. — but where are thy gods that thou hast made? Let them save thee in times of thy troubles, O Judah! Idolaters of all times and places have the same experience, namely, that idols of any kind cannot deliver them from trouble, no matter how great their numbers.

29 “Why will ye plead with Me? Ye all have transgressed against Me,” saith the Lord. — ye all have transgressed against me, saith the Lord; high and low, rich and poor, great and small; men of all ranks, degrees, and character; kings, priests and prophets; and therefore ought not to contend with God, and charge him with injustice or unkindness, but themselves with folly and wickedness.

30 “In vain have I smitten your children; they received no correction. Your own sword hath devoured your prophets like a destroying lion. — the rod of chastisement was used in vain; the afflictions that came upon them had no effect on them to amend and reform them; they were never the better for them:

— your own sword hath devoured your prophets, like Isaiah, who were sent to them to reprove and correct them, but they were so far from receiving their correction, that they put them to death.

31 O generation, see ye the word of the Lord! Have I been a wilderness unto Israel? A land of darkness? Why say My people, ‘We are lords; we will come no more unto Thee’?

32 Can a maid forget her ornaments, or a bride her attire? Yet My people have forgotten Me days without number. — yet my people have forgotten me; which shows great stupidity and ingratitude; the Lord not being so much to them, from whom they had received so many favours, as the ornaments of a maid, and the attire of a bride, are to them.

33 Why readiest thou thy way to seek love? Therefore hast thou also taught the wicked ones thy ways. — the Targum says: “why dost thou make thy way beautiful, to procure loves (or lovers) to be joined to the people?”

— or the sense is, why art thou so diligent and industrious to make thy way, which is exceeding bad, look a good one, by sacrifices and ceremonies, oblations and ablutions, in order to seek and obtain my love and favour, which is all in vain? it is not to be gained by such methods.

34 Also in thy skirts is found the blood of the souls of the poor innocents; I have not found it by secret search, but upon all these. — in thy skirts is found the blood of poor innocents, of holy men and prophets who dared to reprove Israel for her sins. I have not found it by secret search, such a careful scrutiny was not necessary in this case, but upon all these, on account of the sin of idolatry, which finally led to the murder of the Lord’s servants.

35 Yet thou sayest, ‘Because I am innocent, surely His anger shall turn from me.’ Behold, I will plead with thee because thou sayest, ‘I have not sinned.’ — surely his anger shall turn from me; the anger of God, since innocent; or, “let his anger be turned from me”, or as the Septuagint says; pleading for the removing of judgements upon the foot of innocency, which is pretended.

36 Why gaddest thou about so much to change thy way? Thou also shalt be ashamed of Egypt as thou wast ashamed of Assyria. — sometimes going one way, and sometimes another; sometimes to Egypt, and then to Assyria; seeking sometimes to the one for help, and sometimes to the other;

why change thy way? in forming alliances with her heathen neighbors. Thou also shall be ashamed of Egypt, whose vassal Israel was for a while, as thou wast ashamed of Assyria, after King Ahaz had sent there for help, but ultimately ended up being their captives.

37 Yea, thou shalt go forth from him with thine hands upon thine head; for the Lord hath rejected thy confidences, and thou shalt not prosper in them. — and thine hands upon thine head; plucking and dishevelling the hair, as women in distress; so Tamar, when abused by her brother, laid her hand on her head, and went out crying, 2 Samuel 13:19.

A Study Index of Revelation

•October 29, 2021 • Leave a Comment

In the Study, we’ll find that John’s prophecies were not solely meant to be fulfilled during his time; although some of them were, but the majority of their timing were a great distance into the future, into our time.

A Study Index of Revelation

Table of Contents

Chapter 1

— John was in vision on the Island of Patmos
— the Revelation of Jesus Christ, not John
— before the throne of God the Father
— seven spirits before His throne
— the “hand of God” vs the “spirit of God”

~ Chapter 2

— messages to the seven churches
— Ephesus; some are apostles, others art liars
— Smyrna; works in tribulation, but thou art rich
— Pergamos; thou dwellest where Satan’s seat is
— Thyatira; Jezebel who calleth herself a prophetess

A Study of Chapters 1 and 2 HERE ~ —— ~

Chapter 3

— Sardis; thou hast a name, but thou art dead
— Philadelphia; before thee an open door, no man can shut
— Laodicean; thou art lukewarm, and neither cold nor hot
— thou art wretched, miserable, poor, blind and naked

~ Chapter 4

— in heaven, One sat on the throne
— the 24 elders; art thou angels or saints?
— before the throne a sea of glass like crystal
— absence of the “Holy Ghost” around the throne

A Study of Chapters 3 and 4 HERE ~ —— ~

Chapter 5

— a book sealed with seven seals
— in the midst of the throne are four living beings
— a Lamb having seven horns and seven eyes
— the 4 creatures and 24 elders worship the Lamb

~ Chapter 6

— the first seal, a white horse with a bow
— second seal, a red horse
— third seal, a black horse
— fourth seal, a pale horse
— fifth seal, men that were slain
— sixth seal, a great earthquake

A Study of Chapters 5 and 6 HERE ~ —— ~

Chapter 7

— I heard the number of them that were sealed
— a hundred forty-four thousand of the tribes of Israel
— included are of the tribe of Manasseh
— of the tribe of Joseph
— but no mention of the tribe of Dan

~ Chapter 8

— the opening of the seventh seal
— seven angels were given seven trumpets
— another stood at the altar, having a golden censer
— first angel with trumpet blown; fire mingled with blood
— second angel; a mountain with fire; sea became blood
— third angel; fell a great star from heaven
— fourth angel; the sun smitten the world darkened
— fifth trumpet blown: “Woe, woe, woe”

A Study of Chapters 7 and 8 HERE ~ —— ~

Chapter 9

— fifth angel sounded; first woe, out came smoke locusts
— sixth angel sounded; loose 4 angels from the Euphrates
— releasing the two hundred millions
— a third part of men killed by fire, smoke and brimstone,
— seventh angel appears in both chapters 10 and 11

~ Chapter 10

— another mighty angel come with a little book
— thunders uttered, but write not; secrets still sealed
— seventh angel sounded; “Go and take the little book”
— “Take it and eat it, and it shall make thy belly bitter
— but it shall be in thy mouth sweet as honey.”
— “Thou must prophesy again . . .

A Study of Chapters 9 and 10 HERE ~ —— ~

Chapter 11

— “Rise, and measure the temple and the altar”
— power to two witnesses who shall prophesy 1260 days
— there was another great earthquake
— second woe is passed
— third woe; seventh angel sounded
— locusts as scorpions and have stingers in their tails

~ Chapter 12

— a woman clothed with the sun and moon under her feet
— being with child, she cried, travailing in birth
— a great red dragon, having seven heads and ten horns
— his tail drew a third part of the stars of heaven
— woman brought forth a child, but taken to heaven
— the dragon went after remnant of her seed

A Study of Chapters 11 and 12 HERE ~ —— ~

Chapter 13

— a beast rise up out of the sea
— his heads was, as it were, wounded
— his mouth in blasphemy against God
— another beast coming up out of the earth
— he had two horns like a lamb
— but he spoke like a dragon

~ Chapter 14

— the hundred forty and four thousand
— “Babylon is fallen! is Fallen!”
— the third angel, “If any man worship the beast”
— he shall drink the wrath of God
— the Son of Man, in his hand a sharp sickle
— and gathered the vine of the earth

A Study of Chapters 13 and 14 HERE ~ —— ~

Chapter 15

— seven angels holding seven last plagues
— a sea of glass mingled with fire
— they sing the song of Moses
— another seven angels each given a golden vial
— full of the wrath of God

~ Chapter 16

— seven vials of the wrath of God 
— fifth vial poured upon the seat of the beast
— sixth vial poured upon the great river Euphrates
— a place called in the Hebrew tongue, Armageddon
— seventh vial poured out his vial into the air
— there fell upon men a great hail out of heaven

A Study of Chapters 15 and 16 HERE ~ —— ~

Chapter 17

— seven angels, each with a vial
— a woman sitting upon a scarlet-colored beast
— the woman arrayed in purple and scarlet color
— Mystery, Babylon the Great, Mother of Harlots
— the woman was drunk with the blood of the saints
— ten horns shall hate the whore

~ Chapter 18

— “Babylon the great is fallen, is fallen”
— therefore shall her plagues come in one day
— the kings of the earth shall bewail and lament her
— “Alas! Alas, that great city is made desolate!”
— in her was found the blood of prophets and saints

A Study of Chapters 17 and 18 HERE ~ —— ~

Chapter 19

— a great multitude of people in heaven
— with the 24 elders and the four living creatures
— the voice of a great multitude, saying, “Alleluia!
— “Blessed are they at the marriage of the Lamb”
— a white horse with “a sharp two edged sword”
— the beast was taken and with him the false prophet
— both cast alive into the lake of fire and brimstone

~ Chapter 20

—  an angel laid hold on the dragon
— first general resurrection before the Millennium
— the saints to rule a thousand years
— Gog and Magog from the four quarters of the earth
— the Great White Throne appears after the Millennium
— names written in the Book of Life

A Study of Chapters 19 and 20 HERE~ —— ~

Chapter 21

— after the Millennium a new heaven and a new earth
— New Jerusalem coming down out of heaven
— “Behold, I make all things new”
— new City has a great high wall with twelve gates
— the city lit up by the Glory of God, the Shekinah
— more names written in the Lamb’s Book of Life

~ Chapter 22

— a pure river of the Water of Life
— the Shekinah, glory of God will lit the sky
— “I am Alpha and Omega, the Beginning and the End”
— “If any man shall add unto these things”
— more on liars and the ever absent holy ghost

A Study of Chapters 21 and 22 HERE ~ —— ~

Revelation (Ch 21-22)

•October 27, 2021 • Leave a Comment

Chapter 21 contains an account of the happy state of those being saved, consisting of all the elect, both Jews and Gentiles, which will take place upon the first resurrection, and will continue during the thousand years’ reign, and which will be happy times in the new heaven and the new earth.

Revelation 21

1 And I saw a new heaven and a new earth, for the first heaven and the first earth had passed away, and there was no more sea. — a new atmosphere took place when saints came not to Mount Sinai, but to Mount Zion, the city of the living God, the heavenly Jerusalem; and when God dwelt among men;

— everything that has any connection with sin will be removed; the ‘sea’ also, from which the beast and the dragon came forth, will be no more.

And I, John, saw the holy city, New Jerusalem, coming down from God out of heaven, prepared as a bride adorned for her husband. — the holy city, New Jerusalem, coming down from heaven from God, all ready like a bride arrayed for her husband;

— earth shall then become as heaven, or rather it shall be heaven on earth; God dwelling visibly among men, and sin and suffering being forever done away. 

And I heard a great voice out of heaven, saying, “Behold, the tabernacle of God is with men, and He will dwell with them; and they shall be His people, and God Himself shall be with them and be their God. — saying, behold the tabernacle of God is with men; in allusion to the tabernacle being with the Israelites in the wilderness, and the Shekinah, or divine Glory and Majesty, being in the midst of them, as an accomplishment of the promise in Ezekiel 37:27;

— the phrase seems to denote the personal presence of God the Father appearing with his Son, the Messiah with his saints in the Temple; and reign among them as their King.

And God shall wipe away all tears from their eyes, and there shall be no more death, neither sorrow, nor crying, neither shall there be any more pain; for the former things are passed away.” — and there shall be no more death; natural or violent; or persecution of them as in former times; nor will they die a natural death any more; these children of the resurrection;

— and inhabitants of the new heaven and earth, and as kings and priests, they will live better than angels.

And He that sat upon the throne said, “Behold, I make all things new.” And He said unto me, “Write, for these words are true and faithful.” — and he that sat upon the throne said… by whom is meant, God the Father, who is often represented in this book as sitting on the throne, as distinguished from Christ the Lamb.

And He said unto me, “It is done! I am Alpha and Omega, the beginning and the end. I will give unto him that is athirst of the fountain of the Water of Life freely. — God the Father is also the Alpha and Omega, as Aleph is the beginning of the Hebrew alphabet; and cause of all things; as Tau is the last of the Hebrew alphabet;

— in fact, this same title “Alpha and Omega,” among many others, are derived from the Father’s.

He that overcometh shall inherit all things; and I will be his God, and he shall be my son. — he that overcometh… against all spiritual enemies, sin, Satan, and the world, the antichristian beast, his image, mark; not being deceived; obey his commandments who is more than a conqueror through Christ;

one that perseveres to the end, notwithstanding all temptations, trials and difficulties.

But the fearful, and unbelieving, and the abominable, and murderers,and whoremongers, and sorcerers, and idolaters, and all liars, shall have their part in the lake which burneth with fire and brimstone, which is the second death.” — the Ethiopic version renders it, “who pollute themselves” with unnatural lusts;

— and all liars; and particularly those who speak lies in successions, as the followers of the man of sin, and who are given up to believe a lie, that they might be damned; all lies being of the devil, and abominable to God. Each and everyone of them are.

And there came unto me one of the seven angels, who had the seven vials full of the seven last plagues, and talked with me, saying, “Come hither; I will show thee the bride, the Lamb’s wife.” — the bride, his wife, all the elect of God, consisting of the raised and living saints at the coming of Christ; who will make up one body, one general assembly;

— and be as a bride, prepared and adorned for her husband: these were first betrothed to Christ in eternity, and now all glorified, the marriage is consummated, and they are declared publicly to be the bride, the Lamb’s wife; Revelation 19:7.

10 And he carried me away in the spirit to a great and high mountain, and showed me that great city, the Holy Jerusalem, descending out of heaven from God, — John never saw this Holy Jerusalem or “the new Jerusalem” before; so this is another new revelation.

11 having the glory of God. And her light was like unto a stone most precious, even like a jasper stone, clear as crystal. — even like a jasper stone, clear as crystal: God the Father, who sits on the throne, is said to be looked upon like a “jasper”;

— the divine Shekinah illuminating the whole city, perhaps the whole earth which pendant in the air, shone with an elegant and amazing lustre, expressive of the perfect illumination, purity, and holiness of its happy inhabitants.

12 It had a wall great and high, and had twelve gates, and at the gates twelve angels; and names were written thereon, which are the names of the twelve tribes of the children of Israel: — but these gates of that great city, the New Jerusalem, are said to be twelve, in allusion to the twelve apostles, who pointed out to men the way of salvation by Christ; and to the twelve tribes of Israel, who represent all the elect of God, and to the twelve gates of Ezekiel’s city, Ezekiel 48:31;

— or, having a great and high wall, having twelve gates, and upon the gates twelve angels and their names inscribed, which are the twelve tribes of the children of Israel: on the east three gates and on the north three gates and on the south three gates and on the west three gates; and the wall of the city having twelve foundations, and on them the twelve names of the twelve apostles of the Lamb.

13 on the east three gates, on the north three gates, on the south three gates, and on the west three gates. — East: Issachar, JUDAH, Zebulon;

— West: Benjamin, EPHRAIM, Manasseh;

— North: Asher, DAN, Naphtali;

— South: Gad, REUBEN, Simeon;

— but these would be different from that of Ezekiel 48:31 shall be the gates of the city, named for the tribes of Israel, three gates toward the north: the gate of Reuben, one; the gate of Judah, one; the gate of Levi, one.

14 And the wall of the city had twelve foundations, and on them the names of the twelve apostles of the Lamb.

15 And he that talked with me had a golden reed to measure the city, and the gates thereof and the walls thereof.

16 And the city lieth foursquare, and the length is as great as the breadth; and he measured the city with the reed: twelve thousand furlongs; the length and the breadth and the height of it are equal. — and the city lieth four square… to the four corners of the world, from whence its inhabitants come, and denotes the regularity, uniformity, perfection, and immovableness of it;

— and he measured the city with the reed, twelve thousand furlongs; or fifteen hundred miles; a monstrously large city indeed! such an one as never was upon earth; see Ezekiel 48:35 and which shows, that this is not to be understood literally, but mystically;

— and intends the capaciousness of it, here being room enough for all the twelve tribes of Israel; that is, for all the elect of God; for as in Christ’s Father’s house, so in this kingdom state of his, there will be many mansions, or dwelling places, enough for all his people. This city will hold them all;

— the Jews say of the Jerusalem to come, that in time it shall be so enlarged as to reach to the gates of Damascus, yea, to the throne of glory.

17 And he measured the wall thereof: a hundred and forty and four cubits, according to the measure of a man, that is, of the angel.

18 And the wall was built of jasper; and the city was pure gold, like unto clear glass. — the jasper being a very hard and bright stone; and salvation can never be made void; it will last for ever, and in this state will come forth as light, as a lamp that burneth; it is represented by the same precious stone as God sitting on his throne; see Revelation 4:2.

19 And the foundations of the wall of the city were garnished with all manner of precious stones: the first foundation was jasper, the second sapphire, the third chalcedony, the fourth emerald,

— (1) jasper, on this stone, in the breastplate, Benjamin’s name was written (2) sapphire, its colour is azure, or sky blue (3) chalcedony, a misty grey colour, clouded with blue, yellow, or purple (4) emerald, on this stone Judah’s name was written.

20 the fifth sardonyx, the sixth sardius, the seventh chrysolite, the eighth beryl, the ninth topaz, the tenth chrysoprase, the eleventh jacinth, and the twelfth amethyst.

— (5) sardonyx, partly of the sardian, and partly of the onyx stone (6) sardius, this was Reuben’s stone (7) chrysolite, a stone of a dusky green colour, with a cast of yellow (8) beryl, a stone of a pale green colour (9) topaz, a stone very hard and transparent, of a beautiful yellow, or gold colour (10) chrysoprase, a stone of a green colour, inclining to that of gold (11) jacinth, a stone of a purple, or violet colour (12) amethyst, a stone of a violet colour, bordering on purple.

21 And the twelve gates were twelve pearls; each separate gate was of one pearl, and the street of the city was pure gold, as it were, transparent glass. — a single gate was of one pearl; the pearl of great price: this shows that this account cannot be taken literally, but mystically, for no such pearl was ever known, large enough to make a gate of.

22 And I saw no temple therein, for the Lord God Almighty and the Lamb are the temple of it. — poor thing, the Holy Ghost always missed out! and those who call themselves “pastors” are continuing telling lies saying and re-enforcing in numerous ways that there is a holy ghost!  

— Revelation 21: 8 above: “and all liars,” shall have their part in the lake which burneth with fire and brimstone;

— so is it wrong to say that 99.99 percent of professing Christians are LIARS?

23 And the city had no need of the sun, neither of the moon to shine in it; for the glory of God gave it light, and the Lamb is the light thereof. — for the glory of God did lighten it; the Shekinah, or glorious presence of God, which filled the temple of Solomon, and shone round about the shepherds at the incarnation of Christ; with the presence of God, who is light itself.

24 And the nations of them that are saved shall walk in the light of it, and the kings of the earth bring their glory and honor into it. — and the nations of them which are saved… most nations are saved, with a few exceptions: Ammon, Tyre, the Amalekite and perhaps a section of Egypt.

26 and they shall bring the glory and honor of the nations into it.

27 And there shall in no wise enter into it anything that defileth, neither whatsoever worketh abomination, or maketh a lie, but only they that are written in the Lamb’s Book of Life. — those that are written in the book of the Lamb, the true children, the elect of God, will enter the heavenly city, where they will have complete and perfect salvation. Then shall the righteous shine like the sun in their Father’s kingdom. He that hath ears to hear, let him hear!

Revelation 22

Chapter 22 contains a further account of New Jerusalem, a City beautified by the river that ran through it, called a river of water of life, said to be pure and clear as crystal, and to have its rise from the throne of God and the Lamb; and by the tree of life in its midst, situated on each side the river, bearing twelve sorts of fruit, yielded every month, the leaves of which heal the nations.

1 And he showed me a pure river of the Water of Life, clear as crystal, proceeding out of the throne of God and of the Lamb. — and he showed me the river coming forth out of the throne of God and of the Lamb; a great stream or river watered the Garden of Eden, so here the heavenly Paradise receives its water from a healing stream of perennial waters issuing from the throne of God and of the Lamb Himself. 

In the midst of the street of it, and on either side of the river, there was the Tree of Life, which bore twelve kinds of fruit and yielded her fruit every month; and the leaves of the tree were for the healing of the nations. — there twelve kinds of fruit are planted on each side of beautiful trees, not only to serve for ornament and refreshment, but which, like the tree of life in paradise, should make the inhabitants immortal.

And there shall be no more curse, but the throne of God and of the Lamb shall be in it, and His servants shall serve Him.

And they shall see His face, and His name shall be in their foreheads. — and they shall see his face… the face of God, so as if he is not to be seen ’till now; they shall see him as he is; not only the angels, who always behold the face of God, but all the saints, risen and changed, being pure in heart, and perfectly holy; they shall see him face to face;

— it appears as if during the Millennium the saints didn’t managed to see the Father’s face, only after the Millennium is over?

And there shall be no night there, and they will need no candle, neither light of the sun; for the Lord God giveth them light. And they shall reign for ever and ever. — again, for the glory of God will lit the sky; the Shekinah, or glorious presence of God will be manifested.

And he said unto me, “These sayings are faithful and true,” and the Lord God of the holy prophets sent His angel to show unto His servants the things which must shortly be done.

“Behold, I come quickly.” Blessed is he that keepeth the sayings of the prophecy of this book. — this book is a prophecy of things to come, and therefore cannot refer to the times of Jerusalem’s destruction in 70 AD or 132 AD, which some interpreters do, like the book of Ezekiel, for then it would be a narrative of things past; the sayings of it are the things contained in it; to keep these sayings is to read them with an open mind with observation, so that as events unfold we can meditate upon them.

And I, John, saw these things and heard them. And when I had heard and seen, I fell down to worship before the feet of the angel who showed me these things.

Then said he unto me, “See that thou do it not, for I am thy fellow servant, and of thy brethren the prophets, and of them that keep the sayings of this book. Worship God!” — this is the second time John did so, though being warned of and rebuked for it; 

— for angels are not to be worshipped; hence John was forbidden to worship an angel, any angel; the angel being a fellow servant of the same Lord;

— worship God: Father and Son, and these two only, not three, with reverence and godly fear and according to God’s revealed will.

10 And he said unto me, “Seal not the sayings of the prophecy of this book, for the time is at hand.

11 He that is unjust, let him be unjust still; and he that is filthy, let him be filthy still; and he that is righteous, let him be righteous still; and he that is holy, let him be holy still.”

12 “And behold, I come quickly, and My reward is with Me, to give to every man according as his work shall be.

13 I am Alpha and Omega, the Beginning and the End, the First and the Last.” — God the Father is also the Alpha and Omega, as Aleph is the beginning of the Hebrew alphabet; and cause of all things; as Tau is the last of the Hebrew alphabet.

14 Blessed are they that do His commandments, that they may have right to the Tree of Life, and may enter in through the gates into the city. faith alone isn’t enough; commandments need to be kept, which are the whole duty of man; so the question is, which commandments to keep? This is a life-long question.

15 For outside are dogs and sorcerers, and whoremongers and murderers and idolaters, and whosoever loveth and maketh a lie. — lying is a serious crime, and many are liars, particularly those lying tongues that speak lies in successions; (more at the end):

16 These six things doth the Lord hate, yea, seven are an abomination unto Him:
17 a proud look, a lying tongue, hands that shed innocent blood,
18 a heart that deviseth wicked imaginations, feet that be swift in running to mischief,
19 a false witness that speaketh lies, and he that soweth discord among brethren. Proverbs 6:16-19

16 “I, Jesus, have sent Mine angel to testify unto you these things in the churches. I am the Root and the Offspring of David, and the Bright and Morning Star.” — both in a temporal and spiritual sense; he sprung from the root of David, or descended from him;

— as David’s Lord and David’s Son; he is also the bright Star of the morning; not the other “light bringer” Lucifer, which the Roman church had given him.

18 For I testify unto every man that heareth the words of the prophecy of this book: If any man shall add unto these things, God shall add unto him the plagues that are written in this book. — this may likewise be considered as an awful sanction given to the whole Scriptures; in like manner, as Moses guarded the law, (Deuteronomy 4:2Deuteronomy 12:32,). It is equally true, however, that this solemn caution particularly refers to this book of the Revelation.

19 And if any man shall take away from the words of the book of this prophecy, God shall take away his part out of the Book of Life and out of the Holy City, and from the things which are written in this book.

20 He that testifieth these things saith, “Surely I come quickly.” Amen. Even so, come, Lord Jesus.

21 The grace of our Lord Jesus Christ be with you all. Amen.

~~~

More on liars and the non-existing yet offending ‘holy ghost’:

Throughout the study of this mysterious holy ghost we have found him to be missing in the entire book of Revelation. John never saw him; it is as if he had taken a long journey away, or that he was lying in bed with a flu. He was simply not around; Period.

But there was one cherub in the Garden, full of beauty and power, but pride and ego swelled over his head, and he slowly envy and like to be the Most High, led a rebellion to take over the heavenly throne of the Most High, but he was kicked out and fallen like lightning down onto this earth. He was and is the dragon, the Devil, Lucifer, the other ‘light-bringer’ which the Roman church, whom John describes as the great whore of Babylon, has so much affiliation with, and that this lie is also well-embedded and entrenched by her protesting harlotry daughters.

Such deceitful doctrine is a big cover-up of the Devil, who craves to be the Third Person, but is an abomination to God. There are professing Christians who loves to invent lies, others to tell lies, and still others loves to hear them; more so with this doctrinal lie of the holy ghost. Unless repented off, such lie infuriates both the Father and the Son, and the penalty is death: “and all liars, shall have their part in the lake which burneth with fire and brimstone, which is the second death,” Revelation 21:8.

Revelation (Ch 19-20)

•October 25, 2021 • Leave a Comment

Chapter 21 contains the triumph of the saints over Babylon, and their thanksgiving to God because of his judgements on her; the marriage of Christ and his church, and a battle between him and his and her enemies, with the beast and false prophet both cast alive into the lake of fire and brimstone.

Revelation 19

1 And after these things I heard a great voice of a multitude of people in heaven, saying, “Alleluia! Salvation and glory and honor and power, unto the Lord our God, — saying Alleluia; an Hebrew word, which signifies “praise ye the Lord,”

— since He has judged the great harlot John heard the songs of the righteous and saints to rejoice at her overthrow, and a mighty angel had expressed her ruin in the strongest terms, with the reasons of it.

for true and righteous are His judgements: He hath judged the great whore who corrupted the earth with her fornication, and hath avenged the blood of His servants at her hand.” — His judgements, His sentences, are just and true; they have been rendered in accordance with His promises; and they are just and true.

And again they said, “Alleluia!” And her smoke rose up for ever and ever. — by the words “Praise ye the LORD”, as in Psalms 106:1;

— hallelujah! the great harlot is cast into the abyss of fire and brimstone; as smoke rose, she was burned with fire.

And the four and twenty elders and the four living beings fell down and worshipped God who sat on the throne, saying, “Amen! Alleluia!” — of the four and twenty elders and four living creatures, who worship God, assent to what had been before said, and join in praising the Lord.

And a voice came out of the throne, saying, “Praise our God, all ye His servants, and ye that fear Him, both small and great.” — and ye that fear him, both small and great; whether greater or lesser believers, fathers, young or old; Jews or Gentiles, or of whatsoever nation, kindred, or people; see Psalms 115:13.

And I heard, as it were, the voice of a great multitude, and the voice of many waters, and the voice of mighty thunderings, saying, “Alleluia! For the Lord God Omnipotent reigneth. — the voice of a great multitude… even of all the servants of the Lord, and them that fear him, small and great; a vast multitude of converted Jews and Gentiles, from all parts of the world, who in answer to the voice out of the throne, came with songs, dances and energy, lift up their voices in praise to God, both for their own redemption, and for the downfall of Babylon;

— saying, Alleluia; or praises the four and twenty elders and four living creatures, the 144,000; and this is the fourth time the same word is used in this context.

Let us be glad and rejoice and give honor to Him, for the marriage of the Lamb is come, and His wife hath made herself ready.” — for the marriage of the Lamb is come; that is, of Christ, the Son of God, with the Church more especially; first was a secret betrothing of all the elect before the world began; and there is an open espousal of every individual of them at conversion; but the public and general solemnization of the nuptials will not be until now before the personal reign of Christ;

— the bride, moreover, is clothed in the most gorgeous wedding-garment, all pure white and shining with brilliancy. It is a pure, precious dress of honor, the dress of a bride worthy to ruin with Him.

And to her was granted that she should be arrayed in fine linen, clean and white; for the fine linen is the righteousness of saints. — “the marriage of his Lamb is come, and the wife is prepared”; and that her preparation is by her own merits and works of righteousness;

— these are those that passed the last judgement; and are found justified, also because of their excellency; so other Scripture uses the word in the plural: the Targum on Zechariah 3:4 paraphrases the text, “I will clothe thee” זכוך, “with righteousnesses.”

And he said unto me, “Write: ‘Blessed are they that are called unto the marriage supper of the Lamb.’” And he said unto me, “These are the true sayings of God.” — and he saith unto me, write… what follows, because of the importance of it, and that it may be regarded and remembered: the person speaking is either the voice from the throne, Revelation 19:5 or the angel that attended John all along, and showed him this revelation, Revelation 1:1 asking John to write them down.

10 And I fell at his feet to worship him. But he said unto me, “See that thou do it not! I am thy fellow servant and one of thy brethren, who hold to the testimony of Jesus. Worship God! For the testimony of Jesus is the spirit of prophecy.” — so this is the angel speaking, one of the ministering spirits or angels; he being a servant of the same Lord as John; for angels are not to be worshipped.

11 And I saw heaven opened, and behold, a white horse; and He that sat upon him was called Faithful and True, and in righteousness He doth judge and make war. — this is Christ on a white horse, with a sword (verse 15: “a sharp two edged sword”), not with a bow that the beast had, conquering and to conquer; will fully execute to the utter destruction of all his enemies.

12 His eyes were as a flame of fire, and on His head were many crowns; and He had a name written that no man knew, but He Himself. — His eyes were as a flame of fire  and on His head He had many diadems, having a name written which no one knows but Himself, and clothed with a garment bespattered with blood.

13 And He was clothed with a vesture dipped in blood, and His name is called, The Word of God. — and clothed with a garment bespattered with blood, or else in the blood of his saints, he now comes to avenge; or rather in the blood of his enemies, with which he appears as stained; and His name is called “The Word of God.”

— the metaphor is taken from persons treading in a winepress, whose garments are stained with blood of grapes; see Revelation 19:15.

14 And the armies which were in heaven, clothed in fine linen white and clean, followed Him upon white horses. — upon white horses; they had served Christ in his Gospel, which some of them had preached, and all professed, and had maintained the purity of doctrines and practices, and now triumphed in Christ, and along with him, riding upon horses of the same colour with his, as being his princes and nobles, and whom he had made them kings as well as priests.

15 And out of His mouth goeth a sharp sword with which He shall smite the nations, and He shall rule them with a rod of iron; and He treadeth the wine press of the fierceness and wrath of Almighty God. — “a sharp two edged sword” and that with it he should smite the nations; and those that have adhered to Babylon, and have drunk of the wine of her fornication;

— and he shall rule them with a rod of iron; use them with the utmost severity; the phrase is taken out of Psalms 2:9 a prophecy of Christ.

16 And He hath on His vesture and on His thigh a name written: King of kings, And Lord of lords. — which will well suit him now when he shall be openly King over all the earth; the great army of heaven, consisting of the troops of all the elect, takes part in the triumph of their Conqueror. — or KING OF KINGS, AND LORD OF LORDS To show that he was really possessed of an enormous dominion over all the princes and kingdoms of the earth? as his mouth proceeds a sharp double-edged sword, that with it He should smite the nations, and Himself will rule them with an iron rod.

17 And I saw an angel standing in the sun, and he cried with a loud voice, saying to all the fowls that fly in the midst of heaven, “Come and gather yourselves together unto the supper of the great God, — for not only will the corpses of the enemies of the Lord lie unburied, in itself one of the worst misfortunes which men knew of, but their bodies should become the prey, the food, of the birds, mainly the vultures that fly in the sky above the heads of men.

18 that ye may eat the flesh of kings, and the flesh of captains, and the flesh of mighty men, and the flesh of horses and of them that sit on them, and the flesh of all men, both free and bond, both small and great.” — Come, gather yourselves to the great feast of God, that ye may eat the flesh of kings, the flesh of general, the flesh of mighty ones, the flesh of horses, of those that sit upon them, and the flesh of all free as well as of slaves, both small and great;

— this is a ghastly announcement, all the more so because of its finality. In a most commanding and conspicuous position the angel with this command is placed, in order that all hearers should realize and appreciate its importance;

— the destruction of Anti-Christ and of his host is thus assured from the beginning; they will be given to the evil spirits, to the devil and his angels, to be destroyed and tormented forever.

19 And I saw the beast, and the kings of the earth, and their armies gathered together to make war against Him that sat on the horse, and against His army. — and l saw the beast… is this beast the one that hate the whore and shall make her desolate and naked, and shall eat her flesh and burn her with fire? Revelation 17:16;

— or, perhaps the remains of the antichristian civil and religious powers, and which, though it may chiefly regard the antichrist, and the remains of their idolatry, or may take in any of the Mahometan powers, which may join together in this battle; the beast will survive for a while after the downfall of his seat, Babylon or Rome.

20 And the beast was taken, and with him the false prophet who wrought miracles in his presence, by which he deceived them that had received the mark of the beast, and them that worshipped his image. These both were cast alive into a lake of fire, burning with brimstone. — seem like the beast and the false prophet were not destroyed until now; perhaps they fall earlier and captured but were not eliminated until now;

— Gill: the Alexandrian copy reads, “and they that are with him, the false prophet Jezebel”; the false prophetess and her children, who will now be killed with death, Revelation 2:20;

— both were cast alive into a lake of fire burning with brimstone; which is the second death, Revelation 21:8. The severe punishment of antichrist, considered in both his capacities, civil and ecclesiastic, is expressed by being “cast into a lake of fire”;

— not material fire, but the wrath of God, which will be poured out like fire, and will be intolerable; and by this lake “burning with brimstone”, which, giving a nauseous stench, aggravates the punishment;

— the allusion seems to be to the place where Sodom and Gomorrah stood, which is become a sulphurous lake, and is an emblem of the vengeance of eternal fire.

21 And the remnant were slain with the sword of Him that sat upon the horse, whose sword proceeded out of His mouth. And all the fowls were filled with their flesh. — okay any remains are now eliminated; eaten by the fowls and hyenas feasting on them.

Revelation 20

Chapter 20 contains the binding of Satan, the saints’ thousand years’ reign with Christ, the loosing of Satan again, the destruction of him, and the Gog and Magog army, and the last judgement: the angel that is to bind Satan.

1 And I saw an angel come down from heaven, having the key to the bottomless pit and a great chain in his hand. — the key of the bottomless pit: the abyss, the same out of which the beast ascended.

And he laid hold on the dragon, that serpent of old, who is the devil and Satan, and bound him for a thousand years. — that old serpent; so called with respect to his cunning and subtlety, as well as his antiquity, being from the beginning of creation, having beguiled Adam and Eve;

— with the great chain he had in his hand: the devil is in chains now, is under the power of divine Providence, and can do nothing without divine permission.

And he cast him into the bottomless pit, and shut him up and set a seal upon him, that he should deceive the nations no more till the thousand years should be fulfilled; and after that he must be loosed a little season. — and after that he must be loosed a little season; a small space of time, in comparison of the thousand years; how long it will be exactly, cannot be said; but because of the decree of God, who has so appointed it, for the glorifying of himself, in the salvation of his people, and in the final destruction of the devil, and the Gog and Magog army.

And I saw thrones and they that sat upon them, and judgement was given unto them. And I saw the souls of them that had been beheaded for the witness of Jesus and for the Word of God, and who had not worshipped the beast, nor his image, nor had received his mark upon their foreheads or on their hands; and they lived and reigned with Christ a thousand years. — and judgement was given unto the saints; that is, power, dominion, regal authority, possession of a kingdom, answerable to their character as kings, and to their position, sitting on thrones, Daniel 7:22.

But the rest of the dead lived not again until the thousand years were finished. This is the first resurrection. — this must be a first general resurrection; for the 24 elders and the 144,000 must have already been resurrected way before this time.

Blessed and holy is he that hath part in the first resurrection: on such the second death hath no power, but they shall be priests of God and of Christ, and shall reign with Him a thousand years. — this first general resurrection occurs at the beginning of the Millennium so that they will rule with Christ for a thousand years.

And when the thousand years are expired, Satan shall be loosed out of his prison, — this loosing of Satan is for a trial and testing of people born and coming into life during the Millennium; they have never been tested or judged to be worthy, not yet; so it was their turn; and that it is the same judgement upon any unbelievers for their characters; in this fiery trial God intends to purify their performance and faith from all dross to make them strong.

and shall go out to deceive the nations to the four quarters of the earth — Gog and Magog — to gather them together for battle, the number of whom is as the sand of the sea. — Gog and Magog, in Ezekiel, are said expressly (Ezekiel 38:6Ezekiel 38:15) to come from the north quarters and the north;

— but here, Gog and Magog is not the same which are mentioned in Ezekiel 38:1 though there is an allusion to them, and from thence the names are taken, but these are from the four angles, or corners, of the earth; and design the enemies of God’s people from any angle of life; so the Scriptures speak of a Gog and Magog, to signify any rebellion that will come up against Jerusalem in the days of the Messiah, whom they still expect, by whom they shall be destroyed.

And they went out over the breadth of the earth, and compassed the camp of the saints about, and the beloved city. And fire came down from God out of heaven, and devoured them. — just as Gog and Magog are said to cover the land of Israel, as a cloud, Ezekiel 38:16 and it may be observed, that the very phrase of רחב ארצך, “the breadth of thy land”, is used in the land of Israel, in Isaiah 8:8;

— and fire came down from God out of heaven, and devoured them; both material fire; with this the earth, and the bodies of the wicked then upon it, will be burnt at the end of the thousand years.

10 And the devil who had deceived them was cast into the lake of fire and brimstone, where the beast and the false prophet are; and they shall be tormented day and night for ever and ever. — the devil is being cast away the second time which might be his final state.

11 And I saw a great white throne and Him that sat on it, from whose face the earth and the heaven fled away, and there was found no place for them. — the great white throne appears only after the thousand years are over;

— John never saw this in all the chapters before this; so this is a new revelation.

12 And I saw the dead, small and great, standing before God, and the books were opened; and another book was opened, which is the Book of Life. And the dead were judged out of those things which were written in the books, according to their works. — notice, they were judged not according to their faith, but their work; that is, what commandments they believe and what they had done.

13 And the sea gave up the dead which were in it; and death and hell delivered up the dead which were in them; and they were judged every man according to their works. — and the sea gave up the dead that were in it, and death and hell gave up the dead that were in them; and they were judged, every one according to their works;

— but were judged according to their work, not their faith; that is, if it were just faith and not work, many would have been saved, but they were not, unfortunately. Faith without work is dead; James 2:26.

14 And death and hell were cast into the lake of fire. This is the second death. — and death and hell were thrown into the lake of fire. These two great enemies of mankind, that have dogged its footsteps ever since the first sin, will be disposed of forever in a punishment which fits their crime: This is the second death, the lake of fire. From this death all children of God are free, since they are partakers of the first resurrection, since the second death, eternal damnation, has no power over them.

15 And whosoever was not found written in the Book of Life was cast into the lake of fire. — but as for the wicked: and if anyone was not found written in the Book of Life, he was thrown into the lake of fire; the absence of any one’s name from this book, however, means that he is condemned forever to the place where their worm will not die, neither will their fire be quenched, and they will be an abhorrence to all flesh;

— in the Book of Life are recorded the names of all those that are saved by the Lamb; for them not even death can separate from the love of God which is in his Son, the Messiah, our Lord. Amen.

Revelation (Ch 17-18)

•October 24, 2021 • Leave a Comment

Chapters 17 and 18 contain a vision of a beast, and a woman on it, and the interpretation of it; one of the seven angels that had the seven vials proposes to John to show him the whore of Babylon: Mystery, Babylon the Great, Mother of Harlots and Abominations of the Earth, and her harlotry daughters, including Jezebel before spoken of, who all sit on many waters, with whom the kings and inhabitants of the earth have committed fornication, being intoxicated by either her or by one of her harlotry daughters.

Revelation 17

1 And there came one of the seven angels, who had the seven vials, and talked with me, saying unto me, “Come hither; I will show unto thee the judgement upon the great whore who sitteth upon many waters, — that sitteth upon many waters; which in Revelation 17:15 are interpreted of people, multitudes, nations, and tongues, subject to the jurisdiction of Rome; and so several antichristian states are in the preceding chapter signified by the sea, and by rivers and fountains of water:

— and this is said in reference to Babylon, an emblem of the Romish harlot, which was situated upon the river Euphrates, and is therefore said to dwell upon many waters.

with whom the kings of the earth have committed fornication, and the inhabitants of the earth have been made drunk with the wine of her fornication.” — still more concerning this great whore, which the dragon gave his own power and his throne and great authority to him; and quid pro quo in response for its favour, the Roman Church incorporates the ‘Holy Ghost’ into the Godhead so that he could be like the Most High;

— today most professing Christians are drunk with many other pagan practices: Easters; Christmas; either from the Babylonians or from the Egyptians.

So he carried me away in the Spirit into the wilderness; and I saw a woman sitting upon a scarlet-colored beast, full of names of blasphemy, and having seven heads and ten horns. — these are the ten kings, who being of the same mind, and of one religion, the Popish religion, gave their power, strength, and kingdom to the beast.

And the woman was arrayed in purple and scarlet color, and bedecked with gold and precious stones and pearls, having a golden cup in her hand full of abominations and filthiness of her fornication; — and this Roman Papacy was proven to be the Great Whore of Babylon of whom most of her doctrines were later adopted by her harlotry daughters; including Jezebel, who calleth herself a prophetess.

and upon her forehead was a name written: Mystery, Babylon the Great, Mother of Harlots and Abominations of the Earth. — the Romanists boast that theirs is the catholic church, and universal empire with universal values; Gregorian calendar become universal calendar, Sunday the accepted and standard day of rest; Easter, Christmas become the irresistible holidays worldwide, etc.

— and virtually all these Great Whore doctrines and practises are now adopted by all her protesting harlotry daughters.

And I saw that the woman was drunk with the blood of the saints and with the blood of the martyrs of Jesus. And when I saw her, I wondered with great amazement. — the woman was drunk with the blood of the saints…. the blood of the woman’s seed, Revelation 12:17;

— Benson: that in the war with the Albigenses and Waldenses, there perished of these poor creatures in France alone a million! From the first institution of the Jesuits to AD 1480, that is, in little more than thirty years, nine hundred thousand orthodox Christians were slain.

The beast that thou sawest was, and is not, and shall ascend out of the bottomless pit and go into perdition; and they that dwell on the earth, whose names were not written in the Book of Life from the foundation of the world, shall wonder when they behold the beast that was, and is not, and yet is. — “and yet is” much given to idolatry in another way, worshipping various “saints”; it “was” under kings, consuls, dictators, tribunes, and emperors, it “is not” in such a form of government, “and yet is” under its head the pope;

— “Rome was”, but “is not” the same it has been, in some respects, and yet is the same, for idolatry and whoredom; it has the image of old Rome, and under the power of the dragon and though antichrist but has not yet risen up in the empire to its head.

“And here is the mind which hath wisdom: The seven heads are seven mountains on which the woman sitteth.

10 And there are seven kings: five are fallen, and one is, and the other has not yet come; and when he cometh, he must continue a short space. — and when he cometh he must continue a short space; forty two months, or 1260 days; that is, so many years, which, though a long time in itself, and in the account of man, yet with God, with whom a thousand years is as one day, and in comparison of the everlasting kingdom of Christ, it is a short space; and so the reign of the beast, and of the ten kings with him, is said to be one hour, Revelation 17:12.

11 And the beast that was, and is not, even he is the eighth, yet is one of the seven and goeth into perdition.

12 And the ten horns which thou sawest are ten kings, who have received no kingdom as yet, but will receive power as kings for one hour with the beast. — the seven heads are seven mountains, where the woman sits on them; the city of seven hills Rome is called, and so this reference to the Church of Rome, is clear; for Rome was the seat of the Pope from the beginning, and all the adherents of papacy recognize Rome as the capital of their empire.

13 These have one mind, and shall give their power and strength unto the beast. — these have one mind… the princes of these kingdoms, and their subjects, become, in time, of one religion; first they were Romans, and after a long series of time there was great unity between them and their Protesting daughters, even those kingdoms as Sweden, Denmark, England, Scotland, and Ireland, and others; in respect to religious sentiments, being zealously attached to the church of Rome, its principles and practices; now happily one family.

14 These shall make war with the Lamb, and the Lamb shall overcome them; for He is Lord of lords and King of kings, and they that are with Him are called, and chosen, and faithful.” — for he is Lord of lords, and King of kings; as God and Creator, to whom the kingdom of nature and providence belongs; for this is a reason why he overcomes them: this Lamb is the lion of the tribe of Judah, and when he rouses himself, and stirs up his wrath, and exerts his power, kings and great men flee from him; this is the Word and Son of God, as to God himself, Revelation 19:16.

15 And he saith unto me, “The waters which thou sawest, where the whore sitteth, are peoples and multitudes, and nations and tongues. — are peoples, and multitudes, and nations, and tongues; denoting the vast multitude of people, of which the several kingdoms, of divers languages, all belonging to the jurisdiction of Rome Papal: and these are compared to waters, to many waters; which phrase sometimes is used for the sea.

16 And the ten horns which thou sawest upon the beast, these shall hate the whore, and shall make her desolate and naked, and shall eat her flesh and burn her with fire. — the whore should be burnt with fire; and this is to be understood literally of burning the city of Rome, and the seat of Papacy and of the whore, with fire; of which see Revelation 18:8

17 For God hath put into their hearts to fulfill His will and to agree, and to give their kingdom unto the beast, until the words of God shall be fulfilled. — and the ten horns which thou sawest and the beast, these will hate the harlot, and they will lay her waste and strip her naked; and they will eat her flesh, and they will burn her with fire; for God has given into their hearts to carry out His intention, and to execute their single purpose, and to give their kingdom to the beast, until the words of God are fulfilled.

18 And the woman whom thou sawest is that great city which reigneth over the kings of the earth.” —

Revelation 18

1 And after these things, I saw another angel come down from heaven, having great power; and the earth was lightened by his glory. — this chapter gives an account of the fall of Babylon, and of the lamentation of many; which account is announced by an angel: who descended from heaven; to proclaim:

And he cried mightily with a strong voice, saying, “Babylon the great is fallen, is fallen, and is become the habitation of devils, and the hold of every foul spirit, and a cage of every unclean and hateful bird. — that’s what the Roman Church is, an habitation of devils, the hold of every foul spirit, a cage of every unclean and hateful bird; now on plain sight.

For all nations have drunk of the wine of the wrath of her fornication; and the kings of the earth have committed fornication with her, and the merchants of the earth have waxed rich through the abundance of her indulgences pleasures.” — all nations have drunk of the wine of the wrath of her fornication… that is, all the nations of the Roman empire, the European nations, the Americas and much of Africa and Asia; and being made to drink by her, and made drunk with her idolatries. 

And I heard another voice from heaven, saying, “Come out of her, my people, that ye be not partakers of her sins, and that ye receive not of her plagues; — and this Roman Papacy was proven to be the Great Whore of Babylon of whom most of her doctrines were later adopted by her harlotry daughters; including Jezebel, who calleth herself a prophetess.

for her sins have reached unto heaven, and God hath remembered her iniquities. — their iniquities include having the world accepting the Gregorian calendar as universal calendar, instead of the Hebrew Calendar given by Him; Sunday the standard day of rest instead of His Sabbath; Easter, Christmas as standard holidays instead of God’s annual feast days.

Reward her even as she has rewarded you, and unto her double according to her works; in the cup which she hath filled, fill to her double. — and as she had stripped them naked of their clothes, and spoiled them of their worldly goods and substance, so now they should strip her naked of her harlot’s attire, of her gold, silver, and precious stones, and make her and her territories desolate;

— and as she has burnt many of the precious saints in flames, so now they shall utterly burn her with fire; and as she has shed the blood of the righteous, and drank it, and been drunk with it, they shall give her blood to drink; and as she hath killed multitudes with the sword, so now shall they kill her and her children.

How much she hath glorified herself and lived in luxury! That much torment and sorrow give back to her; for she saith in her heart,‘I sit a queen and am no widow, and shall see no sorrow.’ — and lived in a very luxuriant manner, as the popes, cardinals, archbishops, bishops, priests, monks, and friars have done; some being clothed in purple and scarlet, and in gold and silver, and all living upon the fat of the land, and in rioting and drunkenness, in chambering and wantonness:

— so much torment and sorrow give her: by pulling down her pride, which goes before a fall, than which nothing could more torment and afflict her; by stripping her of her fine clothes and rich apparel; and by taking away her fat benefices from her, which will cut her to the heart; and by burning her with fire, which will be very excruciating:

— for she saith in her heart, I sit a queen; a lady of kingdoms, as in Isaiah 47:5 to which the reference is; having a temporal power and authority over the kings of the earth, and jurisdiction over all churches, apostate ones, being the mother of harlots; and her “sitting” as such, as it well agrees with the whore on many waters, and the woman on the scarlet coloured beast and seven mountains.

Therefore shall her plagues come in one day; death, mourning and famine, and she shall be utterly burned with fire; for strong is the Lord God who judgeth her. — therefore shall her plagues come in one day… the seven last plagues, which will take very little time to execute her, one after another, if not all together; see Isaiah 47:9.

“And the kings of the earth, who have committed fornication and lived wantonly with her, shall bewail her and lament for her when they shall see the smoke of her burning, — so the same rulers and kings that have with the great harlot shall mourn and by various gestures outwardly express their sorrow at her desolation;

— and lived deliciously with her; Revelation 18:3 joining with her in her sensual, as well as in her idolatrous practices;

— when they shall see the smoke of her burning: as Abraham saw the smoke of Sodom and Gomorrah go up like the smoke of a furnace; by which they will perceive that her judgement is come, and her ruin begun.

10 standing afar off for the fear of her torment, saying, ‘Alas! Alas, that great city Babylon, that mighty city! For in one hour has thy judgement come.’ — the time of her punishment fixed by God; but the sense is, this is the judgement of the great whore, which the angel proposed to show to John, Revelation 17:1.

11 “And the merchants of the earth shall weep and mourn over her, for no man buyeth their merchandise any more: — the reason of their weeping and mourning follows that no man buyeth their merchandise any more; for such commodities, if they do not sell at one place, will not also at another; and the decline of trade in one city will slow or stop business all the world over.

12 the merchandise of gold, and silver, and precious stones, and of pearls; and fine linen, and purple, and silk, and scarlet; all scented wood, all manner of vessels of ivory and most precious wood, and of brass, and iron, and marble; — the merchandise of gold and silver, and precious stones, and of pearls… things for treasure and ornament, and with which the great whore is said to be decked, Revelation 17:4 and, literally understood, may denote the vast riches which these spiritual merchants, or factors for Rome, cardinals, archbishops, bishops, priests, monks, and friars, bring into their own coffers and the pope’s.

— the “purple, silk”, and “scarlet” were for the popes, cardinals, archbishops, and bishops so the woman on the scarlet coloured beast is said to be arrayed in purple and scarlet.

13 and cinnamon, and perfumes, and ointments, and frankincense, and wine, and oil, and fine flour, and wheat; and cattle, and sheep, and horses, and chariots; and slaves, and the souls of men. — and cinnamon, and odours, and ointments, and frankincense… things for delight and pleasure, for the gratifying of the senses; cinnamon, and odours were used for perfuming.

14 “And the fruits that thy soul lusted after have departed from thee, and all things which were dainty and goodly have departed from thee, and thou shalt find them no more at all. — and thou shalt find them no more at all; for this will be an utter destruction; these desirable things will be taken from her in all nations, sinking the whore into an outward show and form, will be wholly given to the nations, and they will have these things in their hands again before Rome’s utter destruction.

15 The merchants of these things, who were made rich by her, shall stand afar off for the fear of her torment, weeping and wailing — shall stand afar off for fear of her torment; as the kings of the earth before, Revelation 18:10 being conscious to themselves of their being partners in her crimes, and so might justly fear they should share in her punishment;

— and it may be, they will outwardly deny they are now of her religion, and will externally embrace the reformed religion; though they will be inwardly weeping and wailing for the destruction of Rome, and the loss of their merchandise and goodly things.

16 and saying, ‘Alas! Alas, that great city, that was clothed in fine linen and purple and scarlet, and bedecked with gold and precious stones and pearls! — that was clothed in fine linen, and purple, and scarlet, and decked with gold, and precious stones, and pearls;

 see a parallel in Ezekiel: And in their wailing they shall take up a lamentation for thee and lament over thee, saying, “What city is like Tyre, like the destroyed in the midst of the sea?” Ezekiel 27:32.

17 For in one hour such great riches have come to nought!’ “And every shipmaster and all the company in ships, and sailors, and as many as trade by sea, stood afar off; — in one hour so great riches is come to nought… that is, in a very short time, expressing the suddenness and speediness of Rome’s destruction.

18 and they cried when they saw the smoke of her burning, saying, ‘What city is like unto this great city!’ — for her magnificence and grandeur, so now for sorrow, desolation, and ruin; nor was any city like it for power and authority, for pride and luxury, for idolatry and superstition, blasphemy and impenitence.

19 And they cast dust on their heads and cried, weeping and wailing, saying, ‘Alas! Alas, that great city, wherein all that had ships in the sea were made rich by reason of her extravagances! For in one hour is she made desolate!’ — saying, what city is like unto this great city? as before for magnificence and grandeur, so now for sorrow, desolation, and ruin; nor was any city like it for power and authority, for pride and luxury, for idolatry and superstition, blasphemy and impenitence; like the sailors say of Tyre, Ezekiel 27:30.

20 Rejoice over her, thou heaven and ye holy apostles and prophets, for God hath avenged you on her.” — having called upon the saints to come out of Babylon, and to take vengeance on her, now calls upon all good men to rejoice at her ruin, while others were weeping and wailing.

21 Then a mighty angel took up a stone like a great millstone, and cast it into the sea, saying, “Thus with violence shall that great city Babylon be thrown down, and shall be found no more at all. — which is expressive utter destruction of Rome, of her violence, force, and power, and of the suddenness and swiftness of her destruction.

22 And the voice of harpers and musicians, and of pipers and trumpeters shall be heard no more at all in thee; and no craftsman, of whatsoever craft he be, shall be found any more in thee; and the sound of a millstone shall be heard no more at all in thee; — the voice of harpists, minstrels, flutists and trumpeters shall no more be heard in thee, and all craftsmen of every craft shall no more be found in thee, and the light of a lamp shall no more shine in thee, and the voice of bridegroom and bride shall no more be heard in thee.

23 and the light of a candle shall shine no more at all in thee; and the voice of the bridegroom and of the bride shall be heard no more at all in thee. For thy merchants were the great men of the earth, for by thy sorceries were all nations deceived.— for by thy sorceries were all nations deceived; meaning her false doctrines, traditions, idolatry, superstition, and will worship, with which, as another Jezebel, she has bewitched, allured, and deceived the nations of the empire, and the kings thereof, Revelation 18:3.

24 And in her was found the blood of prophets and of saints, and of all that were slain upon the earth.” — for she will now be found guilty of slaying God’s witnesses, who are meant by the prophets and saints, that have been from the beginning of the apostasy.

Revelation (Ch 15-16)

•October 23, 2021 • Leave a Comment

Chapter 15 opens with seven angels holding the seven last plagues, each filled with the wrath of God ready to be poured upon the earth.

Revelation 15

And I saw another sign in heaven, great and marvelous: seven angels holding the seven last plagues, for in them is filled up the wrath of God. — God had borne with his enemies with much longsuffering, but now his wrath will go forth to the uttermost; and even after these plagues the holy wrath of God against his other enemies does not cease.

And I saw, as it were, a sea of glass mingled with fire, and them that had gotten the victory over the beast, and over his image, and over his mark, and over the number of his name, standing on the sea of glass and having the harps of God. — a sea of glass mingled with fire; Revelation 4:6 “and before the throne there was a sea of glass like unto crystal,” but is now mingled with fire;

— they were come out of great tribulation, and had washed their garments, and made them white in the blood of the Lamb; and were just come up from the washing, and stood upon, or rather by or “near the sea.”

And they sing the song of Moses, the servant of God, and the song of the Lamb, saying, “Great and marvelous are Thy works, Lord God Almighty! Just and true are Thy ways, Thou King of saints! — and they sing the song of Moses the servant of God… both that in Exodus 15:1 and in Deuteronomy 32:1 and the sense is, that they observed the law of Moses, which he as a servant in the Lord’s house faithfully delivered, as in the times before; that they sung a song like that of Moses.

Who shall not fear Thee, O Lord, and glorify Thy name? For Thou only art holy. For all nations shall come and worship before Thee, for Thy judgements are made manifest.” — for the final result of the Lord’s doing will be that all nations, all men, will acknowledge His sovereignty and to give honor to Him as the holy Judge of the nations.

And after that I looked, and behold, the temple of the tabernacle of the testimony in Heaven was opened; — and the tabernacle, in allusion to the tabernacle of Moses, which was before the temple, because God dwells in it, as he did;

— the testimony was the law, or the two tables of stone, so called, because they testified what was good, and perfect, and acceptable will of God; and these being put into the ark, were a testimony of the covenant between God and the people of Israel, and were a witness against them, when they transgressed them.

and the seven angels, having the seven plagues, came out of the temple, clothed in pure and white linen and having their breasts girded with golden girdles. — the seven angels having the seven plagues, clothed in white, shining linen, and girded about their breasts with a golden girdle.

And one of the four living beings gave unto the seven angels seven golden vials full of the wrath of God, who liveth for ever and ever. — another seven angels each given a golden vial full of the wrath of God;

— it will be the wrath of the living God, for this wrath will issue in the everlasting destruction of the antichrist: so the wrath of God is signified by a wine cup of fury, Jeremiah 25:15 and that destruction, and those plagues which God designed to bring upon Pharaoh, was a type, there are some of them a manifest allusion to the plagues of Egypt. 

And the temple was filled with smoke from the glory of God and from His power, and no man was able to enter into the temple till the seven plagues of the seven angels were fulfilled. — and the sanctuary was filled with the smoke of the glory of God and of His power, and no one is able to enter into the sanctuary until the seven plagues of the seven angels are completed.

Revelation 16

And I heard a great voice out of the temple, saying to the seven angels, “Go your ways, and pour out the vials of the wrath of God upon the earth.” — it is the voice of God which is heard, for it is He that has the avenging plagues in His hand; the seven angels, the seven messengers of God, were to pour out the bowls containing the wrath of the Lord upon the earth.

And the first went and poured out his vial upon the earth; and there fell a noisome and grievous sore upon the men who had the mark of the beast and upon them that worshipped his image. — and there came a grievous ulcer on the men that had the mark of the beast and those that had worshipped his image?

— or, is this a plague of painful boils?

And the second angel poured out his vial upon the sea; and it became as the blood of a dead man, and every living soul died in the sea. — the second on the sea, turning it into blood, and killing the fish;

— this was like the first Egyptian plague, coagulated blood, fatal to all animal life.

And the third angel poured out his vial upon the rivers and fountains of waters; and they became blood. — the rivers and fountains, also rendering the waters blood; undrinkable as in Egypt.

And I heard the angel of the waters say, “Thou art righteous, O Lord, who art, and wast, and shall be, because Thou hast judged thus; — who art, and wast, and shall be; the same as “the Eternal”; the “Everlasting”; ‘I am,’ ‘I was,’ ‘I’ll be.’ These are descriptions of the Lord, not to be mistaken as a name of the Lord, whose name is Yehovah (the letter J didn’t appear in the English language until the sixteenth century the earliest).

for they have shed the blood of saints and prophets, and Thou hast given them blood to drink, for they are worthy.” — much of the blood of the saints, of the preachers of the Gospel, of the prophets and witnesses, have been martyred.

And I heard another out of the altar say, “Even so, Lord God Almighty; true and righteous are Thy judgements.” — this angel joins the other, and approves and confirms what he says; applauding the judgements of Christ upon the worshippers of the beast, from the verity of them, being what were threatened, and from the justice of them, being what they deserved.

And the fourth angel poured out his vial upon the sun; and power was given unto him to scorch men with fire. — this fourth angel poured out his vial upon the sun, and to him was given to scorch men with fire; and

— this vial refers to; when Zion’s light will be come, and the light of the sun will be seven fold, and Christ alone will be exalted; which clear ministration of Christ.

And men were scorched with great heat, and they blasphemed the name of God, who hath power over these plagues; and they repented not to give Him glory. — every new plague seems to be more deadly than the preceding one; and after these men were scorched with great heat, they blasphemed the name of God, who has the power over these plagues, and they did not repent to give Him glory.

10 And the fifth angel poured out his vial upon the seat of the beast; and his kingdom was full of darkness, and they gnawed their tongues from pain; — the beast is the same with that in Revelation 13:1 and which again shows that to be one and the same: the seat or throne of the beast is Rome, which, when the empire was Pagan, was the seat of Satan, or the dragon, Revelation 2:13 and when the beast or antichrist was risen, the dragon gave this seat, as well as his authority to him.

11 and they blasphemed the God of heaven because of their pains and their sores, and repented not of their deeds. — and blasphemed the God of heaven… who dwells in it, and from whence wrath is revealed, and comes upon the seat of the beast; but they will curse him who is their King, and their God, and look upwards to heaven, where he is, Isaiah 8:21.

12 And the sixth angel poured out his vial upon the great river Euphrates; and the water thereof was dried up, that the way of the kings of the east might be prepared. — nor is the situation changed by the sixth plague: and the sixth poured out his vial upon the great river Euphrates; and its water was dried up, that the way of the kings from the rising of the sun might be prepared. 

13 And I saw three unclean spirits like frogs come out of the mouth of the dragon, and out of the mouth of the beast, and out of the mouth of the false prophet.

14 For they are the spirits of devils working miracles, which go forth unto the kings of the earth and of the whole world to gather them for the battle of that great Day of God Almighty. — and of the mouth of the dragon and out of the mouth of the beast and out of the mouth of the false prophet three unclean spirits like frogs; for they are spirits of demons performing miracles, which go forth upon the kings of the whole earth to assemble them to battle of that great day of Almighty God. 

15 “Behold, I come as a thief. Blessed is he that watcheth and keepeth his garments, lest he walk naked, and they see his shame.” — blessed is he that watcheth; against sin, the lusts of the flesh, and the cares of this life, lest they bring a sleepiness upon him, and so the day of the Lord come upon him at an unawares; and against Satan and his temptations, who goes about seeking whom he may devour;

and against his emissaries and false teachers, who lie in wait to deceive; and blessed is he also who is wishing and waiting for the coming of Christ, and so, being ready, will enter with him into the marriage chamber, and partake of the supper of the Lamb.

16 And he gathered them together at a place called in the Hebrew tongue, Armageddon. — the Hebrew tongue Armageddon; which may be the same with Har-megiddo, the mountain of Megiddo; for the Hebrew word הר is read “Ar” by the Greeks; so the city Argarize is interpreted the mountain of the most High:

and this refers either to the slaying of Josiah in the valley of Megiddo, which occasioned such mourning, that it became proverbial for any great sorrow; see II Chronicles 35:22 where it is called the valley of Megiddon.

17 And the seventh angel poured out his vial into the air; and there came a great voice out of the temple of heaven from the throne, saying, “It Is Done!” — the kingdom of Satan, he being the prince of the power of the air, Ephesians 2:2 not that he has power over the air, to raise or lay winds and storms in it at pleasure;

but he is so called because he is the prince of that posse of devils, the principalities and powers of darkness, that have their dwelling in the air; hence the air, encompassing the whole earth, stands for the kingdom of Satan all the world over.

18 And there were voices and thunders and lightnings; and there was a great earthquake, such as has not been since men were upon the earth, so mighty an earthquake and so great. — another great voice out of the temple of heaven, from the throne; this voice is said to come “out of the temple of heaven”, that is, out of the temple which is in heaven, which will now be opened, as under the sounding of the seventh trumpet.

19 And the great city was divided into three parts, and the cities of the nations fell, and great Babylon came to remembrance before God, to give unto her the cup of the wine of the fierceness of His wrath. — like the city of Jerusalem, as inhabited by Christians, Jews, and Muslims?

— the wrath of God is sometimes signified in the Old Testament by a cup, a wine cup, a wine cup of fury, see Psalms 75:8.

20 And every island fled away, and the mountains were not found. — the islands are removed, and the mountains sink from sight, for the final Judgement has come, and the end of all things is at hand. 

21 And there fell upon men a great hail out of heaven, every stone about the weight of a talent. And men blasphemed God because of the plague of the hail, for the plague thereof was exceeding great. — and great hail, resembling a talent in size, fell down from heaven upon men, and men blasphemed God for the plague of the hail, for the plague of it is very great;

this is the punishment which will destroy all the enemies of the Lord, a hail of God’s wrath which falls from heaven upon the blasphemers and casts them into the lowest hell;

.and yet the enemies, in the midst of their destruction, blaspheme the Lord, just as they will blaspheme Him throughout eternity, as they are consumed by the torments of hell.

Revelation (Ch 13-14)

•October 22, 2021 • Leave a Comment

Chapter 13 appears as insert chapter, sort of flashbacks.

Chapter 13 contains a description of the Antichrist, under the two beasts, one representing him in civil power, the other in ecclesiastical power. The first beast is described by its origin, the sea, and by the monstrous parts; its heads seven, in which were the name of blasphemy; its horns ten, on which were crowns; its skin like a leopard, its feet as a bear, and its mouth as a lion; and by its state and condition, having power, a throne, and great authority; and having one of its heads wounded, and healed; and by the great regard had unto him, being wondered at, and worshipped by all the world, and declared to be more powerful than any, and none to be like them.

Revelation 13

1 And I stood upon the sand of the sea. And I saw a beast rise up out of the sea, having seven heads and ten horns, and upon his horns ten crowns, and upon his heads the name of blasphemy. — sea usually indicates vastness as ocean is; so from this vastness of humanity; it arose out of the sea or ocean of nations, gradually, but surely, until it had power over practically the entire world;

— seven heads; the seven mountains on which Rome was built, and so design the city itself built on them; this beast is the Roman Empire;

— ten horns; refers to the ten provinces of the Roman Empire; or ten kingdoms, into which the empire was divide it upon its being wasted and vanquished by the Goths, and the ten kings of them, which reigned with the beast, and gave their kingdoms to him; so horns signify kingdoms in Zechariah 1:18;

— ten crowns; which distinguishes Rome Papal from Rome Pagan; the crowns in Rome Pagan were upon the heads, or the emperors, that resided at Rome; and though it had ten horns, and was divided into provinces,yet they were not kings, they had no crowns but here the horns have crowns on them because the governors of these ten kingdoms are crowned kings; one such king with a province is King Herod, but he was under the Emperor in Rome;

— still more concerning this beast: and the dragon gave his own power and his throne and great authority to him; and quid pro quo in response for its favour, the Roman Church incorporates the ‘Holy Ghost’ into the Godhead so that he could be like the Most High.

and this Roman Papacy was proven to be the Great Whore of Babylon of whom most of her doctrines were later adopted by her harlotry daughters.

And the beast which I saw was like unto a leopard, and his feet were as the feet of a bear, and his mouth as the mouth of a lion. And the dragon gave him his power, and his seat, and great authority. — this beast has the best or strongest of other beasts;

— like unto a leopard…. to which the Grecian kingdom is compared in Daniel 7:6; because of that rapidity and swiftness with which Alexander overran the world;

— the feet of a bear; to which the Persian monarchy is compared, Daniel 7:5;

— his mouth as the mouth of a lion; which was the first beast, or the Babylonian empire;

— the dragon gave him his power: for the coming of antichrist is after the working of Satan.

And I saw that one of his heads was, as it were, wounded to death, and his deadly wound was healed. And all the world wondered after the beast. — the great Roman Empire which the beast represents received a temporary setback, a wound which looked like a deadly wound; which came to an end in the year 476. But Rome retained its power in spite of all that, for the worldly authority remained sometimes with the Pope and at other times, the Emperor, supporting and strengthening each other.

And they worshiped the dragon which gave power unto the beast, and they worshiped the beast, saying, “Who is like unto the beast? Who is able to make war with him?” — and they worshipped the dragon… indeed they do, as the cast out one has embedded himself into the Godhead, the Trinity; who can say that the Trinity is fake? So indeed over a billion people or more than 99.99 percent of professing Christians are conned by the dragon.

And there was given unto him a mouth, speaking great things and blasphemies, and power was given unto him to continue forty and two months. — power is given unto the beast to continue, or to make war and prevail, forty-two months; speaking great things, and blasphemies; great swelling words of vanity; calling himself Christ’s vicar, Peter’s successor, head of the church, universal bishop; promising to his followers: riches, honours, pleasures, pardons, and heaven itself and uttering things of blasphemies mentioned in Revelation 13:6.

And he opened his mouth in blasphemy against God to blaspheme His name, and His tabernacle, and them that dwell in Heaven. — and it is well known what blasphemous and extravagant claims of authority and power have been made by him, who has been styled, His Holiness Infallible Sovereign of kings and kingdoms Christ’s Vicegerent, and yea, God upon earth;

— and give him power to insert the “holy ghost” into the Godhead to create the Trinity.

And it was given unto him to make war with the saints and to overcome them; and power was given him over all kindreds, and tongues, and nations. — it was given unto him to make war with the saints…. the remnant of the woman’s seed, Revelation 12:17;

— Benson: that in the war with the Albigenses and Waldenses, there perished of these poor creatures in France alone a million! From the first institution of the Jesuits to AD 1480, that is, in little more than thirty years, nine hundred thousand orthodox Christians were slain;

— let the Romanists boast, that theirs is the catholic church, and universal empire with universal values; Gregorian calendar become universal calendar, Sunday the standard day of rest; Easter, Christmas become standard holidays worldwide, etc.

and most of these Great Whore doctrines were later adopted by her harlotry daughters.

And all that dwell upon the earth shall worship him, whose names are not written in the Book of Life of the Lamb, slain from the foundation of the world.

If any man have an ear, let him hear:

10 He that leadeth into captivity shall go into captivity. He that killeth with the sword must be killed with the sword. Here is the patience and the faith of the saints.

11 And I beheld another beast coming up out of the earth; and he had two horns like a lamb, and he spoke as a dragon. the beast with ten crowned horns is the Roman empire, as divided into ten kingdoms;

— but this other beast had two horns like a lamb He had, both regular and secular, the appearance of a lamb; and pretended to be like a lamb, all meekness and mildness; but he spake as a dragon; he had a voice of terror, like Roman emperors, in usurping divine titles, in commanding idolatry;

— this beast is otherwise called the false prophet; than which there cannot be a stronger or plainer argument to prove that false doctors or teachers were particularly designed. For the false prophet, no more than the beast, is a single man, but a body or succession of men, propagating false doctrines, and teaching lies for sacred truths.

12 And he exerciseth all the power of the first beast before him; and he causeth the earth and them that dwell therein to worship the first beast, whose deadly wound was healed. he exerciseth all the power of the first beast before him; he holdeth an empire within an empire; claimeth a temporal authority as well as a spiritual, and enforceth his canons and decrees with the sword of the civil magistrate;

and causeth the earth, and them who dwell therein, to worship the first beast, whose deadly wound was healed; he supports tyranny, as he is by tyranny supported.

13 And he doeth great wonders, so that he maketh fire come down from heaven on the earth in the sight of men. — Gill: of the pretensions of the Papacy to confer the Holy Ghost, and his gifts upon men, by breathing on them, which on the day of Pentecost were represented by cloven tongues, as of fire, coming down from heaven; or of their anathemas, curses, and excommunications, at which time burning torches and candles are cast up, and fall down, as emblems of divine wrath, which is called cursing men with bell, book, and candle; or else of the fire of persecution.

14 And he deceiveth them that dwell on the earth by means of those miracles which he had power to do in the sight of the beast, saying to them that dwell on the earth that they should make an image to the beast, which had the wound by a sword and lived. — as the first beast concurs to maintain his authority, so he in return confirms and maintains the sovereignty and dominion of the first beast over his subjects; 

— the little horn and the two-horned beast act precisely in the same capacity; each exercising the power of the first beast before him, and each perishing in one common destruction with him.

15 And he had power to give life unto the image of the beast, that the image of the beast should both speak and cause to be killed as many as would not worship the image of the beast. — he enslaves the consciences, as the first beast subjugates the bodies of men; and, by joining with them, procures them a blind obedience from their subjects: and so he is the occasion of the preservation of the old Roman empire in some kind of unity, and name, and strength.

16 And he causeth all, both small and great, rich and poor, free and bond, to receive a mark in their right hand or in their foreheads,

17 that no man might buy or sell, save he that had the mark or the name of the beast or the number of his name. — Kretzmann: there are the two swords, the temporal and the spiritual, which the Pope still claims for himself; there are the many cases of interdict, or spiritual boycott, when congregations, cities, and states were suspended from the means of grace; there are the cases of indulgences, when the forgiveness of sins was made a matter of traffic and bargaining;

— Benson: the canon of the council of Lateran, under Pope Alexander the Third, made against the Waldenses and Albigenses, enjoins, upon pain of anathema, that “no one presume to entertain or cherish them in his house or land, or exercise traffic with them.” The synod of Tours, in France, under the same pope, ordered, under the like intermination, that “no man should presume to receive or assist them, no, not so much as to hold any communion with them in selling or buying, that, being deprived of the comfort of humanity, they may be compelled to repent of the error of their way.”

18 Here is wisdom: Let him that hath understanding count the number of the beast, for it is the number of a man; and his number is six hundred threescore and six. —

Chapter 14 is unusual, in that three angels would be called out to do redemptive work which had been normally reserved for human beings.

Revelation 14

1 And I looked and lo, a Lamb stood on Mount Zion, and with Him a hundred forty and four thousand, having His Father’s name written in their foreheads. — the vision of the Lamb is no other than Christ, by the place where he was, Mount Zion; by his position there, standing, and by the company that were with him, the 144,000, his Father’s name written on their foreheads; at the same time a voice was heard from heaven, comparable to the sound of many waters, of thunders, and of harps: and a song sung which none learn but the Lamb;

— stood on the Mount Zion; by which is meant one in heaven, a similar one as one on earth; as the earthly temple modelled after one in heaven, so is also one called Mount Zion.

And I heard a voice from heaven as the voice of many waters, and as the voice of a great thunder, and I heard the voice of harpers harping with their harps. — a voice from Heaven; for those still on earth.

And they sang, as it were, a new song before the throne, and before the four living beings and the elders; and no man could learn that song, except the hundred and forty and four thousand who were redeemed from the earth. — a voice before the throne, hence in heaven, and as the voice of many waters and as the rumbling of great thunder; and the voice which I heard resembled that of harpists playing on their harps; and they sang a new song and before the four living beings and the elders; and no one can learn the song except the hundred and forty-four thousand that have been redeemed from the earth.

These are they that were not defiled with women, for they are virgins. These are they that follow the Lamb whithersoever He goeth. These were redeemed from among men, being the firstfruits unto God and to the Lamb. — these are they which were not defiled with the whore of Rome, or her daughter harlots, while the kings and inhabitants of the earth were drunk these were free from such their idolatrous practices.

And in their mouth was found no guile, for they are without fault before the throne of God. — are redeemed from the consequence of this present evil world, and from a vain, wicked, and idolatrous conversation with it.

And I saw another angel fly in the midst of heaven, having the everlasting Gospel to preach unto them that dwell on the earth, and to every nation and kindred, and tongue and people, — would this be the first angel?

saying with a loud voice, “Fear God and give glory to Him, for the hour of His Judgement is come. Worship Him that made heaven and earth, and the sea and the fountains of waters.” — these are messages to the nations, to every nation and tribe and tongue and people, all and every nations that may have not heard of the gospel, nor of the kingdom.

— so this first angel is doing missionary work?

And there followed another angel, saying, “Babylon is fallen! Fallen is that great city, because she made all nations drink of the wine of the wrath of her fornication.” — Babylon is a figure of the (1) Roman empire: and of this it is said, that it “is fallen, is fallen”; which words are repeated for the certain confirmation of it, as matter of fact;

— (2) but Babylon could also be Ephraim, the message of Ezekiel’s warning of her abominations and all her idolatries; fornication and whoredoms. A day would come that they would be fallen, is fallen.

— would this be the second angel?

And the third angel followed them, saying with a loud voice, “If any man worship the beast and his image, and receive his mark in his forehead or in his hand, — if any man worship the beast and his image; give in to the idolatries of the church of Rome, or her daughter harlots and embrace, maintain, and defend the Popish religion, which bears a resemblance to the worship of the heathens, and is the very image of Rome Pagan; see Revelation 13:4;

— Seventh-day Adventists preach a lot on this third angel message; so much emphasis that it is as if it’s more important than the gospel itself?

Observing on Samaritan Sundays isn’t okay, but indulging in pagan Christmas is okay!

10 the same shall drink of the wine of the wrath of God, which is poured out unmixed into the cup of His indignation; and he shall be tormented with fire and brimstone in the presence of the holy angels and in the presence of the Lamb. — the same shall drink of the wine of the wrath of God… which is a just punishment for their sin; that as such have drank of the wine of the wrath of Rome’s fornication, Revelation 14:8 so they shall now drink of the wine of God’s wrath; it is usual in Scripture to express the punishment God inflicts upon wicked men by his wrath, and by the wine cup of his fury; and their suffering such punishment, by their drinking of it; see Jeremiah 25:15.

11 And the smoke of their torment ascendeth up for ever and ever; and they have no rest day or night, who worship the beast and his image, and whosoever receiveth the mark of his name.” — and the smoke of their torment ascendeth up for ever and ever… that is, the smoke of that fire which torments them will for ever arise; or, in other words, there will be no end of their torment; hence their misery is called everlasting fire, everlasting punishment, and everlasting destruction.

12 Here is the patience of the saints: here are they that keep the commandments of God, and the faith of Jesus. — here are they that keep the commandments of God; that is, including the Sabbath and annual Feast days; including the calendar established by the Sanhedrin.

13 And I heard a voice from heaven, saying unto me, “Write: ’Blessed are the dead who die in the Lord from henceforth.’” “Yea,” saith the Spirit, “that they may rest from their labors, and their works do follow them.” — those that die in the Lord are those that remain steadfast in His Word and faith unto the end, whether this end be that of a quiet death or that of martyrdom.

14 And I looked, and behold, a white cloud; and upon the cloud sat one like unto the Son of Man, having on his head a golden crown and in his hand a sharp sickle. — and in the hand of the Son of Man, he has a sharp sickle: to reap the earth with, as hereafter, and is expressive of his power as King of kings and Chief Judge of the world, to gather all nations before him; for the sickle is used to gather with, as well as to cut them down.

15 And another angel came out of the temple, crying with a loud voice to him that sat on the cloud, “Thrust in thy sickle and reap; for the time has come for thee to reap, for the harvest of the earth is ripe.” — would this be the fourth angel?

— not only the grapes are gathered, but all the shoots and branches are cut off; the fruit of sin and unbelief has reached its full maturity, the patience of the Lord is exhausted.

16 And he that sat on the cloud thrust in his sickle on the earth, and the earth was reaped.

17 And another angel came out of the temple which is in heaven, he also having a sharp sickle. — would this be the fifth angel?

— beside the Son of Man having a sharp sickle; another angel also has one and he came out of the altar, having power over the fire, and he shouted with a loud voice to him that had the sharp sickle, saying, Send forth thy sharp sickle and cull the grape-clusters from the vine of the earth, for its grapes have matured. Here the fire of God’s wrath, of God’s Judgement, is in evidence. The final Judgement will not be a partial judgement, but will strike fruit, branches, stem, and roots.

18 And another angel came out from the altar, who had power over fire, and cried with a loud cry to him that had the sharp sickle, saying, “Thrust in thy sharp sickle and gather the clusters of the vine of the earth, for her grapes are fully ripe.”— would this be the sixth angel?

19 And the angel thrust in his sickle into the earth, and gathered the vine of the earth, and cast it into the great wine press of the wrath of God. — would this be the seventh angel?

— at the end of the world: this vine may be said to be cut down at the burning of the world, and to be gathered at the resurrection, as the wheat harvest of the saints will be at a resurrection.

20 And the wine press was trodden outside the city, and blood came out of the wine press, even unto the horse bridles, for the space of a thousand and six hundred furlongs. — even unto the horses’ bridles, for the space of a thousand and six hundred furlongs; which could be:

— (a) measuring a thousand and six hundred miles, between 600 and 625 feet in width, with a depth of about five feet;

— (b) an hyperbolical expression, setting forth the largeness and universality of the destruction of the wicked, and the impossibility of their escaping it.

Revelation (Ch 11-12)

•October 21, 2021 • Leave a Comment

Chapter 11 contains a vision of two wonders or signs seen in heaven, a woman and a dragon, and an account of what followed thereon, war both in heaven and on the earth.

Revelation 11

And there was given me a reed like unto a rod; and the angel stood, saying, “Rise, and measure the temple of God and the altar, and them that worship therein. and there was given me a reed like unto a rod…. a measuring reed, was six cubits long, Ezekiel 40:5; with the Greeks and Romans, ten feet long.

measuring the servants of God is equivalent to judging and trying them, and if qualified, to seal them for official duties.

But the court which is outside the temple, leave out, and measure it not, for it is given unto the nations; and the Holy City shall they tread under foot for forty and two months. for the time being, the majority people of the nations are not given the calling, not judged yet, that’s why the court is left out and measure not; but its time will come; perhaps starting with the ‘times of the gentiles’?

And I will give power unto my two witnesses, and they shall prophesy a thousand two hundred and threescore days, clothed in sackcloth.” — 1260 days is the same as three and half years.

These are the two olive trees and the two candlesticks, standing before the God of the earth.

And if any man will hurt them, fire proceedeth out of their mouth and devoureth their enemies; and if any man will hurt them, he must in this manner be killed. — these are the two olive trees…. or represented by the two olive tree; reminding us of Moses and Elijah who called for fire upon their adversaries; or in Zechariah 4:3, Joshua and Zerubbabel after the Babylonish captivity, who in laying out themselves, in rebuilding and finishing the temple, were types of these witnesses.

These have power to shut heaven, that it rain not in the days of their prophecy, and have power over waters to turn them to blood, and to smite the earth with all plagues, as often as they will. — these have power to shut up the sky, that no rain map fall during the days of their prophecy, and they have power over the waters to turn them into blood, and to smite the earth with all manner of plagues as often as they choose;

— and if any man will hurt them, he must in this manner be killed; this is repeated, partly to show the certainty of this destruction; and partly to point out the manner of it, which will be not by the use of carnal weapons: these enemies of the witnesses will not be killed by the sword, or any other weapon, but by the word of God,by the pronouncement of God’s judgments on them, by fire, proceeding out of their mouths.

And when they shall have finished their testimony, the beast that ascendeth out of the bottomless pit shall make war against them, and shall overcome them and kill them. — his coming is after the working of Satan: he is raised up, influenced, and supported by him; he is a creature of his, and has his power, seat, and authority from him, the great dragon, the old serpent, called the devil and Satan.

And their dead bodies shall lie in the street of the great city, which spiritually is called Sodom and Egypt, where also our Lord was crucified. — and men of the peoples and tribes and tongues and nations will see their corpses three days and one half, and will not permit their corpses to be placed into sepulchers; and they that dwell upon the earth will rejoice over them and be very glad.

And they of the people and kindreds, and tongues and nations shall see their dead bodies three days and a half, and shall not suffer their dead bodies to be put in graves.

10 And they that dwell upon the earth shall rejoice over them and make merry, and shall send gifts one to another, because these two prophets tormented them that dwelt on the earth. — and kings, people and kindreds will send one another presents, because these two prophets tormented those that lived upon the earth. Sodom was the essence of abominations, and Egypt was the country where their forefathers had been kept in shameful slavery; both names therefore stood for the lowest and meanest on earth. 

11 But after three days and a half, the Spirit of life from God entered into them, and they stood upon their feet; and great fear fell upon them that saw them. the enemies of the Lord, rejoiced too soon as in many cases since; and after the three and one-half days the Spirit of Life from God came into them, and they stood upon their feet, and a great fear fell upon those that saw them.

12 And they heard a great voice from Heaven, saying unto them, “Come up hither!” And they ascended up to Heaven in a cloud, and their enemies beheld them.

13 And that same hour there was a great earthquake, and a tenth part of the city fell; and in the earthquake were slain seven thousand men, and the remnant were seized with fear, and gave glory to the God of Heaven. and they ascended to heaven in a cloud, and their enemies saw them; and in that hour there happened a great earthquake, and the tenth part of the city fell, and there were killed in the earthquake seven thousand souls, and the rest became terrified and gave glory to the God of heaven.

14 The second woe is past; and behold, the third woe cometh quickly. — the second woe is past…. the meaning is, that the second woe trumpet, which is the sixth, will now have done sounding, when the four angels, bound in the river Euphrates, shall have been loosed, and they, with their horsemen, shall have done what they were designed to do; when the two witnesses shall have been slain, and are raised again, and ascended to heaven; and the things attending, or following thereon, as the earthquake, and slaughter, and the conversions of men, are accomplished;

— behold the third woe cometh quickly; immediately, upon the passing of the other; namely, the sounding of the seventh trumpet, as follows.

15 And the seventh angel sounded, and there were great voices in Heaven, saying, “The kingdoms of this world are become the kingdoms of our Lord and of His Christ, and He shall reign for ever and ever!” and the seventh angel sounded; the sounding of this angel, the third woe commences, brought on the inhabitants of the earth to ruin and downfall of any antichrist: and then, and not till then, the kingdoms of this world will become the kingdoms of our Lord and Christ;

and that include all the pagan nations are to be taken into the account, and everyone of the Papacy, riding on a white horse with a bow; and of Mahomet, the king of the locusts of 200,000,000, will “become the kingdoms of our Lord, and of his Christ.”

16 And the four and twenty elders, who sat before God on their seats, fell upon their faces and worshiped God,

17 saying, “We give Thee thanks, O Lord God Almighty, who art, and wast, and art to come, because Thou hast taken to Thee Thy great power, and hast reigned. which art, and wast, and art to come; the same as “the Eternal”; the “Everlasting”; ‘I am,’ ‘I was,’ ‘I’ll be.’ These are descriptions of the Lord, not to be mistaken as a name of the Lord, whose name is Yehovah (the letter J didn’t appear in the English language until the sixteenth century the earliest).

18 And the nations were angry; and Thy wrath is come, and the time of the dead, that they should be judged, and that Thou shouldest give reward unto Thy servants the prophets, and to the saints and them that fear Thy name, small and great, and shouldest destroy them that destroy the earth.” and there are still nations that are angry…. See Psalms 99:1, these could be the remaining nations that are harder to convert, having thicker skulls, which the Septuagint render, the “Lord reigns, let the nations be angry.”

19 And the temple of God was opened in Heaven; and there was seen in His temple the ark of His testament, and there were lightnings and voices, and thunderings and an earthquake, and great hail. — and the temple of God was opened in heaven…. this temple would be the Ezekiel Temple that were designed in heaven but now built at Jerusalem, to which the allusion is, was the place of public worship for all nations; the pure worship of God will be restored; the temple will be open to all; here everyone may come and sing and worship without fear.

Revelation 12

Chapter 12 appears as an insert chapter, sort of a flashback.

And there appeared a great wonder in heaven: a woman clothed with the sun, and the moon under her feet, and upon her head a crown of twelve stars. — and upon her head a crown of twelve stars; “stars” could be the 12 stars that Joseph saw in his dream, the 12 tribes which Christ holds in his right hand;

— each headed by an apostle; having the respect for the twelve apostles; and the “crown” being rewarded to each of them, which are also composed of stars.

And she, being with child, cried, travailing in birth and in pain to be delivered. — and a great sign was seen in heaven, a woman clothed with the sun, and the moon beneath her feet, and on her head a crown of twelve stars; and being pregnant, she cried in the pains of birth and was in torment to give birth. This woman symbolizes the Daughter of Zion, the Church, the saints;

— and the moon under her feet; the church is sometimes compared to the moon herself, because, as the moon receives its light from the sun, so she receives her light from Christ.

And there appeared another wonder in heaven: behold, a great red dragon, having seven heads and ten horns, and seven crowns upon his heads. — so Pharaoh king of Egypt were also called dragons in Scripture, Ezekiel 29:3; Isaiah 27:1; all which places the Targum interprets of מלכא, “a king”, and particularly of Pharaoh king of Egypt; who is like to a great and mighty dragon: and the Roman empire, as under the influence of Satan, the missing “Holy Ghost” who wanted to be like the Most High, is fitly compared to a “dragon”;

having seven heads, and ten horns, and seven crowns upon his heads; the “seven heads” of the Roman empire either design the seven mountains, or hills, on which Rome was built, as the seven heads of the beast on which the woman drunk with the blood of the saints sat, are explained in Revelation 17:9.

And his tail drew a third part of the stars of heaven, and cast them to the earth. And the dragon stood before the woman who was ready to be delivered to devour her child as soon as it was born. — his tail dragged the third part of the stars of heaven, and threw them to the earth; 

— and the dragon stood before Israel (especially Judah the sceptre holder)) which was ready to be delivered, for to devour her child as soon as it was born; just as the dragon Pharaoh lay in the midst of his rivers, in the river Nile, Ezekiel 29:3; to slay the male children of Israel as soon as born; and as the dragon Herod sought to take away the life of Jesus quickly after his birth.

And she brought forth a man child, who was to rule all nations with a rod of iron; and her child was caught up unto God and to His throne.  the house of Judah gave birth to a man-child, who was intended to rule all the nations with an iron rod; and her child was caught up to God and to His throne.

And the woman fled into the wilderness, where she hath a place prepared by God, that they should feed her there a thousand two hundred and threescore days. and the woman, house of Judah, now especially the Nazarenes, fled into the wilderness, where a place has been prepared for her by God, that they should nourish her there twelve hundred and sixty days (more at the end). 

And there was war in Heaven: Michael and his angels fought against the dragon; and the dragon fought and his angels,

and prevailed not; neither was their place found any more in Heaven.

And the great dragon was cast out — that serpent of old called the Devil and Satan, who deceiveth the whole world. He was cast out onto the earth, and his angels were cast out with him. Michael is an archangel, Daniel 10:13Daniel 12:1 summoned the hosts of heaven and gave battle so successfully that the dragon, or Satan, called the old serpent and the devil because his constant endeavor is to bring ignominy and shame on all men, was cast out of heaven with his host. 

10 And I heard a loud voice saying in Heaven, “Now have come salvation and strength, and the Kingdom of our God, and the power of His Christ; for the accuser of our brethren is cast down, who accused them before our God day and night.

11 And they overcame him by the blood of the Lamb and by the word of their testimony, and they loved not their lives unto the death.

12 Therefore rejoice, ye heavens, and ye that dwell in them! Woe to the inhabitants of the earth and of the sea! For the devil has come down unto you, having great wrath, because he knoweth that he hath but a short time.” — for this reason rejoice, heavens, and those that dwell in them. Woe to the earth and to the sea, because the devil has come down to you having a great rage, knowing that he has little time. And they, the believers themselves, won the victory over Satan; they are always winners, in the fight against him, through the power of Christ, through the fact that His blood was shed for their redemption.

13 And when the dragon saw that he was cast unto the earth, he persecuted the woman who brought forth the manchild. — he persecuted the woman which brought forth the man child: he was enraged at Israel, the house of Judah that put forth the Sceptre, now the church, the Nazarenes, and pursued her with great wrath.

14 And to the woman were given two wings of a great eagle, that she might fly into the wilderness, into her place, where she is nourished for a time and times and half a time, from the face of the serpent. — two wings of a great eagle; as God said to the children of Israel, (Exodus 19:4,) “Ye have seen what I did unto the Egyptians, and how I bare you on eagles’ wings.”

— “a time and times and half a time” is one time, plus two times, plus half a time which total 3 and a half times, and since one time is 360 days, the total is 1260 years; one day for a year.

15 And the serpent cast out of his mouth water as a flood after the woman, that he might cause her to be carried away by the flood. as the Lord holds His protecting hand over them that are His scattered Church continues to exist in spite of all persecutions, even though it be only in secret places and hidden from the eyes of men, and was protected by divine means in the wilderness for 1260 years from the serpent.

16 And the earth helped the woman; and the earth opened her mouth, and swallowed up the flood which the dragon cast out of his mouth. — this is a picture of the flood of trials and tribulations which Satan time and again poured forth against the Church, a time of great persecutions against the scattered brethren, of numerous Inquisitions, to note in what manner the devil makes fanatics of men against the preaching of the truth.

17 And the dragon was wroth with the woman, and he went to make war with the remnant of her seed, who keep the commandments of God, and have the testimony of Jesus Christ. — the Church were dispersed, no more functioning a a single body as was the Jerusalem church, and now her seed are scattered members dispersed throughout the hills and valleys of Asia and Europe, some later migrated to the Americas.

~~~

The Church fled to the wilderness for 1260 days

The period mentioned in Revelation 12:6 is 1,260 days, which in this place prophetically refers to 1,260 years according to the “day for a year” principle found in Numbers 14:34 and Ezekiel 4:5.

The Church in this text flees into the “wilderness,” a solitary, lonely, desert place. Here is what happened historically: the Church was severely persecuted during the reigns of both Emperor Diocletian and Emperor Galerius from 303 to 313 AD, especially in the eastern provinces (see Revelation 2:10).

In 325 Constantine convened the Council of Nicaea and Catholicism became the state religion. In order for the Nazarenes to fully obey God and put into practice their beliefs, they had to “flee” from the centers of influence and into the less-populated areas. In the early period of this “exile” the true Christians were most numerous in what today is eastern Turkey. In later centuries they were found in scattered areas of Europe, especially in and around high mountains and valleys, usually away from major population centers.

Around 1585, 1,260 years later, Catholic domination of the throne in England ended. This brought to a close the period when the Church had to carry on in the wilderness, lonely areas of Europe and Asia Minor, instead of the greater population centers where Catholic and later even Protestant churches flourished.

Revelation (Ch 9-10)

•October 19, 2021 • Leave a Comment

Chapter 9 starts the woe, woe, woe; three times to the inhabitants of the earth; incorporating all peoples, with heavy calamities; answerable to the three trumpets soon to be blown; and which are therefore called the woe trumpets.

Revelation 9

1 And the fifth angel sounded, and I saw a star fall from heaven unto the earth; and to him was given the key to the bottomless pit.

And he opened the bottomless pit, and there arose a smoke out of the pit, as the smoke of a great furnace; and the sun and the air were darkened by reason of the smoke of the pit. — the fifth angel blows his trumpet, and a star falls; the key of the bottomless pit is given to him, which being opened by it, out of it comes smoke to the darkening of the sun and air, and out of the smoke locusts, who have power like scorpions.

And there came out of the smoke locusts upon the earth; and unto them was given power, as the scorpions of the earth have power. — and there came out of the smoke locusts the earth…. not literally, for these locusts might not meddle with the grass, nor any green thing, or tree, as locusts do, only men, Revelation 9:4; and had a king over them, Revelation 9:11; which locusts have not.

And it was commanded to them that they should not hurt the grass of the earth, neither any green thing, neither any tree, but only those men who have not the seal of God in their foreheads.

Sealing on their foreheads; this could be a parallel in Ezekiel:9:4;

and the Lord said unto him, “Go through the midst of the city, through the midst of Jerusalem, and set a mark upon the foreheads of the men who sigh and who cry because of all the abominations that are done in the midst thereof.” — and you shall mark a sign: you shall mark a sign on the foreheads of the righteous men in order to show the destroyers those men whom they should not strike.

Gill: it is a Rabbinical thought, mentioned by Kimchi that Gabriel had orders to write the letter ת (tav; the last letter of the alphabet) in ink upon the foreheads of the righteous, which signified תחיה, “thou shall live”. And for the wicked the same letter ת were written in blood upon the foreheads, but it signified תמות, “thou shall die”.

And to them it was given that they should not kill them, but that they should be tormented five months; and their torment was as the torment of a scorpion when it strikes a man. — it was granted to them (are they the same as the “six men” or six destroyers in Ezekiel 9:2?) that they should not kill them (the people still living on earth), but should torture them five months; with excruciating pain, and their torture is as the torture of a scorpion when it strikes a man;

— “four angels”, as some think, because of the four names of Saracens, Turks, Tartars, and Arabians, though all Mahometans. 

And in those days shall men seek death, and shall not find it; and shall desire to die, and death shall flee from them. — the scorpion signified a vicious and dangerous opponent, whose attacks are worse than death; it signifies how troublesome and afflictive those locusts were; as in Ezekiel 2:6.

And the shapes of the locusts were like unto horses prepared for battle; and on their heads were, as it were, crowns like gold, and their faces were as the faces of men. — the heads of locusts are very much like the heads of horses: and here they are compared to horses;

— it was the east wind which brought the locusts on Egypt Exodus 10:13, and they must therefore have come from some area of Arabia – for Arabia is the land that lies over Egypt in the east.

And Moses stretched forth his rod over the land of Egypt, and the Lord brought an east wind upon the land all that day and all that night; and when it was morning, the east wind brought the locusts, Exodus 10:13

Gill: and it is a remarkable coincidence that Muslim tradition speaks of locusts having dropped into the hands of Mahomet, bearing on their wings this inscription – “we are the army of the most high God; we are the ninety and nine eggs, and if the hundred should be made perfect, we should consume the whole world, and whatever is in it.”

Gill described “Mahomet the king of the locusts.”

Mahomet were referred to as:

(a) Mohammed, the founder of Islam; and who gave birth to over a billion of Muslims today;

(b) Mehmed II, at the age of 21, the General of the Ottomans Turks who conquered Constantinople in 1453 after 53 days of siege. After the conquest Mehmed claimed the title “Caesar” of the Roman Empire based on the fact that Constantinople had been the seat and capital of the surviving Eastern Roman Empire since its consecration in 330 AD by Emperor Constantine.

Mehmed II the Conquerer of Constantinople in 1453

And they had hair as the hair of women, and their teeth were as the teeth of lions. — and their faces like faces of men, and they had hair the hair of women, and their teeth like those of lions: weird descriptions, could these vile men be using chemical or germ warfare like those Unit 731 or those flying planes spraying Orange Agents?

And they had breastplates like breastplates of iron, and the sound of their wings was as the sound of chariots with many horses running to battle. — the hardness of their hearts, their thick skulls for their protection; the whirring noise made by them when in flight; these sound like war-like machines, the helicopters.

10 And they had tails like unto scorpions, and there were stingers in their tails; and their power was to hurt men five months.

11 And they had a king over them, the angel of the bottomless pit, whose name in the Hebrew tongue is Abaddon, but in the Greek tongue his name is Apollyon. — Benson: Abaddon in Hebrew, and Apollyon in Greek; that is, the destroyer. Mede imagines that this is some allusion to the name of Obodas, the common name of the kings of that part of Arabia from whence Mohammed came, as Pharaoh was the common name of the kings of Egypt, and Cesar of the emperors of Rome; and such allusions are not unusual in the style of Scripture;

— and they had a king over them…. the ‘locusts’ has a king a “destroyer” over them, who can he be? An Antichrist? A Mahdi? Commentator Matthew Henry (1708) believed Abaddon to be the Antichrist.

The Conqueror Of Constantinople - Story Of Mehmed II Fatih - About History
Mehmed II, Conqueror of the Eastern Roman Empire,
took the title Kayser-i Rum (Roman Caesar) 

12 One woe is past; and behold, there come two more woes hereafter. — one woe is past…. one of the three woe trumpets, the first of them; that is, in the vision which John had saw:

— and behold there come two woes more hereafter; under the blowing of the sixth and seventh trumpets.

13 And the sixth angel sounded, and I heard a voice from the four horns of the golden altar which stands before God,

14 saying to the sixth angel who had the trumpet, “Loose the four angels who are bound in the great river Euphrates.” — loose the four angels which are bound in the great river Euphrates; not the four angels in Revelation 7:1; they stood upon the four corners of the earth; these were in, or at the river Euphrates; they held the four winds, that they should not blow.

15 And the four angels were loosed, who had been prepared for an hour and a day and a month and a year, to slay a third part of men. — for to slay the third part of men; which may in general denote their readiness, vigilance, and quick dispatch: they lay for a good while hovering over the banks of the river Euphrates, as if they were waiting for an order;

— that would be well over 2 billion people; killed!

16 And the number of the army of horsemen was two hundred thousand thousand, and I heard the number of them. — the army of horsemen of two hundred thousand thousand; or “two myriads of myriads”; two hundred millions;

— many commentators, like Gill, Benson, Kretzmann, etc, mentioned the Turk attack the Roman Empire in the year 1453, when Turkish Mahomet took Constantinople, “filled the hearts of the Mohammedan hordes, fire and smoke and sulfur issuing out of their mouths (Kretzmann);”

— Benson: when Mohammed the Second besieged Constantinople, he had about four hundred thousand men in his army, besides a powerful fleet of thirty larger and two hundred lesser ships;

— could a parallel occurs again? Good to watch Iran and Turkey, with a significant higher number of 200,000,000.

And the sixth angel poured out his vial upon the great river Euphrates; and the water thereof was dried up, that the way of the kings of the east might be prepared, Revelation 16:12.

17 And thus I saw the horses in the vision, and they that sat on them had breastplates of fire and of jacinth and brimstone; and the heads of the horses were as the heads of lions, and out of their mouths issued fire and smoke and brimstone.

18 By these three was a third part of men killed by the fire and by the smoke and by the brimstone, which issued out of their mouths. — a third part of mankind would be well over two billions; that’s a great amount!

19 For their power is in their mouth and in their tails; for their tails were like unto serpents and had heads, and with them they cause hurt.

20 And the rest of the men, who were not killed by these plagues, yet repented not of the works of their hands, that they should not worship devils, and idols of gold and silver, and brass and stone and of wood, which can neither see nor hear nor walk;

21 neither repented they of their murders, nor of their sorceries, nor of their fornication, nor of their thefts. — and the rest of men, that were not killed in these plagues, yet repented not of the works of their hands, not to worship demons and idols of gold and of silver; and they repented not of their murders nor of their magic arts nor of their fornications nor of their thefts;

— even as Pharaoh hardened his heart in spite of the many evidences of God’s power performed in his sight, even as the children of Israel in the wilderness refused again and again to turn to the Lord in true repentance, in spite of the many miracles by which He sought to influence them, thus it has ever been in the history of the world;

— the Lord may send ever so many plagues, wars, pestilences, famines, and yet, as soon as He withdraws His chastening hand, men harden their hearts once more and refuse to repent of the works of their hands, of their idolatry. This is a description of the abyss of human depravity, such a picture as we see but rarely in its entirety, although glimpses are seen often enough in these last days before the coming of the Lord.

Revelation 10

1 And I saw another mighty angel (angelon ἄγγελον) come down from heaven, clothed with a cloud; and a rainbow was upon his head, and his face was as it were the sun, and his feet as pillars of fire. angelon ἄγγελον here or angelou ἀγγέλου, not angelous ἄγγελος);

and I saw another strong angel descending out of heaven, clad in a cloud, and a rainbow on his head and his face like the sun and his feet like columns of fire;

— a parallel scene in the wilderness, descended on Mount Sinai, but by God, dwelt in the tabernacle and later in the temple; later left on the Temple Mount and ascended to heaven.

And he had in his hand a little book open. And he set his right foot upon the sea, and his left foot on the earth,

βιβλαριδιον, a little book, different from the βιβλιον or book, mentioned before: and it was openthat all men might freely read and consider it. It was indeed a codicil or supplement to the larger book, and comes along with the sixth trumpet;

— and he set his right foot upon the sea, and his left on the earth; to show the extent of his power and commission; this angel set his right foot on the sea toward the west, his left on the land toward the east, so that he looked southward;

— southward, that is, toward the great continent of Africa, but bits of Asia; or this angel might be given authority over land and sea?

— but the Q remains, what is the little book? We are told it’s open and that all men could read it freely, not sealed. So what is its message?

— perhaps since it is “open” as the seals were unloosed, and the things in it revealed, perhaps it represents the numerous books and booklets of Christian literatures we are flooded with, every men can study these literatures on our own time and space?

— of course that include online Bibles of different versions, Septuagint, Targum, Talmud, various rabbis and theology experts from the last many hundred years; now internet excess for easy study.

and cried with a loud voice, as when a lion roareth. And when he had cried, seven thunders uttered their voices.

And when the seven thunders had uttered their voices, I was about to write, and I heard a voice from Heaven saying unto me, “Seal up those things which the seven thunders uttered, and write them not.” — John heard the voice, was going to put it down in writing, but he was forbidden to write them down;

— so the contents of the seven thunders remain sealed; kept secret from mankind, at least for the time being; would they be revealed later? (more at the end)

And the angel (ἄγγελος), whom I saw standing upon the sea and upon the earth, lifted up his hand to heaven.

And he swore by Him that liveth for ever and ever, who created heaven and the things that are therein, and the earth and the things that are therein, and the sea and the things which are therein, that there should be time no longer,

but that in the days of the voice of the seventh angel (ἀγγέλου), when he shall begin to sound, the mystery of God should be finished, as He hath declared to His servants the prophets. — that time should be no longer; that is, that these times should wait be no longer; that these dates would be up, and the events affixed to them be accomplished, when the seventh angel should begin to sound his trumpet: the same divisions of time are made in Revelation 12:14.

And the voice which I heard from heaven spoke unto me again and said, “Go and take the little book which is open in the hand of the angel (ἀγγέλου) who standeth upon the sea and upon the earth.”

And I went unto the angel (ἄγγελον) and said unto him, “Give me the little book.” And he said unto me, “Take it and eat it up, and it shall make thy belly bitter, but it shall be in thy mouth sweet as honey.” of course the taste of the little book start with the mouth first, which is sweet as honey, then when eaten, it goes down to the belly, and it is bitter.

10 And I took the little book out of the angel’s (ἀγγέλου) hand and ate it up, and it was in my mouth sweet as honey; and as soon as I had eaten it, my belly was bitter. — perhaps it goes like this: the message of the Gospel that mankind will be saved by grace, which is sweet, but that before attaining it, mankind has to go through lots of trials and tribulations, even being martyred, which is bitter, to get into the kingdom.

11 And he said unto me, “Thou must prophesy again before many peoples and nations, and tongues and kings.” — thou must prophesy again; if the prophecy begin here again anew, the subject be resumed from the beginning, and all that follows be contained in the little bookthen the little book contains more matter than the larger book;

— the little book, the supplement includes the numerous literatures that we have, will go to the nations, preached and re-preached; our knowledge increases day by day.

~~~

But the contents of the seven thunders remain sealed; it’s kept a secret from mankind, at least for the time being; would they be revealed soon? We can be sure they will be revealed. The Question is when will that be.

The Greek word translated “thunder” means “to roar.” Thunder is often a mark of judgement as in I Samuel 2:10II Samuel 22:14, and in Revelation 8:5, 11:19, 16:18, so these seven powerful voices are crying out for God’s judgement upon the whole earth. The thunder represents the voice of God. Psalm 18:13 says, “The LORD thundered from heaven; the voice of the Most High resounded.”

Further evidence of the seven thunders being the voice of God is in Revelation 4:5: From the throne came flashes of lightning, rumblings and peals of thunder; as in Mount Sinai before the children of Israel. There are seven spirits of God with seven lamps all blazing before the throne. Again the voice of God is depicted as thunderous rumblings that display the power, majesty and glory of our mighty Lord to give the whole world an unique Mount Sinai experience. In this verse, John saw a preview of the divine wrath to be poured out on the earth as described in full from Revelation chapters 16 to 19.

The seven thunders are the only words in Revelation that are still sealed. Would these seven thunders be revealed in our lifetime?

Revelation (Ch 7-8)

•October 18, 2021 • Leave a Comment

Chapter 6 ended with “For the great Day of His wrath is come, and who shall be able to stand?”

And now John was to be prepared for the events “the great Day of His wrath which were to follow” the opening of the seventh seal. Though a bit late, would the Holy Ghost finally turn up?

Revelation 7

1 And after these things I saw four angels standing on the four corners of the earth, holding the four winds of the earth, that the wind should not blow on the earth, nor on the sea, nor on any tree. — and after these things…. after the opening of six of the seals of the sealed book, and these four angels parallel the four spirits of heavens, in Zechariah 6:5;

— these four angels could be four cherubim; as was it the case when Ezekiel saw them in Ezekiel 1?

And I saw another angel ascending from the east, having the seal of the living God; and he cried with a loud voice to the four angels to whom it was given to hurt the earth and the sea, — this mighty angel from the east seems to have more authority that the four in verse 1 because he gave command to the others;

— to whom it was given to hurt the earth and the sea: they had a commission from God to let loose the winds, or to bring on wars, devastations, calamities, and plagues, of various sorts, upon the earth, not only on the continent, but upon the islands, even all the nations, tongues, and all peoples.

saying, “Hurt not the earth, neither the sea nor the trees, till we have sealed the servants of our God in their foreheads.” — this mighty angel commands “Hurt not the earth, neither the sea nor the trees,” to the other four angels;

— sealing on the forehead; this could be a parallel in Ezekiel:9:4;

and the Lord said unto him, “Go through the midst of the city, through the midst of Jerusalem, and set a mark upon the foreheads of the men who sigh and who cry because of all the abominations that are done in the midst thereof.” — and you shall mark a sign: you shall mark a sign on the foreheads of the righteous men in order to show the destroyers those men whom they should not strike.

— Gill: it is a Rabbinical thought, mentioned by Kimchi that Gabriel had orders to write the letter ת (tav; the last letter of the alphabet) in ink upon the foreheads of the righteous, which signified תחיה, “thou shall live”. And for the wicked the same letter ת were written in blood upon the foreheads, but it signified תמות, “thou shall die”.

And I heard the number of them that were sealed: there were sealed a hundred and fortyfour thousand of all the tribes of the children of Israel. — the context in verses 2 and 3 indicate that these 144,000 are sealed on earth, not in heaven.

Of the tribe of Judah were sealed twelve thousand; of the tribe of Reuben were sealed twelve thousand; of the tribe of Gad were sealed twelve thousand;

of the tribe of Asher were sealed twelve thousand; of the tribe of Naphtali were sealed twelve thousand; of the tribe of Manasseh were sealed twelve thousand;

of the tribe of Simeon were sealed twelve thousand; of the tribe of Levi were sealed twelve thousand; of the tribe of Issachar were sealed twelve thousand;

of the tribe of Zebulun were sealed twelve thousand; of the tribe of Joseph were sealed twelve thousand; of the tribe of Benjamin were sealed twelve thousand.

After this I beheld, and lo, a great multitude, which no man could number, of all nations and kindreds and people and tongues, stood before the throne and before the Lamb, clothed in white robes and with palms in their hands.

10 And they cried with a loud voice, saying, “Salvation to our God who sitteth upon the throne, and unto the Lamb!” — God the Father and the Son are always around, and so are the others, but if the Holy Spirit is a person where is he? He seems absent all the time; maybe he has been travelling? Weird! We’re in the seventh chapter and we have yet to see how John will describe the Holy Spirit if he appears, but he hasn’t yet . . . maybe he has caught a flu and has gone to sleep?

11 And all the angels stood round about the throne, and about the elders and the four living beings, and fell on their faces before the throne and worshiped God, — see, the angels are around, so are the 24 elders and even the four beasts, but where is the Third Person in the Godhead?

12 saying, “Amen. Blessing and glory and wisdom and thanksgiving, and honor and power and might, be unto our God for ever and ever. Amen!”

13 And one of the elders answered, saying unto me, “Who are these that are arrayed in white robes, and from whence have they come?” — these 144,000 seems to be in heaven in the presence of God; so they must be resurrected?

14 And I said unto him, “Sir, thou knowest.” And he said to me, “These are they that came out of great tribulation, and have washed their robes and made them white in the blood of the Lamb. — these 144,000 are those that came out of great tribulation, but what about those that died before the great tribulation? Moses? Daniel? Elijah? to name a few? Could they be included?

15 Therefore, “they are before the throne of God, and serve Him day and night in His temple; and He that sitteth on the throne shall dwell among them. — see, these must be in heaven, before the throne, and had been resurrected.

16 They shall hunger no more, neither thirst any more; neither shall the sun light on them, nor any heat.

17 For the Lamb who is in the midst of the throne shall feed them, and shall lead them unto living fountains of waters, and God shall wipe away all tears from their eyes.” — if they are spirit beings then they are not subjected to physical needs or limitations;

— when the praise of God is sung, the angels couldn’t remain silent; and all the angels stood around the throne and the elders and the four living beings, and fell down before the throne upon their faces and worshiped God, saying, Amen,

— praise and glory and wisdom and thanksgiving and honor and power and might be to our God forever and ever, Amen. As in in earlier chapters, the angels are pictured as surrounding the throne and the elders and the cherubs, a great cloud of witnesses of the heavenly bliss. But the Holy Ghost remains missing!

Revelation 8

1 And when He had opened the seventh seal, there was silence in Heaven about the space of half an hour.

And I saw the seven angels who stood before God, and to them were given seven trumpets. — and to them were given seven trumpets: every angel has one; which were an emblem of wars, and desolations, and calamities, which would come upon the whole world, at the blowing of each of them; the trumpet being an alarm, preparing for, proclaiming, and introducing these things; Jeremiah 4:19;

these are said to be given them; either by the Father that sat on the throne; or by the Lamb that opened the seal.

And another angel came and stood at the altar, having a golden censer; and there was given unto him much incense, that he should offer it with the prayers of all saints upon the golden altar, which was before the throne. — the prayers of the saints, rightly performed, are themselves compared to incense, being very grateful and acceptable to God, Psalms 141:2.

And the smoke of the incense, which came with the prayers of the saints, ascended up before God out of the angel’s hand. — so the the prayers of all saints ended up upon the golden altar, before the throne, before God.

And the angel took the censer, and filled it with fire from the altar, and cast it onto the earth; and there were voices and thunderings and lightnings, and an earthquake. — and there were voices, and thunderings, and lightnings, and an earthquake; which may be understood either of the nature, use, and effects of listening to God, having a Godly experience, speaking to the hearts of men by the sons of thunder, enlightening their minds, and shaking through our thick skulls; the like were at the giving of the law, Exodus 19:16.

And the seven angels who had the seven trumpets prepared themselves to sound.

The first angel sounded, and there followed hail and fire mingled with blood, and they were cast upon the earth; and a third part of the trees were burned up, and all green grass was burned up. — and there followed hail and fire, mingled with blood; somewhat like one of the plagues of Egypt, Exodus 9:23; in which was hail mingled with fire, only no blood, but what was caused by its fall on man and beast. 

— the whole world is calling to mind the Israelites experience of their Egyptian plagues, now the whole world is been given an Egyptian experience.

And the second angel sounded and, as it were, a great mountain burning with fire was cast into the sea; and a third part of the sea became blood;

and a third part of the creatures which were in the sea and had life, died, and a third part of the ships were destroyed. — and the third part of the creatures which were in the sea…. the fishes; by whom men are meant, the inhabitants of the earth; see Ezekiel 29:4, where by fish the Targum understands mighty princes and governors:

— and had life, died; were put to death by these savage and barbarous people, who killed all they met with, men, women, and children, young and old, rich and poor, high and low.

10 And the third angel sounded, and there fell a great star from heaven, burning as if it were a lamp, and it fell upon a third part of the rivers and upon the fountains of waters;

11 and the name of the star is called Wormwood. And a third part of the waters became wormwood; and many men died from the waters, because they were made bitter. — Wormwood, an Ukrainian word for Chornobyl’, lit. ’black herb’), many have referred to the Chernobyl nuclear disaster in 1986, referring to a ‘star falling down and turning the waters bitter’ are interpreted as the radioactive fallout from the disaster poisoning the environment around Chernobyl, leaving it uninhabitable;

and the third part of the waters became wormwood; that is, the inhabitants of the countrysides and cities were afflicted with grievous and bitter afflictions and calamities; so great distresses are called wormwood, and waters of gall given to drink, Jeremiah 9:15.

12 And the fourth angel sounded, and a third part of the sun was smitten, and a third part of the moon and a third part of the stars, so that a third part of them was darkened; and a third of the day shone not, and the night likewise. — and the fourth angel sounded, and the third part of the sun was smitten; a fit representation to express the last desolation of God’s judgement to all earthly power and authority;

darkening, smiting, or the setting of the sun, moon, and stars are for the setting of a kingdom; and when darkness is opposed to light, as light is a symbol of joy and safety, so darkness is a symbol of misery and adversity; according to the style of Jeremiah 13:16.

13 And I beheld, and heard an angel flying (one eagle flying in Greek 105 [e] aetou) through the midst of heaven, saying with a loud voice, “Woe, woe, woe to the inhabitants of the earth, because of the other voices of the trumpets of the three other angels, which are yet to sound!” — one flying eagle (105 [e] aetou; a solitary eagle flying in many translations) could be one of the four living creatures in Revelation 4;

Woe, woe, woe; three times, to the inhabitants of the earth; all peoples, without exception: heavy calamities coming to all; answerable to the three trumpets yet to be blown; and which are therefore called the woe trumpets: and these woes are denounced.

~~~

More about the missing Holy Ghost; indeed he’s real and around; he was created full of wisdom and beauty, his head swelled up so much that he wanted to be like the Most High:

These clues are giving in the book of Ezekiel 28 and Isaiah 14;

Moreover the word of the Lord came unto me, saying,

“Son of man, take up a lamentation over the king of Tyre, and say unto him, ‘Thus saith the Lord God: “‘Thou sealest up the sum, full of wisdom and perfect in beauty.

Thou hast been in Eden the garden of God; every precious stone was thy covering: the sardius, topaz, and the diamond, the beryl, the onyx, and the jasper, the sapphire, the emerald, and the carbuncle, and gold; the workmanship of thy taborets and of thy pipes was prepared in thee in the day that thou wast created.

Thou art the anointed cherub that covereth, and I have set thee so; thou wast upon the holy mountain of God; thou hast walked up and down in the midst of the stones of fire.

Thou wast perfect in thy ways from the day that thou wast created, till iniquity was found in thee.” (Ezekiel 28:11-15)

“How art thou fallen from heaven, O Lucifer (H1966 hêlēl), son of the morning! How art thou cut down to the ground, who didst weaken the nations!

For thou hast said in thine heart, ‘I will ascend into heaven, I will exalt my throne above the stars of God; I will sit also upon the mount of the congregation, in the sides of the north.

I will ascend above the heights of the clouds; I will be like the Most High.’ (Isaiah 14:12-14)

That’s why the “Holy Ghost” was missing all the while; cast down, heaven and those around the throne has no place for him! Such doctrine was invented by the Great Whore of Babylon, and shared widely by her numerous harlot daughters.

Revelation (Ch 5-6)

•October 17, 2021 • Leave a Comment

John is back in vision, his second vision and presents the majesty of God on His throne. A new incident is introduced: And I saw on the right hand of Him that was sitting on the throne a scroll written on the inside and on the back, sealed with seven seals.

Revelation 5

1 And I saw in the right hand of Him that sat on the throne a book written within and on the back, sealed with seven seals. — and this may be truly said to be at the right hand of God, and from thence taken by the Lamb of the tribe of Judah;

— a book written within, and on the backside, sealed with seven seals: this book was very much like Ezekiel’s roll, Ezekiel 2:9; which was written פנים ואחור, “within” and “without”, before and behind, and indeed it was in the form of a roll;

— sealed with seven seals, as seven is a number for perfection, it may mean that the book was so sealed that the seals could neither be counterfeited nor broken; the matter of the book was so obscure and the work it enjoined and the facts it predicted so difficult and stupendous, that they could neither be known nor performed by any human.

And I saw a strong angel proclaiming with a loud voice, “Who is worthy to open the book and to loose the seals thereof?” — who is worthy to open the book, and to loose the seals thereof? suggesting, that if there was any such person, that he is a person of greatness and worth, to take a book out of his right hand, this book of the Revelation;

— and as it was sealed, to unseal it and explain it to others, as it afterwards was in the following scenes and visions, and gave a view of all that is contained in it; and how to accomplish all the prophecies in it; and who can, or is worthy to do all this, but he that sits at the right hand of God? 

And no man in heaven, nor on earth, neither under the earth, was able to open the book, neither to look thereon. — and no man in heaven; whether angels, or any humans, not any of the twenty-four saints;

— nor in earth: among all the men on earth, even those of the greatest sagacity and penetration, the wise, the prudent.

And I wept much, because no man was found worthy to open and to read the book, neither to look thereon. — the Ethiopic version reads, “and many wept”, many of those that were about the throne, as well as John.

And one of the elders said unto me, “Weep not! Behold, the Lion of the tribe of Judah, the Root of David, hath prevailed to open the book and to loose the seven seals thereof.” — weep not; cease sorrowing, do not be cast down; behold the lion of the tribe of Judah; by whom is meant Christ, who, according to the flesh, was to come of the tribe of Judah.

And I beheld, and lo, in the midst of the throne and the four living beings, and in the midst of the elders, stood a Lamb as it had been slain, having seven horns and seven eyes, which are the seven Spirits of God, sent forth into all the earth. — here the seven Spirits of God have some descriptions each, each with an eye and even a horn; nevertheless since the Spirit is inherently holy, there would be seven Holy Spirits;

— and we would add Jesus the Son and God the Father, resulting in nine Personage. Nine in the Godhead; we should have a Polygon or a Nonagon; it might be more realistic to believe in the Polyty or a Nonaty, but certainly wouldn’t be a Trinity; (more at the end);

— the root of David; Christ called the root of Jesse in Isaiah 11:10; and the meaning either is, that he is a branch that springs out of the roots of Jesse and David, is David’s son and offspring, according to his human nature; see Revelation 22:16;

And He came and took the book out of the right hand of Him that sat upon the throne. — and took the book out of the right hand of him that sat upon the throne; as in Revelation 1:1; and the authority to open it, and make it manifest to others, and to accomplish many events, over several eras of time.

And when He had taken the book, the four living beings and the four and twenty elders fell down before the Lamb, having every one of them harps and golden vials full of incense, which are the prayers of saints. — here “the prayers of saints” it is hinting who the twenty-four elders are, every one of them with harps and golden vials full of incense; the prayers of the 24 elders are that of saints, not angels.

And they sang a new song, saying, “Thou art worthy to take the book and to open the seals thereof; for Thou wast slain, and hast redeemed us to God by Thy blood, from every kindred and tongue, and people and nation, — these 24 elders are singing, praising God, “for Thou wast slain, and hast redeemed us”; only humans are redeemed “redeem us”, angels were and are never redeemed.

10 and hast made us unto our God kings and priests; and we shall reign on the earth.” — a parallel Scripture in Exodus being fulfilled: “And ye shall be unto Me a kingdom of priests and a holy nation.’ These are the words which thou shalt speak unto the children of Israel,” Exodus 19:6; some versions have “kings and priests.” ‘And ye shall be unto Me kings and priests and a holy nation.’

11 And I beheld, and I heard the voice of many angels round about the throne and the living beings and the elders; and the number of them was ten thousand times ten thousand, and thousands of thousands, — and the number of them was ten thousand times ten thousand, and thousands of thousands; an innumerable multitude; and yet these are but a part of the holy angels; afterward, (Revelation 7:11). 

12 saying with a loud voice, “Worthy is the Lamb that was slain, to receive power and riches and wisdom and strength, and honor and glory and blessing!” — worthy is the Lamb that was slain; they address him as the Lamb and their Lord; and speak of him as having been slain, and celebrate the virtue and efficacy of his sufferings and death, and ascribe his worthiness to receive such glory and honour.

13 And I heard every creature which is in heaven and on the earth, and under the earth and such as are in the sea, and all that are in them, saying, “Blessing and honor and glory and power be unto Him that sitteth upon the throne, and unto the Lamb for ever and ever!” — the hymn of praise is taken up by a larger circle of angels and saints, in a sacred concert with such magnificent singing around the throne of God: And I saw, and I heard as the voice of many angels round about the throne and the living beings and the elders;

with eyes and ears that mere held open by the inexpressible wonder of it all John took notice of the countless celestial beings as they circled round the throne and the cherubs and the elders, their voices rising in such anthems of glory as pertain to the realms of eternal joy.

14 And the four living beings said, “Amen.” And the four and twenty elders fell down and worshiped Him that liveth for ever and ever.

~~~

The seven Spirits of God, having seven horns and seven eyes, which mean each spirit has a horn and an eye, but what does this mean? In Zechariah 3:9Zechariah 4:10, they mention what is made of the seven eyes of the Lord, which go forth over all the earth.

For behold the stone that I have laid before Joshua: upon one stone shall be seven eyes. Behold, I will engrave the engraving thereof,’ saith the Lord of hosts, ‘and I will remove the iniquity of that land in one day. Zechariah 3:9

For who hath despised the day of small things? For they shall rejoice and shall see the plummet in the hand of Zerubbabel with those seven. They are the eyes of the Lord, which run to and fro through the whole earth.” Zechariah 4:10

A horn represents power and strength, like bull’s horn, and an eye represents all seeing and all knowing; both the horns and the eyes are the seven Spirits or seven Angels of God sent forth into all the earth; therefore having seven horns and seven eyes represent God’s omnipotence and God’s omniscience that operate everywhere in the universe.

And that through this effectual working of the seven spirit or seven angels of God (there are no capital letters in Hebrew), which goes throughout the whole creation: and both in the natural as well as spiritual world, it demonstrates the magnificence, elegance and augustness of God’s Omnipotence and Omniscience!

Revelation 6

Chapter 6 opens with the vision of the opening six of the seals of the sealed book, by the Lamb, and of the events that follows.

1 And I saw when the Lamb opened one of the seals; and I heard, as it were, the noise of thunder, one of the four living beings saying, “Come and see!” — the preparation to the vision of the first seal; the Lamb opens it, John hears a noise like thunder, and one of the living creatures bids him come and see; upon which he saw a horse, of a white colour, and a rider on it, who is described by a bow and crown given him, and by the victory he obtained;

— one of the living creatures speaking, the first? But what does that mean? (more at the end)

And I saw, and behold, a white horse, and he that sat on him had a bow; and a crown was given unto him, and he went forth conquering and to conquer. — what is this white horse? It is a symbol, but what is it?

— and this major Church come riding with a bow; but Christ come riding with a sword (Rev 19:14-15), so this subtle difference; and this Church with a bow is the Roman Church, set conquering and to conquer;

— but Christ the Son was the Revelator, and in Matthew 24 Christ revealed very first condition of the times is that of false preachers, misleading and deceiving, not the few, but the many; this was the rise of the Rome Papacy. And this Papacy was proven to be the Great Whore of Babylon of whom many of her doctrines were later adopted by her numerous harlot daughters.

And when He had opened the second seal, I heard the second living being say, “Come and see!”

And there went out another horse that was red; and power was given to him that sat thereon to take peace from the earth, that they should kill one another; and there was given unto him a great sword. — red, the color of blood; and this horseman, as Jesus Himself reveals, is WAR;

— there were wars in those days, but wars have not stopped; they have grown progressively worse and worse, more and more horrible and destructive, until today, we face the question of whether human life can survive the next atomic and hydrogen bomb war!

— one of the living creatures, but this is the second one; what does this mean?

And when He had opened the third seal, I heard the third living being say, “Come and see!” And I beheld, and lo, a black horse; and he that sat on him had a pair of balances in his hand. — four living creatures, but this is the third.

And I heard a voice in the midst of the four living beings say, “A measure of wheat for a penny, and three measures of barley for a penny; and see thou hurt not the oil and the wine!” — one of the living creatures, but this is the third.

And when He had opened the fourth seal, I heard the voice of the fourth living being say, “Come and see!” — I heard the voice of the fourth beast say, come and see; this living creature was that which was like an eagle, and was on the north side of the throne, answerable to the standard of Dan, which was on the north of the camp of Israel, and had the figure of an eagle upon it;

— one of the living creatures, but this is the fourth.

And I looked, and behold, a pale horse, and his name that sat on him was Death, and Hell followed with him. And power was given unto them over a fourth part of the earth to kill with sword, and with hunger, and with death, and with the beasts of the earth. — a pale horse? pestilences, like Covid-19 epidemics of coronal virus which we’re experiencing today;

— famines, and with hunger, and with death, and with the beasts of the earth;

— God’s four judgements, which goes about with the sword, famine, pestilence and destruction by wild beasts.

And when He had opened the fifth seal, I saw under the altar the souls of them that were slain for the Word of God, and for the testimony which they held.

10 And they cried with a loud voice, saying, “How long, O Lord, holy and true, dost Thou not judge and avenge our blood on them that dwell on the earth?” — and they cried with a loud voice as making an appeal to the injured justice of God. This cry began way back under the first Roman persecution;

— they knew their blood would be avenged, but they cried out “how long and execute judgement?”

11 And white robes were given unto every one of them, and it was said unto them that they should rest yet for a little season, until their fellow servants and also their brethren, who were to be killed as they were, should be fulfilled. — white robes were given unto every one of them as a token of their justification, and favourable acceptance with God; of their victory and triumph over death, their joy and glory.

12 And I beheld when He had opened the sixth seal, and lo, there was a great earthquake, and the sun became black as sackcloth of hair, and the moon became as blood; — and a great earthquake happened, and the sun became black as sackcloth, and the full moon became like blood, and the stars of heaven fell to the earth, as a fig-tree casts her figs when shaken by a mighty wind. With the opening of the sixth seal by the Lamb the special signs which should usher in the last day were enacted before John. There was a great and terrible earthquake.

13 and the stars of heaven fell unto the earth, even as a fig tree casteth her untimely figs when she is shaken by a mighty wind. — and the stars of heaven fell unto the earth…. all the other inferior deities lost their esteem, worship, and honour; for the idol temples being now opened, the idols and statues were exposed to the common people, and were found to be stuffed with hay and straw, which brought them into great contempt.

14 And the heaven departed as a scroll when it is rolled together, and every mountain and island were moved out of their places. — every mountain and island were moved out of their places; by “every mountain” may be meant the places of idolatrous worship, which were usually upon mountains; see Jeremiah 3:6; which were now shut up, or demolished, or used for Christian worship; and “every island” being moved also may show, that Paganism was not only rooted out of the provinces of the empire upon the continent, but out of the islands also.

15 And the kings of the earth, and the great men, and the rich men, and the chief captains, and the mighty men, and every bondman, and every free man, hid themselves in the dens and in the rocks of the mountains; — and the kings of the earth and the mighty ones and the generals and the wealthy and the strong ones and every slave and freeman hid themselves in the caves and in the rocks of the mountains, and said to the mountains and the rocks, Fall upon us and hide us from the face of Him that sits upon the throne, and from the wrath of the Lamb; for the great day of their wrath has come, and who is able to stand? Here the terror and despair of the enemies of the Lord, of which He Himself has prophesied.

16 and they said to the mountains and rocks, “Fall on us, and hide us from the face of Him that sitteth on the throne, and from the wrath of the Lamb! — and they all, filled with unspeakable dread, will cower in abject terror and fly to the crags and caves of the mountains, vainly hoping to find a spot where the angry glances of God will not strike them, where the wrath of the Lamb will not find them. That is what the breaking of the sixth seal uncovered: the terrors of the godless world on the day of the Judgement of God.

17 For the great Day of His wrath is come, and who shall be able to stand?” — and who shall be able to stand? against either of them, or in their presence, and so as to bear their wrath and displeasure; all which expresses guilt, shame, fear, and despair. The details of God’s wrath are to be revealed in the next chapter.

~~~

The four living creatures, or four beasts could be the same as what Ezekiel saw of a Cherub in opening chapter of Ezekiel:

“As for the likeness of their faces, all four had the face of a man, and the face of a lion on the right side, and all four had the face of an ox on the left side; they four also had the face of an eagle,” Ezekiel 1:10.

The face of a man could also be that of a cherub. But the question is, are these faces as it appeared in Revelation 6 the same as in Ezekiel?

Revelation (Ch 3-4)

•October 16, 2021 • Leave a Comment

The Churches must be real; and that their spiritual state is literally pointed out; but they must have reference to the state of the Church in later stages of its history. The messenger, or the angel could well be giving the Church certain warnings pertaining to the era of their Church so as to teach and edify those concern.

Revelation 3

In Chapter 2, we went through the Ephesian era, the Smyrnian era, the Pergamenian era, and the Thyatira Era; here the last three Church eras continue . . .

(5) The Sardis Era

1 “And unto the angel of the church in Sardis write: ‘These things saith He that hath the seven Spirits of God and the seven stars: I know thy works, and that thou hast a name that thou livest, but thou art dead. — here were seven Spirits of God, and since the Spirit is inherently Holy, there would be seven Holy Spirits;

— and we would add Jesus the Son and God the Father, resulting in nine Personage. Nine in the Godhead; we should have a Polygon or a Nonagon; it might be more realistic to believe in the Polyty or a Nonaty, but certainly wouldn’t be a Trinity.

Be watchful and strengthen the things which remain, that are ready to die, for I have not found thy works perfect before God.

— one of the characteristics of this church, namely the Church of God, Seventh Day, is that they believe there is no new truth; which means there no nothing more to be revealed; nothing else to be learned, and therefore it is deemed “ready to die” a dead church: “I have not found thy works perfect before God.”

Remember therefore how thou hast received and heard; and hold fast and repent. If therefore thou shalt not watch, I will come on thee as a thief, and thou shalt not know what hour I will come upon thee.

Thou hast a few names even in Sardis who have not defiled their garments; and they shall walk with Me in white, for they are worthy.

He that overcometh, the same shall be clothed in white raiment; and I will not blot out his name from the Book of Life, but I will confess his name before My Father and before His angels.

He that hath an ear, let him hear what the Spirit saith unto the churches!’

Besides the Thyatira church one condition lies in the Sardis exist side by side with the Philadelphian and the Laodicean eras at the “end time” groups that may or may not be accounted worthy to escape the tribulation;

They were refusing to repent and allow the Spirit to work through them to establish the truth that was ready to perish!

Within this CoG7, an ambitious man grew among the brethren; and not long after his ordination in 1931, and when certain leading ministers demanded that no more new truth be preached to the brethren, he broke off and started his own branch; he was Herbert W. Armstrong;

(6) The Philadelphia Era

Most of the congregations of the CoG7 succumbed to spiritual growth; dying, but the age of this Sardis continues, limping along. Elsewhere, the era of Philadelphia had began.

Paul was chosen, who was highly train in Judiasm, for spreading the gospel to the Gentiles. He later raised up Peter Waldo, a successful businessman, to keep His truth alive during the Middle Ages. In later days when the Gospel must go around the world, a man trained in advertising was tasked to shoulder the mission, Herbert Armstrong;

“And to the angel of the church in Philadelphia write: ‘These things saith He that is holy, He that is true, He that hath the key of David, He that openeth and no man shutteth, and shutteth and no man openeth:

I know thy works. Behold, I have set before thee an open door, and no man can shut it. For thou hast a little strength, and hast kept My Word, and hast not denied My name. — here is a church with little strength, few in numbers, but which has kept the word of God; here is a church which would preach the gospel with power before it an open door;

— Paul was struck down; in like manner Herbert Armstrong’s business went bankrupt in order that he might come to understand the truth;

— shortly before this event, God had opened the mind of Mrs Armstrong to understand the Sabbath truth from an elderly Church of God woman. After six months of study, unsupervised, in a persistent effort to prove Sabbath-keeping unscriptural, Armstrong accepted the Sabbath.

Behold, I will make them of the synagogue of Satan, who say they are Jews and are not, but do lie — behold, I will make them to come and worship at thy feet, and to know that I have loved thee.

10 Because thou hast kept the word of My patience, I will also keep thee from the hour of temptation, which shall come upon all the world to try them that dwell upon the earth.

11 Behold, I come quickly; hold fast that which thou hast, that no man take thy crown. — from this moment forward, Mr and Mrs Armstrong came to understand further truths. The brethren with whom they associated became interested that Herbert soon found himself speaking at their insistence; then preaching to small groups in Oregon!

12 Him that overcometh will I make a pillar in the temple of My God, and he shall go out no more; and I will write upon him the name of My God, and the name of the city of My God, which is New Jerusalem, which cometh down out of heaven from My God, and I will write upon him My new name.

13 He that hath an ear, let him hear what the Spirit saith unto the churches!’

During Herbert Armstrong’s reign, the church grew rapidly, claimed of up to 30 percent year on year for some 30 years. Pride went into his head, and he became a tyrant like any other tyrants one could be found in the African continent; and when enriching himself for self importance, he flew in a corporate Grumman Gulfstream II and his apostate treasures of plates and cutleries would of no less eminence than that of the Czars’. A few unauthorised biographies could give more details:

(a) Herbert Armstrong’s Tangled Web, An Insider’s View of the Worldwide Church of God, by David Robinson, 1980

(b) The Truth Shall Make You Free, Herbert Armstrong’s Empire Exposed, by John Tuit, 1981

In him covering up feelings of inferiority with an inflated ego was the next era started, the Laodicean:

(7) The Laodicean Era

But spiritually Herbert Armstrong and the church become blind, became stiffnecked, unable to see that Passover is a composite festival celebrated from the fourteenth to the twenty-first of Nisan; and Pentecost, he followed the Samaritan version of always having it on a Sunday.

14 “And unto the angel of the church of the Laodiceans write: ‘These things saith the Amen, the faithful and true witness, the beginning of the creation of God:

15 I know thy works, that thou art neither cold nor hot; I would thou wert cold or hot.

16 So then because thou art lukewarm, and neither cold nor hot, I will spew thee out of My mouth.

17 Because thou sayest, “I am rich and increased with goods and have need of nothing,” and knowest not that thou art wretched and miserable, and poor and blind and naked, — after Herbert Armstrong’s death in 1986, many splinters broke off; made up of individuals who are spiritually lukewarm! each saying to the other: “I am rich, and increased with goods, and have need of nothing.”

— his college, Ambassador College, was built on sand, loose sands, and within a few years of his death, students enrolment collapsed, faulty dismissed or sacked and the land and properties of the college sold.

18 I counsel thee to buy from Me gold tried in the fire, that thou mayest be rich, and white raiment, that thou mayest be clothed and that the shame of thy nakedness may not appear, and anoint thine eyes with eye salve, that thou mayest see.

Gold, not straw, tried in the fire. And here is what Herbert W Armstrong made a challenge based on this direct quote from an early World Tomorrow radio broadcast of himself as a prophet of God:

“A terrible famine is coming to the United States, that is going to ruin us as a nation inside of less than twenty years. Alright, I stuck my neck out there. You just wait twenty years and see whether I told you the truth. God says, if a man tells you what’s going to happen, wait and see. If it doesn’t happen, he was not speaking the word of God, he’s speaking out of his own mind. If it happens, you’ll know God sent him.”

Thus we can only oncluded that Herbert Armstrong labeled himself man of straw, not gold, hence also a false prophet.

19 As many as I love, I rebuke and chasten: be zealous therefore, and repent.

20 Behold, I stand at the door and knock. If any man hear My voice and open the door, I will come in to him, and will sup with him, and he with Me.

21 To him that overcometh, will I grant to sit with Me on My throne, even as I also overcame and am set down with My Father on His throne.

22 He that hath an ear, let him hear what the Spirit saith unto the churches!’” — now notice the warning to the last era, at the close of this age, the Laodicea: “I know thy works, that thou art neither cold nor hot:… I will spew you out of my mouth (Rev 3:15, 16);

— at the time of the end when prophecies hidden for ages are being revealed, knowledge increased; truth restored, but knowledge brings responsibility; it becomes dangerous if not handled rightly;

— notice Jesus’ admonition for today in Luke 21:36. “Watch ye therefore and Pray always, that ye may be accounted worthy to escape ALL these things that shall come to pass, and to stand before the Son of Man.”

There seems to be a parallel warning from the Book of Ezekiel:

Ezekiel 9:

1 He cried also in mine ears with a loud voice, saying, “Cause them that have charge over the city to draw near, even every man with his destroying weapon in his hand.”
2 And behold, six men came from the way of the higher gate, which lieth toward the north, and every man a slaughter weapon in his hand; and one man among them was clothed with linen, with a writer’s inkhorn by his side. And they went in and stood beside the brazen altar.
3 And the glory of the God of Israel had gone up from the cherub, whereupon he was, to the threshold of the house. And He called to the man clothed with linen, who had the writer’s inkhorn by his side;
4 and the Lord said unto him, “Go through the midst of the city, through the midst of Jerusalem, and set a mark upon the foreheads of the men who sigh and who cry because of all the abominations that are done in the midst thereof.”
5 And to the others He said in mine hearing, “Go ye after him through the city and smite. Let not your eye spare, neither have ye pity.
6 Slay utterly old and young, both maids and little children and women; but come not near any man upon whom is the mark; and begin at My sanctuary.” Then they began with the elder men who were before the house.

A Slaughting is to begin at “My sanctuary”and of course, the message and warning from Ezekiel were primarily aimed at the house of Israel, sometimes call the house of Ephraim.

Revelation 4

1 After this I looked, and behold, a door was opened in heaven; and the first voice which I heard was, as it were, of a trumpet talking with me, which said, “Come up hither, and I will show thee things which must be hereafter.” — Come up hither, and I will show thee things which must be hereafter; here is a case of the 24 elders that were called up into heaven, to be around the throne, and to witness what is to come;

— and later (in chapter 7), the 144,000 of the 12 tribes of Israel; these were redeemed and “come up” from the earth.

And immediately I was in the Spirit; and behold, a throne was set in Heaven, and One sat on the throne.

And He that sat thereon was to look upon like a jasper and a sardius stone; and there was a rainbow round about the throne, in appearance like unto an emerald.

And round about the throne were four and twenty seats; and upon the seats I saw four and twenty elders sitting, clothed in white raiment, and they had on their heads crowns of gold. — who are the 24 elders; are they angels or humans? (more at the end)

And out of the throne proceeded lightnings and thunderings and voices. And there were seven lamps of fire burning before the throne, which are the seven Spirits of God; — again, if the Spirit is a Being or an independent Personage; there would be seven Holy Spirits;

— and with these we would add Jesus Christ the Son, and God the Father, then there would be nine Personage; we should have a Polygon or a Nonagon; so surely the Godhead would be a Polyty or a Nonaty; nine heads, that would be more like an Indian goddess more than a Trinity?

and before the throne there was a sea of glass like unto crystal. And in the midst of the throne, and round about the throne, were four living beings full of eyes in front and behind.

And the first being was like a lion, and the second being like a calf, and the third being had the face of a man, and the fourth being was like a flying eagle. — this is very similar to what Ezekiel saw in his vision (Ezekiel 1); the Cherub had four faces; the face of a MAN (REUBEN) on the South; of a LION (JUDAH) on the East; the face of an OX (EPHRAIM) on the West and an EAGLE (DAN) on the North. 

And each of the four living beings had six wings about him, and they were full of eyes within; and they rested not day and night, saying, “Holy, holy, holy, Lord God Almighty, who was, and is, and is to come!” — in Ezekiel 1 the four cherubim each has four wings; same as in Ezekiel 10; but here they each has 6 wings. Why the difference? Are they different sets of cherubim?

And when those living beings give glory and honor and thanks to Him that sat on the throne, who liveth for ever and ever,

10 the four and twenty elders fall down before Him that sits on the throne, and worship Him that liveth for ever and ever, and cast their crowns before the throne, saying,

11 “Thou art worthy, O Lord, to receive glory and honor and power; for Thou hast created all things, and for Thy pleasure they are, and were created.”

~~~

Who are the 24 Elders in Revelation?

Who are the Twenty four Elders in Revelation? Whenever I heard conversation on this topic, my heart jumps onto my throat.

Revelation 4:

1 After this I looked, and, behold, a door was opened in heaven: and the first voice which I heard was as it were of a trumpet talking with me; which said, Come up hither, and I will shew thee things which must be hereafter.

2 And immediately I was in the spirit: and, behold, a throne was set in heaven, and one sat on the throne.

3 And he that sat was to look upon like a jasper and a sardine stone: and there was a rainbow round about the throne, in sight like unto an emerald.

4 And round about the throne were four and twenty seats: and upon the seats I saw four and twenty elders sitting, clothed in white raiment; and they had on their heads crowns of gold.

Q. Who are these Twenty four Elders set around a throne in heaven? Would they be:

(a) Angelic beings, not humans. Jesus said only He had down from heaven John 3:13 And no man hath ascended up to heaven, but he that came down from heaven, so the twenty four elders could not be humans as identified in Revelation 4:4. During the first resurrection, when Christ return, the saints will rise first, Satan bound (Revelation 20:1-4).They will meet Christ in the air, and when Christ set his feet in Jerusalem, the saints will be with Christ forever (1 Thess 4:16-17).  Further, among the restored 18 vital truths to the True Church since 1933 (Mystery of the Ages, Dodd & Mead, 1985, p251), Herbert W Armstrong came in the spirit of Elijah (Malachi 4:5), to establish the foundation of the True Church, and to restore all things (Matt 17:11, Mark 9:12, Acts 3:21). “Rain” and soon a storm appeared; “Drought” and the land suffered three and a half years of constipation! When you look at the preceding two or three verses in Acts 3:19-20, this restitution of all things by Elijah is in the context of Christ returning back to this earth. Hence these truths are solidified and sealed.

(b) Saints, not angelic beings. First, search the Scriptures, the word or title “elder” is nowhere applied to angels, but only to humans, or once humans. Second, in Rev 5:9, these 24 elders were redeemed by the Lamb’s blood. The exact phase “and hast redeemed us (Strong’s 2248: hémas; our, us, we)”. Only humans, not angels, were to be redeemed to God by Christ’s blood out of every kindred, tongue and nation. And in Rev 5:10 And hast made us (2248) unto our God kings and priests: and we shall reign on the earth (Those versions that translated as them for us and they for we are erroneous). Again, only humans were promised to be kings and priests to reign on earth, not angels. Do ye not know that the saints shall judge the world? 1 Corinthians 6:2. Finally, only members of God’s family, or members of Elohim (not angelic beings) are given crowns in heaven (Satan might have a crown too but he’s restricted on this earth). The Greek word for crown in Rev 4:4 (Strong’s 4735 as in Rev 2:10) is stephanos which is a garland wreath as awarded to overcomers or winners as in Greek games.

So are these 24 elders saints or angelic beings?

Revelation (Ch 1-2)

•October 15, 2021 • 2 Comments

Revelation 1

1 The Revelation of Jesus Christ, which God gave unto Him to show unto His servants things which must shortly come to pass. And He sent and signified it by His angel unto His servant John, — the Revelation of Jesus Christ, not John; John was never the Revelator! This is a revelation of Jesus Christ which the Father gave unto His Son to show unto an earthly servants, John, things which must shortly come to pass.

who bore record of the Word of God, and of the testimony of Jesus Christ, and of all things that he saw. — who bore record of the word of God…. of the essential and eternal Word of God, his only Son; as John the apostle did in his Gospel, and in his epistles, and also in this book.

Blessed is he that readeth, and they that hear the words of this prophecy, and keep those things which are written therein; for the time is at hand. — and they that hear the words of this prophecy; that listen attentively to the reading and exposition of this book, and have ears to hear, so as to understand the prophecies contained in it: but some versions read it as either, “blessed is he that readeth, and he that heareth”; or “blessed are they that read, and they that hear.”

John, To the seven churches in Asia: Grace be unto you and peace from Him who is, and who was, and who is to come, and from the seven spirits which are before His throne; — introducing himself similarly as others in the OT: “The word of the Lord came expressly unto Ezekiel, the priest, . . ;

— and from the seven spirits which are before his throne; before the throne of God the Father; are meant the angels, and stand before the throne of God, and are ready to do his will: this is also mentioned with reference to the seven angels of the churches;

— very often at other times, the hands of God is also the spirits of God; as in Ezekiel 3:14, “in the heat of my spirit; but the hand of the Lord was strong upon me; the spirit is not a person;

— hence the spirit of God could either be (a) an angel of God; or (b) a hand of God; (more at the end).

and from Jesus Christ, who is the faithful witness, and the first-begotten of the dead, and the prince over the kings of the earth. Unto Him that loved us, and washed us from our sins in His own blood, — and the Prince of the kings of the earth: which is to be understood figuratively of the saints, who have power over the world, through Christ, and of whom he is the Prince; under whom there is a King, whom the Prince asked us to address as the Father.

and hath made us kings and priests unto God and His Father, to Him be glory and dominion for ever and ever. Amen. — reference seems to be had to Exodus 19:6: “and ye shall be unto me a kingdom of priests”; which the Jerusalem Targum renders, “ye shall be unto me”, מלכין וכהנין, “kings and priests”; and so the Targum of Jonathan paraphrases it thus, “and ye shall be before me”, מלכין, “kings” crowned with a crown;

— parallel Scriptures:

And they sang a new song, saying, “Thou art worthy to take the book and to open the seals thereof; for Thou wast slain, and hast redeemed us to God by Thy blood, from every kindred and tongue, and people and nation,

10 and hast made us unto our God kings and priests; and we shall reign on the earth.” Revelation 5:9-10

Behold, He cometh with clouds, and every eye shall see Him, and they also who pierced Him; and all kindreds of the earth shall wail because of Him. Even so. Amen. — every eye shall see him, and they also which (they were who = “whosoever”) pierced him; here again is a reference to the incident of the piercing of Christ’s side (John 19:34), recorded only by John.

— and also a reference to Zechariah 12:10; “and they shall look upon me whom they have pierced, and they shall mourn for him as one mourneth for his only son.”

“I Am Alpha And Omega, the Beginning and the Ending,” saith the Lord, who is, and who was, and who is to come, the Almighty. — this is most probably the Son, one who was pierced, referenced earlier in verse 7; He is the beginning and the ending; that is, as aleph is the beginning of the alphabet; and cause of all things; as tau is the last letter of the alphabet.

I, John, who also am your brother and companion in tribulation and in the Kingdom and patience of Jesus Christ, was on the isle that is called Patmos, for the Word of God and for the testimony of Jesus Christ. — Ignatius, an early Christian writer and Patriarch of Antioch, says John “was banished to Patmos”: by Domitian emperor of Rome; Irenaeus says, at the latter end of his reign.

10 I was in the Spirit on the Lord’s Day, and I heard behind me a great voice as of a trumpet, — I was in the Spirit; this has many parallels in Ezekiel, “And the Spirit entered into me when He spoke unto me, and set me upon my feet, so that I heard Him who spoke unto me,” Ezekiel 2:2;

— also, “Then the Spirit entered into me and set me upon my feet, and spoke with me and said unto me, “Go, shut thyself within thine house,” Ezekiel 3:24;

— any person reading the book of Ezekiel would not say that was another person talking to Ezekiel, but why would the Catholics and Protestants invent that this spirit is a personage in Revelation 1:10?; and if so, there (in verse 4) were seven spirits?

— “on the Lord’s Day” is actually the Day of God’s judgement; “the day of Judgment” (Encyclopedia Biblica, article “Lord’s Day”); in later years, when the Roman Church were getting strong this was reinterpreted to mean the day of Christ’s resurrection, Sunday; hence today, “the Lord’s Day” has become a technical name for Sunday.

11 saying, “I am Alpha and Omega, the First and the Last,” and, “What thou seest, write in a book and send it unto the seven churches which are in Asia: unto Ephesus, and unto Smyrna, and unto Pergamos, and unto Thyatira, and unto Sardis, and unto Philadelphia, and unto Laodicea.” — “I am Alpha and Omega, the First and the Last,” this has the same expression as in verse 8 earlier: the “I am the Alpha and Omega, the Beginning and the Ending.”

12 And I turned to see the voice that spoke with me. And being turned, I saw seven golden candlesticks; — and I turned; for he had heard the voice behind him; probably the Father, but it could be read as if it is the Son, too, to see the person from whom the voice came from.

13 and in the midst of the seven candlesticks One like unto the Son of Man, clothed with a garment down to the feet and girded about the breast with a golden girdle. — like unto the Son of man; this is similar to Daniel 7:13;

— John now describes what he saw: And having turned around, I saw seven golden lamp-stands, and in the midst of the lamp-stands one similar to a Son of Man clothed in a long robe and girded across his breast with a golden belt. The prophet saw, not a single candlestick with seven lamps, Exodus 25:37;

14 His head and His hair were white like wool, as white as snow, and His eyes were as a flame of fire; — and his eyes were as a flame of fire: see Daniel 10:6; which is the omniscience of the Son of God; and (a) his love, like flames of fire, melts their souls into a true and genuine repentance for sin: or else, (b) his eyes of wrath and vengeance, as set upon his enemies, are meant: will be fierce and furious and bring swift and sudden destruction on them.

15 and His feet like unto fine brass, as though they burned in a furnace, and His voice as the sound of many waters. — this description “the sound of many waters” is found in Ezekiel 43:2, “the glory of the God of Israel came from the way of the east; and his voice was like the noise of many waters: and the earth shined with his glory.”

16 And He had in His right hand seven stars, and out of His mouth went a sharp two edged sword, and His countenance shone as the sun shineth in his strength. — in his right hand seven stars; the stars are representing the seven angels, messengers, or the seven churches; their presence in the right hand of Christ shows that they are under his special care and protection.

17 And when I saw Him, I fell at His feet as dead. And He laid His right hand upon me, saying unto me, “Fear not; I am the First and the Last. — I fell at his feet as dead; the appearance of the glory of the Lord had the same effect upon Ezekiel, Ezekiel 1:28.

18 I am He that liveth, and was dead; and behold, I am alive for evermore, Amen, and have the keys of hell and of death. — I am he that liveth, and was dead; I am Christ the Savior, who had died for mankind; and being raised from the dead, has the keys of life and death; to destroy the living or raise the dead.

19 Write the things which thou hast seen, and the things which are, and the things which shall be hereafter. — write the things which thou hast seen; these visions are for general instruction, and therefore every circumstance must be faithfully recorded. What he had seen was to be written; and what he was to see afterwards, must also be recorded.

20 The mystery of the seven stars which thou sawest in My right hand, and the seven golden candlesticks: the seven stars are the angels of the seven churches, and the seven candlesticks which thou sawest are the seven churches. — the seven stars are the angels of the seven churches; that is, the seven stars which John saw in Christ’s right hand, represent the angels, or the seven churches of Asia, and in them all their pastors and ministers of the churches in all the periods of time until Christ’s second coming. 

~~~

Sometimes, the “hand of God” verses the “spirit of God” could be read interchangeably; and this is true in the following instance:

The word of the Lord came expressly unto Ezekiel the priest, the son of Buzi, in the land of the Chaldeans by the River Chebar; and the hand of the Lord was there upon him. Ezekiel 1:3

So the Spirit lifted me up and took me away, and I went in bitterness, in the heat of my spirit; but the hand of the Lord was strong upon me. Ezekiel 3:14

And the hand of the Lord was there upon me; and He said unto me, “Arise, go forth into the plain, and I will there talk with thee.” Ezekiel 3:22

And it came to pass in the sixth year, in the sixth month, on the fifth day of the month, as I sat in mine house and the elders of Judah sat before me, that the hand of the Lord God fell there upon me. Ezekiel 8:1

The hand of the Lord was upon me, and carried me out in the Spirit of the Lord and set me down in the midst of the valley which was full of bones, Ezekiel 37:1

In the five and twentieth year of our captivity, at the beginning of the year, on the tenth day of the month, in the fourteenth year after the city was smitten, on the selfsame day the hand of the Lord was upon me, and brought me thither. Ezekiel 40:1

In that day shall Egypt be like unto women; and it shall be afraid and fear, because of the shaking of the hand of the Lord of hosts, which He shaketh over it. Isaiah 19:16

Lord, when Thy hand is lifted up, they will not see; but they shall see and be ashamed for their envy at the people; yea, the fire of Thine enemies shall devour them. Isaiah 26:11

I have made the earth and created man upon it; I, even My hands, have stretched out the heavens, and all their host have I commanded. Isaiah 45:12

And when ye see this, your heart shall rejoice, and your bones shall flourish like an herb; and the hand of the Lord shall be known toward His servants, and His indignation toward His enemies. Isaiah 66:14

The “angel of God” verses the “spirit of God” could be read interchangeably; and spirits, as angels can speak too; this is true in the following instance:

Then the angel of the Lord went out and struck down one hundred eighty-five thousand in the camp of the Assyrians. When the people got up the next morning, there were all the dead bodies! Isaiah 37:36.

My God sent his angel and shut the lions’ mouths; and they haven’t harmed me, for I was found innocent before him. And also before you, Your Majesty, I have not done harm,” Daniel 6:22.

I asked, “What are these, my lord?” The angel who was talking to me replied, “I will show you what they are,” Zechariah 1:9.

Then he showed me the high priest Joshua standing before the angel of the Lord, with Satan standing at his right side to accuse him, Zechariah 3:1

If the Spirit is a Being or an independent Personage by itself/himself; and there were seven Spirits that are before His throne, and since the Spirit is inherently and intrinsically Holy, there would be seven Holy Spirits, as John saw them;

and with these John would add Jesus Christ the Son, and God the Father, then there would be nine Personage. This is just simple arithmetic. Nine in the Godhead; we should have a Polygon (a nine sided shape) or a Nonagon (nine straight sides that meet at nine corners); so surely the Godhead would be a Polyty or a Nonaty, but certainly couldn’t be a Trinity?

Revelation 2

Seven Churches of Revelation Bible Study – David Jeremiah Blog

It’s important to note that beside the Churches as seen as historical it may have metaphorical or allegorical meaning to these Churches, in term of eras, otherwise why took the time and trouble to write them down. The Churches must be real; and that their spiritual state is literally pointed out; but they must have reference to the state of the Church in later stages of its history; and that the notion of what has been termed the Ephesian state, the Smyrnian state, the Pergamenian state . . . the Laodicean state, should be studied, analysed and such expositions should be entertained by anyone who wishes to arrive at a sober and rational knowledge of the Scriptures. The messenger, or the angel could well be giving the Church certain warnings pertaining to the era of their Church so as to teach and edify those concern.

(1) The Ephesus Era

1 “Unto the angel of the church of Ephesus write: ‘These things saith He that holdeth the seven stars in His right hand, who walketh in the midst of the seven golden candlesticks: — the church at Ephesus, started on the day of Pentecost and being the original apostolic church; known originally as Nazarenes (Acts 24:5), a church whose records had been documented in the Acts of the Apostles, which patiently labored to spread the gospel to the nations, the Gentiles; and were met with many obstacles but remained steadfast to the truth, though persecuted till the end;

I know thy works and thy labor and thy patience, and how thou canst not bear them that are evil; and how thou hast tried them that say they are apostles and are not, and hast found them liars; — I know thy works; for the eyes of the Lord are throughout the earth, beholding the evil and the good; and, being omnipresent, all things are continually open and naked before him;

— “apostles and are not, and hast found them liars” are false apostles, and they could be found right from the start, Simon Magus, from the Samaritans (Acts 8:9-25), who were famed for their worship of the Sun; but went on masquerading itself as the One True Church or the first church that ever existed.

and hast borne, and hast patience, and for My name’s sake hast labored and hast not fainted.

Nevertheless, I have something against thee, because thou hast left thy first love.

Remember therefore from whence thou art fallen, and repent and do the works as at first; or else I will come unto thee quickly and will remove thy candlestick out of his place, unless thou repent.

But this thou hast: that thou hatest the deeds of the Nicolaitans, which I also hate.

He that hath an ear, let him hear what the Spirit saith unto the churches. To him that overcometh will I give to eat of the Tree of Life, which is in the midst of the Paradise of God.’

— the headquarters church at Jerusalem, in around 69 AD, fled to Pella before the Romans razed the city and the Temple to the ground;

until probably the time of Emperor Constantine;

— Paul, Barnabas; and later such men as Polycarp and Polycrates, they were called “Quartodecimani” because they kept the true Passover celebration the Jewish way on the fourteenth instead of Easter on a Sunday.

(2) The Smyrna Era

“And unto the angel of the church in Smyrna write: ‘These things saith the First and the Last, who was dead and is alive: — 

I know thy works and tribulation and poverty (but thou art rich), and I know the blasphemy of them that say they are Jews and are not, but are the synagogue of Satan. — they called themselves Jews but from God’s point of view they are of the synagogue of Satan; this is a serious charge!

What happened was an attempt by the Catholics to stamp out the true scattered Church and the true Passover from the world?

Let the Catholic historian Eusebius, who lived in the time of Constantine, tell the story: “But before this time another most virulent disorder had existed, and long afflicted the Church; I mean the difference respecting… Easter. For while one party asserted that the Jewish custom (as to time) should be adhered to, the other (did not).

“Accordingly, the people being thus in every place divided in this respect… no one appeared who was capable of devising a remedy…. Constantine appeared to be the only one on earth capable… He convoked a general council…”

10 Fear none of those things which thou shalt suffer. Behold, the devil shall cast some of you into prison, that ye may be tried, and ye shall have tribulation ten days. Be thou faithful unto death, and I will give thee a crown of Life.

11 He that hath an ear, let him hear what the Spirit saith unto the churches. He that overcometh shall not be hurt by the second death.’  

After the Nicaean Council closed, Emperor Constantine sent the following letter to all the churches: “At this meeting the question concerning… Easter was discussed… First of all, it appeared an unworthy thing that in the celebration of this… feast we should follow the practice of the Jews… Let us then have nothing in common with the Jews… It has been determined by the common judgment of all, that the… feast of Easter should be kept on one and the same day.” The Council of Nicea decided, under his authority, that Easter MUST be celebrated on Sunday and that the Passover must be forbidden!

(3) The Pergamos Era

12 “And to the angel of the church in Pergamos write: ‘These things saith He that hath the sharp sword with two edges: — as a result of the Council of Nicaea (325 AD), the great false Church commenced 1260 years of Tribulation (Rev 12:6) with full force. The true Church fled into the valleys and mountains in Europe and Asia Minor.

It was the close of the twelfth century. In Lyons, France, lived an astonishingly successful and wealthy merchant, Peter Waldo. “One day, while in the company of some of the leading citizens, one of his friends fell lifeless at his side. Terrified by the event, he said to himself: If death had stricken me, what would have become of my soul?”

Being a Catholic, Waldo asked one of these theologians what is the PERFECT way. ‘Ah!’ answered the theologian… ‘here is Christ’s precept’: ‘”If thou wilt be perfect, go, sell that thou hast and give to the poor, and thou shalt have treasure in heaven, and come take up thy cross and follow me.”‘” (Comba, “History of the Waldenses,” p 21).

Waldo disposed of his property by distributing to the poor. But from his wealth he also had a translation of the Scriptures made. In this translation he noticed the command to the apostles to preach the gospel of the Kingdom of God. His mind began to understand the Scriptures.

God was using Peter Waldo.

Comba says that “he brought to the study of the Scriptures that practical common sense which had guided him in his business transactions… The word of Christ was clear enough, for Waldo it was simply a question of furnishing a literal translation” (p 243 of Comba’s “History”).

The humble remnant of the Church of God listened to him. Soon many new disciples were coming to repentance. “His disciples became almost as many C0-workers for him” (p 26). The world called them Waldenses.

But in 1315 AD, long before the crusade against the Waldenses occurred, the truth of God was carried to England by a German Waldensian preacher, Walter Lollard. It took deep root for a while until the Protestant Reformation.

Through the preaching of Lollard and other helpers, hundreds were repenting. Thousands were learning for the first time that baptism means immersion — that the world’s religious holidays came from paganism and that Sunday was not the Sabbath.

It was not until about 1650 that there were again enough Sabbath keepers to establish local congregations. They often called themselves the Church of God, but the world termed them “Sabbatarians” and Sabbatarian Baptists.

13 I know thy works and where thou dwellest, even where Satan’s seat is; and that thou holdest fast My name and hast not denied My faith, even in those days wherein Antipas was My faithful martyr, who was slain among you, where Satan dwelleth.

14 But I have a few things against thee, because thou hast there them that hold the doctrine of Balaam, who taught Balak to cast a stumbling block before the children of Israel, to eat things sacrificed unto idols, and to commit fornication. — 

15 So thou also hast them that hold the doctrine of the Nicolaitans, which thing I hate.  

16 Repent, or else I will come unto thee quickly, and will fight against them with the sword of My mouth.

17 He that hath an ear, let him hear what the Spirit saith unto the churches. To him that overcometh will I give to eat of the hidden manna, and will give him a white stone, and on the stone a new name written, which no man knoweth save he that receiveth it.’ — 

From England the true Church spread to America. In 1664, Stephen Mumford, sent to Newport, Rhode Island, raised up a small church mainly from Baptist converts. One by one new churches were established through continued help of the churches in England.

But as always happens, after several generations the children take truth for granted and never really surrender their wills and their lives to God. In less than one hundred and fifty years, the English churches almost disappeared, having cut themselves off from God by turning from His truth, and by adopting the name “Seventh-day Baptists.”

Members of the church migrated to America the number of churches increased as the gospel was spread from state to state. But so nearly dead were these congregations that in 1802 many began to organise themselves together into a General Conference instead of submitting to the government of God for the carrying out of the gospel. At this serious juncture, most of the local churches joined together to form the Seventh-day Baptist General Conference and thereby ceased to be the true Church. Soon they began teaching the Trinity doctrine!

(4) The Thyatira Era

18 “And unto the angel of the church in Thyatira write: ‘These things saith the Son of God, who hath His eyes like unto a flame of fire, and His feet are like fine brass: — during this time William Miller started the advent movement among Sunday-observing churches. In 1843 several followers of Miller in Washington, New Hampshire, became acquainted with the truth of the Sabbath. It was not until after their miserable Great Disappointment of 1844 that the general body of Adventists had the Sabbath question called to their attention.

19 I know thy works, and charity and service, and faith and thy patience, and thy works, and the last to be more than the first. — a small number accepted the Sabbath and teamed up with the few others who refused to be affiliated with the Seventh-day Baptist Conference.

They called themselves the “Church of God” and began publishing “The Advent Review and Sabbath Herald”. Their first songbook was dedicated to “The Church of God scattered abroad.”

The Thyatira’s Phoenician Princess, Jezebel, masquerading as a true Prophetess!

20 Notwithstanding, I have a few things against thee, because thou sufferest that woman Jezebel, who calleth herself a prophetess,to teach and to seduce My servants to commit fornication, and to eat things sacrificed unto idols. — Jezebel, who calleth herself a prophetess; no other church groups has a better fit than one among the Seventh-day Adventists, who fulfils this prophecy exactly like a T;

with each passing year, new and different doctrines were being introduced by Ellen G. White to explain away the Adventist failure of October 22. 1844. The original church members generally did not go along, with the “inspired testimony” of Ellen G. White;

— and finally, a meeting was held by some of the members in Battle Creek, Michigan, September 28 through October 1, 1860. And that is how the Seventh-Day Adventist began to regard her as a prophetess, and who was responsible for naming their organisation and the birth of her Jezebelian dreams;

— Ellen G White, in one of “inspired” visions, wrote of rays of lights from the throne as she received her numerous visions, and her revelation about volcanoes, earthquakes and the Flood, are quoted from her book, Patriarchs and Prophets, an epic that Professor Walter Veith often quoted from, as below:

“At this time immense forests were buried. These have since been changed to coal, forming the extensive coal beds that now exist, and also yielding large quantities of oil. The coal and oil frequently ignite and burn beneath the surface of the earth. Thus rocks are heated, limestone is burned, and iron ore melted. The action of the water upon the lime adds fury to the intense heat, and causes earthquakes, volcanoes, and fiery issues. As the fire and water come in contact with ledges of rock and ore, there are heavy explosions underground, which sound like muffled thunder. The air is hot and suffocating. Volcanic eruptions follow; and these often failing to give sufficient vent to the heated elements, the earth itself is convulsed, the ground heaves and swells like the waves of the sea, great fissures appear, and sometimes cities, villages, and burning mountains are swallowed up. These wonderful manifestations will be more and more frequent and terrible just before the second coming of Christ and the end of the world, as signs of its speedy destruction.” (Patriarchs and Prophets, Pacific Press, 1958, pg 108-109).

21 And I gave her space to repent of her fornication, and she repented not. — in fact, instead of the true gospel, Passover and feast days and prophecies of the Old Testament, their ministers taught a “third angel’s message,” which they had accepted from Helen G. White; so much emphasis that it is as if it’s more important than the gospel itself.

22 Behold, I will cast her into a bed, and them that commit adultery with her into great tribulation, unless they repent of their deeds. — the Adventist movement didn’t regard themselves separate from the mainstream Protestants, but rather as one of them, and in doing so, took in Trinity in their teachings along with Christmas celebrations.

23 And I will kill her children with death, and all the churches shall know that I am He that searcheth the reins and hearts; and I will give unto every one of you according to your works. — “I will kill her children with death” sounds serious, and this warning is from God. There must be some serious abominations within the church, within their practices and doctrines.

24 But unto you I say, and unto the rest in Thyatira, as many as have not this doctrine and who have not known the depths of Satan (as they say) I will put upon you no other burden. — there is great rewards for those who are judged faithful and true, yet penalties are great, too, for those who harbour many Jezebelian doctrines and teachings within.

25 But that which ye have already, hold fast till I come.

26 And he that overcometh and keepeth My works unto the end, to him will I give power over the nations,

27 and “he shall rule them with a rod of iron; as the vessels of a potter shall they be broken to shivers,” even as I have received from My Father.

28 And I will give him the morning star.

29 He that hath an ear, let him hear what the Spirit saith unto the churches!’

~~~

“And I will kill her children with death;” perhaps this great tribulation should be tied in with a similar vision the prophet Ezekiel had: “Slay utterly old and young, both maids and little children and women; but come not near any man upon whom is the mark; and begin at My sanctuary.” Then they began with the elder men who were before the house,” Ezekiel 9:6.

One thing which is a serious charge is that Adventists put Ellen G. White’s writings ahead of Moses and the Prophets, ahead of God’s in actual fact; hence they insist wine is grape juice; and Passover is observe quarterly, on every thirteenth sabbath, and not annually on the fourteenth of Nisan as the Scriptures say.

Obadiah

•October 13, 2021 • Leave a Comment

The long feud between the brother tribes of the children of Israel and the descendants of Esau which began at the birth of the twin ancestors, and continued with varied fortunes down to the extinction of both as distinct nationalities, forms the subject of Obadiah’s vision.

Esau selling his Birthright to Jacob for a bowl of soup

The title of this Book in the Hebrew copies is usually “Sepher Obadiah” which means the Prophecy of the Prophet Obadiah. This book is the shortest book of the OT with 21 verses only. We do not know anything of the book’s author, except its name, Obadiah (meaning servant of Yehovah).

Many would place Obadiah into the time of king Jehoram of Judah (848 – 841 BC) under whose reign the Edomites revolted from under the dominion of Judah (II Chronicles 21:8-10). In this case Obadiah would have been the first writing prophet in the history of Israel. Other observers, however, think that Obadiah lived and ministered at the time of Jerusalem’s destruction in 586 BC or even later as he obviously must have known this event.

This short prophetical book is about the nation of Edom; its people the Edomites were established to the south of the Israelites whose hatred for Israel will eventually lead to their destruction, a destruction that may not has a return; but as could be understood by following this study, its fate is still in suspense. The Lord was asked to remember in Psalms 137 against the Edomites who had asked that Jerusalem be razed to its foundations:

7 Remember, O Lord, the children of Edom in the day of Jerusalem’s fall, who said, “Raze it, raze it, even to the foundation thereof!”
8 O daughter of Babylon who art to be destroyed, happy shall he be, that rewardeth thee as thou hast served us.
9 Happy shall he be, that taketh and dasheth thy little ones against the stones. Psalms 137:7-9

To call for the razing of the Temple of God “Raze it, raze it, even to the foundation thereof!” is a heavy crime against the God of the Most High. The Most High dwelled there and these Edomites cheered the Babylonians to burn it down? Madness! Just Madness!!!

Prophecies against Ammon and the Ammonites (Genesis 19:38; it is stated they descendants of Lot) have no promise of restoration; for the Lord have spoken it (Ezekiel 21:32, 25:10).

But for Edomites, and they shall know My vengeance: “And I will lay My vengeance upon Edom by the hand of My people Israel, and they shall do in Edom according to Mine anger and according to My fury; and they shall know My vengeance, saith the Lord God,’ Ezekiel 25:14; indicating they’ll survive? Or, perhaps, their fate is still in the balance?

Historically, the children of Esau dwelt to the south of the children of Israel; in the mountains of Seir south of the Dead Sea down to the Gulf of Akaba. When the Israelites were on their journey from Egypt to Canaan the Edomites would not let them pass through their territory (Numbers 20:14-21).

Edom rejoiced over Jerusalem’s destruction in 586 BC (Psalms 137:7). When the Romans conquered Judea the Idumeans (Edomites) family of Herod reached the royal dignity. Since Jerusalem’s destruction in 70 AD the Edomites “disappeared” from history. But where did they go?

These are the names of Esau’s sons: Eliphaz (7) the son of Adah the wife of Esau, Reuel (4) the son of Basemath the wife of Esau (Genesis 36:10); and Jeush, Jaalam and Korah from Abolibamah (Genesis 36:18); so Esau had five sons and numerous grandsons.

One strong indication points to where they are today: in ancient times they live South of the children of Israel and would most probably today; that they are now in Spain, Portugal, Italy; and across the Atlantic: Mexico and the Latin Americas.

Obadiah

A parallel in Ezekiel Chapter 35

— a prophesy against Mount Seir
— a prophesy against all Edom

A Targum version of Obadiah as translated by Lenihan exists online here. The Targum is an indispensable source of understanding the Bible. Started by Ezra for those returning Jews from Babylon and for these returnees they could only understand the Sacred Text in Aramaic; hence the Targum is as if Ezra is speaking to us from the verses quoted.

The vision of Obadiah. Thus saith the Lord God concerning Edom: We have heard a word from the Lord, and an ambassador is sent among the nations: “Arise ye, and let us rise up against her in battle” — the Edomites thought their land was unconquerable because of the defence system that they had built throughout their rocky mountains. Obadiah warns them that no matter how high up the mountains they go or how strong they make their defences, nothing will save them from the coming destruction;

Rashi: The vision of Obadiah: Why is Obadiah different that he was chosen to prophesy concerning Edom and did not prophesy any other prophecy? Our Sages of blessed memory stated: Obadiah was an Edomite proselyte. Said the Holy One, blessed be He: From them and in them will I bring upon them. Let Obadiah, who dwelt between two wicked people, Ahab and Jezebel, and did not learn from their deeds, come and impose retribution upon Esau, who dwelt between two righteous people, Isaac and Rebecca, and did not learn from their deeds.

“Behold, I have made thee small among the nations; thou art greatly despised. — thou art greatly despised; a parallel in Jeremiah 49:15 “For lo, I will make thee small among the heathen and despised among men,” as the term beaners (Latinx or Latinos?) could allude to.

Rashi: Behold I have made you small: In contrast with what his father called him, his big son, and his mother called him her big son, the Holy One, blessed be He, says: In My eyes, he is small. And our Sages expounded: small for they have neither script nor language;

The Targum (translated by Lenihan): Behold, I will make you weak among the nations. You are highly contemptible.

The pride of thine heart hath deceived thee, thou that dwellest in the clefts of the rock, whose habitation is high, that saith in his heart, ‘Who shall bring me down to the ground?’

The Targum: The wickedness of your heart has led you astray. For you are like an eagle that dwells in the teeth of the rock, whose dwelling-place is in the heights, who says in his heart, “Who will bring me down to earth?”

one Report by McKinsey says of the 60 millions Latinos in US, they often live in ‘deserts’ where adequate housing, groceries are hard to find. “Nearly 9 in 10 of the Latino residents in such communities lived in five states: California, Florida, New Jersey, New York and Texas.”

McKinsey: Latinos are projected to make up 22.4 percent of the US labor force by 2030 and more than 30 percent by 2060 (Latinos population to 111.2 million by ’60). 

Though thou exalt thyself as the eagle, and though thou set thy nest among the stars, from thence will I bring thee down,” saith the Lord.

— Esau was the firstborn, set to exalt thyself as an eagle and favored by his father Isaac for the birthrights, but Jacob coveted it and stole it from under him, and he was brought down like a pigeon. Also, like Herod the Great, an Idumean, he was a great eagle with his famed cruelty over the Jews as king over Judea; shall come up and fly as the eagle but he, too, would be brought down.

Christopher Columbus, an Italian explorer; when he set foot in the Americas on October 12, 1492, claimed the land for King Ferdinand and Queen Isabella of Spain

“If thieves came to thee, if robbers by night (how thou art cut off!), would they not have stolen till they had enough? If the grape-gatherers came to thee, would they not leave some grapes?

Rashi: come upon you: Heb; lit., came to you.

How were you silent?: Why were you sleeping soundly and still until they stole all they desired?

would (the vintagers) not leave over some gleaning grapes? But these will not leave you anything, for they will search and reveal and seek out your hidden things.

The Targum: If thieves came upon you, if plunderers of the night – How then would you sleep until they had stolen their fill! And if robbers, as grape-cutters, came upon you – Would they not leave gleanings?

How the things of Esau are searched out! How his hidden things are sought out!

Rashi: were revealed: Jonathan rendered: were revealed, and it is an Aramaic expression: נִבְעוּ means “sought out.” Cf. (Isa. 21: 12) “If you will request, request (א ִם תִּבְעָיוּן בְּעָיוּ).”

Allegorical representation of the Spanish Armada, June to September 1588, showing Queen Elizabeth I and her army watching the action off Portland Bill (the Queen was in London)
The Spanish Armada, defeated by Queen Elizabeth I and her Royal Navy, 1588, when the British emerged to become the top dog and ruled the waves

The Targum: How then has Esau been ransacked! His hidden things have been revealed.

All the men of thy confederacy have brought thee even to the border; the men that were at peace with thee have deceived thee and prevailed against thee. They that eat thy bread have laid a wound under thee; there is no understanding in him.

Rashi: Until the border… escorted you: Those who promised to aid you, came with you and escorted you to the border of your land, to the boundary, whence they came upon you in war, and with this they enticed you and succeeded.

they prevailed against you: to entice you to leave, and they deserted you.

your food they lay as a wound under you: Even your food your brother Jacob made for you as a wound, for he gave you bread and a pottage of lentils, and thereby you despised the birthright.

Shall I not in that day,” saith the Lord, “even destroy the wise men out of Edom, and understanding out of the mount of Esau?

Americans moving westward after they bought the Louisiana Purchase from France in 1803

And thy mighty men, O Teman, shall be dismayed, to the end that every one of the mount of Esau may be cut off by slaughter.

Rashi: And your mighty men shall be dismayed: They shall be dismayed and frightened to flee to the land of Israel [Malbim : to the land of Edom]. And Jonathan rendered: And your mighty men shall be dismayed, dwellers of the southland.

in order that every man be cut off: i.e, every mighty man. [from Targum Jonathan]

from the mountain of Esau by slaughter: By the great slaughter that will come upon them.

The Targum: And your warriors who dwell in the south shall be smashed, in order to destroy any man with the mark of the City of Esau, through slaughter.

10 “For thy violence against thy brother Jacob, shame shall cover thee, and thou shalt be cut off for ever.

— “Because of the violence done to your brother Jacob, shame shall cover you, and you shall be cut off forever . . . and there shall be no survivor for the house of Esau, for the LORD has spoken.”

Rashi: Because of the violence of your brother Jacob: Because of the violence you inflicted upon Jacob.

11 In the day that thou stoodest on the other side—in the day that the strangers carried away captive his forces, and foreigners entered into his gates and cast lots upon Jerusalem” even thou wast as one of them.

Rashi: On the day you stood from afar: that you did not come to aid him.

you, too, are like one of them: I account it for you as though you were one of their attackers. “Raze it, raze it.”

The Targum: On the day you stood aside, on the day the nations plundered his possessions and strangers entered his forts and cast lots upon Jerusalem, even you were like one of them.

12 But thou shouldest not have looked on the day of thy brother in the day that he became a stranger; neither shouldest thou have rejoiced over the children of Judah in the day of their destruction; neither shouldest thou have spoken proudly in the day of distress.

Rashi: And you should not have looked on the day of your brother: You should not have looked and stood from afar.

on the day of his being delivered: Heb. נָכְרוֹ. On the day of his being delivered into the hands of the heathens. And so does Scripture state concerning Saul: (I Sam. 23:7) “ נִכַּר אֹתו ֹאֱלֹהִים בְּיָדְי”, “He has delivered him into my hand.”

13 Thou shouldest not have entered into the gate of My people in the day of their calamity; yea, thou shouldest not have looked on their affliction in the day of their calamity, nor have laid hands on their substance in the day of their calamity.

Dwellers of the Southland – Anachronous map of the Spanish Empire (RED Territories until the Spanish American wars of independence (1808–1833))

Rashi: and you should not have stretched out upon their possessions: You should not have stretched out your hand upon their possessions. So did Jonathan render. And this is an ellipsis, to which we must add: “your hands.”

The Targum: And that you entered the gates of my nation on the day of their destruction, and that even you watched his affliction of the day of his destruction, and that you laid your hand on his possessions on the day of his destruction.

14 Neither shouldest thou have stood in the crossway to cut off those of his that did escape; neither shouldest thou have delivered up those of his that remained in the day of distress.

Rashi: And you should not have stood by the gap: Heb. הַפֶּרֶק. The place through which the escapees emerge to escape, and in French they call it “trou.”

And you should not have stood by the gap: From here [we learn] that one may not interrupt between one paragraph and another in reading the “Shma.” [Haggadah of Rabbi Akiva]

15 “For the day of the Lord is near upon all the nations. As thou hast done, it shall be done unto thee: thy reward shall return upon thine own head.

Spain and Mexico losing their territories after Napoleon, broke but wanting France to fight the Russians and British, was forced to sell Louisiana to the American in 1803, but ended defeated by the Russians in 1812 and by the British at the Battle of Waterloo in 1815

16 For as ye have drunk upon My holy mountain, so shall all the nations drink continually; yea, they shall drink, and they shall swallow down, and they shall be as though they had not been.

Rashi: For, as you drank on My Holy Mount: Just as you rejoiced concerning the destruction of My Holy Mount. [from Jonathan]

and be stunned: Heb. יְלָעוּ. As the Targum renders: וְיִסְתַּלְעֲמוּן, an expression of confusion, amazement, and benumbing the mind; etourdissant in French – stunning.

17 “But upon Mount Zion shall be deliverance, and there shall be holiness; and the house of Jacob shall possess their possessions.

Rashi: those who inherited them: The possessions of the people who inherited them. [from Targum Jonathan]

The Targum: And in Mount Zion there will be deliverance, and they will be holy. And the House of Jacob shall inherit the possessions of the nations who had inherited from them.

18 And the house of Jacob shall be a fire, and the house of Joseph a flame, and the house of Esau for stubble; and they shall kindle them and devour them. And there shall not be any remaining of the house of Esau, for the Lord hath spoken it.”

Reuben, firstborn but drunk, climbed up to his father’s bed, hence lost his birthright, defeated at the Battle of Waterloo and Napoleon exiled to the island of St Helena

Rashi: for the Lord has spoken: Now where did He speak? (Num. 24:19) “Out of Jacob shall come a ruler, and he shall destroy him that remains in the city.” [from Mechilta Bo 12:16, Pirkei d’Rabbi Eliezer ch.37]

— Oh, wait; is “there shall not be any remaining of the house of Esau,” meaning an end of any survival for the house of Esau, which seems contrary to Ezekiel 25:14? Or, perhaps according to Rashi above, verse 10, only those “that remains in the city” won’t survive?

And the House of Jacob shall be mighty as fire and the House of Joseph as strong as flame and the House of Esau as weak as straw. And they shall dominate them and kill them and there will no survivor for the House of Esau, for the Lord has decreed it so.

19 And they of the south shall possess the mount of Esau, and they of the plain the Philistines. And they shall possess the fields of Ephraim and the fields of Samaria, and Benjamin shall possess Gilead.

Rashi: And [the inhabitants of] the southland shall inherit: Israel, who were dwelling in the south of Eretz Israel, shall inherit the mountain of Esau, which is at the southern boundary; and the people of the plain shall inherit the land of the Philistines and Mt. Ephraim and Mt. Shomeron.

— and Benjamin with [the inhabitants of] Gilead: And the children of Manasseh, whose territory was the land of Gilead, shall spread beyond the borders of Eretz Israel on the east.

20 And the captives of this host of the children of Israel shall possess that of the Canaanites, even unto Zarephath; and the captives of Jerusalem who are in Sepharad (בִּסְפָרַ֑ד Hebrew 5614) shall possess the cities of the south.

Rashi: And this exiled host: Heb. הַחֵל. Jonathan renders: This people. הַחֵל, An expression of a host. Cf. (Isa. 36:2) “And he came to Jerusalem with an army (חֵיל) of a great multitude,” which deals with Rabshakeh, only that this one is missing a “yud.” It is also possible to explain גָלֻת הַחֵל as “the exile of this valley.”

— who are with the Canaanites as far as Zarephath: The exile which is of the children of Israel who were exiled from the ten tribes to the land of the Canaanites as far as Zarephath

— and the exile of Jerusalem which is in Sepharad: who are of the people of Judah who were exiled to Sepharad – they shall inherit the cities of the southland, which are in the Southern part of Eretz Israel. The exegetes [a person who interprets text, especially the Scriptures] claim that Zarephath is the kingdom called France in French.

— Jonathan renders: Spain (Rashi quoting the Targum: Sepharad shall inherit the cities of the Southland as Spain); the Targums identified Sepharad with Spain, hence, Spanish Jews are called Sephardim;

Peshitta (Lamsa): The first exiles, that is, of the children of Israel, shall possess the land from Canaan as far as Zarephath; and the exiles of Jerusalem who are in Spain shall possess the cities of the south.

Cambridge Bible for Schools and Colleges: Sepharad is the name of a place; the modern Jews understand it of Spain, and accordingly, “at the present day the Spanish Jews, who form the chief of the two great sections into which the Jewish nation is divided, are called by the Jews themselves the Sephardim, German Jews being known as the Ashkenazim.”

Geneva Study Bible: by Zarephath, France; and by Sepharad, Spain;

21 And saviors shall come up on Mount Zion to judge the mount of Esau; and the kingdom shall be the Lord’S.

Wikipedia: Sepharad (/sɛfəræd/or səˈfɛərəd/ Hebrew: סְפָרַד Sp̄āraḏ; also Sefarad, Sephared, Sfard) is the Hebrew name for Spain. A place called Sepharad, probably referring to Sardis in Lydia (‘Sfard’ in Lydian), in the Book of Obadiah (Obadiah 1:20, 6th century BC) of the Hebrew Bible. The name was later applied to Spain.

Rashi: shall ascend: Princes of Israel as saviors on Mt. Zion.

to judge the mountain of Esau: to exact retribution from the mountain of Esau for what they did to Israel.

to judge: Heb. לִשְׁפֹּט. joustiser in O.F.

— the mountain of Esau: Jonathan renders: the great city of Esau.

and the Lord shall have the kingdom: This teaches you that His kingdom will not be complete until He exacts retribution from Amalek.

Final decision seems to be still in suspense, yet to be decided, if this is the correct understanding, until the saints would come to Mount Zion to judge the house of Esau? Any other possible observations?

More on Esau: Ezekiel 20:45-21:1-5; Ezekiel 35

Hosea (Ch 13-14)

•October 12, 2021 • Leave a Comment

The Prophecy of Hosea is primarily to the house of Ephraim. Being the chief of the ten tribes, Ephraim is often used in place of Israel when referring to northern ten tribes. Elsewhere on this site Ephraim and Manasseh has been established as the United States. So although Hosea may refer to situation in his time, the encoded message of Ephraim and Israel is specially meant primarily for the United States and secondarily its European allies.

Hosea 13

1 When Ephraim spoke, trembling, he exalted himself in Israel; but when he offended in Baal, he died. — when Ephraim,” as the mightiest of the northern tribes, “spoke, there was trembling”; for the other tribes were so much weaker that they could not hold out against the top dog; he exalted himself in Israel, assuming the leadership and enforcing his will; that was yesterday, but today, when America sneezes the world catches a flu!

And now they sin more and more, and have made for themselves molten images of their silver, and idols according to their own understanding, all of it the work of the craftsmen. They say of them, “Let the sacrificers of men kiss the calves!” — and now they sin more and more…. since the times of Jeroboam, and also of Ahab, adding other deities to the calves, as follows; increasing the number of their idols, and their idolatrous sacrifices, rites, and ceremonies: Easters, Christmas; and then Halloweens; and from evil to evil; they stop not, but run into greater absurdities and grosser idolatries.

Therefore they shall be as the morning cloud, and as the early dew that passeth away, as the chaff that is driven with the whirlwind out of the floor, and as the smoke out of the chimney. — and as the early dew it passeth away; as soon as the heat of the sun is felt, when the earth is left dry; so these people, though they seemed to be in great prosperity, and to be very fruitful in children, and in substance, and promised themselves much more; yet in a little time their land would become desolate, and they stripped of all that was dear and valuable to them these metaphors are used in Hosea 6:4.

“Yet I am the Lord thy God from the land of Egypt, and thou shalt know no god but Me; for there is no savior besides Me.

“I knew thee in the wilderness, in the land of great drought. — I did know thee in the wilderness…. where there were no food nor drink, where scorpions, serpents, and beasts of prey; there the Lord knew them, and showed a fatherly affection and care of them; and fed them with manna and quails, and guided and directed them in the way, and protected and preserved them from their enemies, and from all hurt and danger;

— so the Targum explains it, “I sufficiently supplied their necessities in the wilderness.”

According to their pasture, so were they filled; they were filled, and their heart was exalted; therefore have they forgotten Me. — they were filled, their hearts exalted, elated with plenty, grew proud and haughty; they attributed their fullness not to God, but to their own merit; put their trust and confidence in their affluence; and thought themselves safe, secure, and out of any danger.

Therefore I will be unto them as a lion; as a leopard by the way will I observe them. by this and the following metaphors are set forth the severity of God’s judgments upon them for their arrogance, and utter destruction. Some observe the word an old lion, which, though slower in the pursuit of its prey, is more cruel when it has got it; see Hosea 5:14.

I will meet them as a bear that is bereaved of her whelps, and will rend the caul of their heart, and there will I devour them like a lion; the beast of the field shall tear them. — and there will I devour them like a lion; in their cities and houses, when taken by the enemy; and then they will utterly destroy them.

“O Israel, thou hast destroyed thyself, but in Me is thine help.

10 I will be thy King. Where is any other that may save thee in all thy cities, and thy judges of whom thou saidst, ‘Give me a king and princes’? — I will be thy King, so the Lord’s offer still holds good; where is any other king that may save any of your cities? Who else could deliver you from the power of the Assyrians?

11 I gave thee a king in Mine anger, and took him away in My wrath. the first king of all Israel, king Saul was given at the request of the people; in doing so, in fact, they rejected God their King.

12 “The iniquity of Ephraim is bound up; his sin is hid. the Targum says, “the sins of the house of Ephraim are treasured up; they are reserved to punish all their offences.”

13 The sorrows of a travailing woman shall come upon him. He is an unwise son, for he should not stay long in the place of the breaking forth of children. the sorrows of a travailing woman shall come upon him…. upon Ephraim, or the ten tribes; that is, afflictions and calamities, which are often compared to the pains and sorrows of a woman in childbirth; see Isaiah 13:8;

— the Targum says, “distress and trouble shall come upon them, as pains on a woman with child.”

14 I will ransom them from the power of the grave; I will redeem them from death. O death, I will be thy plagues! O grave, I will be thy destruction! Repentance shall be hid from Mine eyes.” God’s plan of redemption would be carried out; in the very midst of a proclamation of wrath and punishment, then, we have a most glorious promise of the victory gained through the redemption; as in Ezekiel 37; planned in God’s counsel for mankind established before the foundation of the world.

15 Though he be fruitful among his brethren, an east wind shall come; the wind of the Lord shall come up from the wilderness, and his spring shall become dry, and his fountain shall be dried up; He shall despoil the treasure of all pleasant vessels. — an east wind shall come; the Targum says, “now will I bring against him a king strong as a burning wind;”

Rashi: A king, strong as the east wind, shall come up by the word of the Lord from the way of the desert; he shall plunder: that king shall plunder the treasures of all coveted vessels; (more at the end).

16 Samaria shall become desolate, for she hath rebelled against her God. They shall fall by the sword, their infants shall be dashed in pieces, and their women with child shall be ripped up. — according to these unspeakable cruelties, things which are often done by extreme enemies, cities are sacked and plundered; and which Shalmaneser might have provoked into such extremes by the treachery of the king of Israel, and the city of Samaria holding out a three years’ siege;

— but why does Ephraim deserve all these unspeakable cruelties? Oh wait, perhaps the answer is in the last chapter?

Hosea 14

1 O Israel, return unto the Lord thy God, for thou hast fallen by thine iniquity. — for thou hast fallen by thine iniquity; or “though thou art fallen” into sin, and into ruin, temporal and spiritual; from a state of great prosperity and happiness, both civil and religious, into great calamities; yet return, consider from whence thou art fallen; return, be restored, notwithstanding thy fall, and the low estate in which thou art;

— the Targum says, “return to the fear of the Lord.”

Take with you words, and turn to the Lord; say unto Him, “Take away all iniquity and receive us graciously, so will we offer the calves of our lips. the Targum says, “turn to the worship of the Lord, and say, let it he with thee to forgive sins, and may we be received as good, and the words of our lips be accepted with thee as bullocks for good pleasure upon the altar.”

— Kretzmann; so will we render the calves of our lips, literally, “and we will render as bullocks our lips,” namely, the confession of guilt and the promise to amend our ways.

Assyria shall not save us; we will not ride upon horses, neither will we say any more to the work of our hands, ‘Ye are our gods’; for in Thee the fatherless findeth mercy.”

“I will heal their backsliding, I will love them freely, for Mine anger is turned away from him. — I will heal their backsliding, all the calamities brought upon them by their unfaithfulness to the Lord.

I will be as the dew unto Israel; he shall grow as the lily, and cast forth his roots as Lebanon. the Targum says, “my Word shall be as dew to Israel;”

— he shall grow as the lily; to which the church and people of God are sometimes compared; the Targum says, “they shall shine as the lily.”

His branches shall spread, and his beauty shall be as the olive tree, and his smell as Lebanon. some render “as incense” called “lebonah” in Hebrew, from whence the mountain is thought to have its name, frankincense growing upon it; so the Targum says, “and their smell as the smell of the incense of spices.”

They that dwell under his shadow shall return. They shall revive as the corn and grow as the vine; the scent thereof shall be as the wine of Lebanon. the Targum says, “and they shall be gathered out of the midst of their captivity, they shall dwell under the shadow of their Messiah;”

Ephraim shall say, ‘What have I to do any more with idols?’ I have heard him, and observed him; I am like a green fir tree. From Me is thy fruit found.” — I have heard him; says the Lord; Ephraim bemoaning himself, repenting of his sins, and confessing them; his prayers for pardon and this is what his idols he once served could not do, who had ears, but heard not; but the Lord not only heard, but answered, and granted his request.

— the Targum says, “I by my Word will receive the prayer of Israel, and will have mercy on him:”

Who is wise, and he shall understand these things? Prudent, and he shall know them? For the ways of the Lord are right, and the just shall walk in them; but the transgressors shall fall therein. — who is wise, and who shall understand these things? namely, all that the prophet has written by way of warning, rebuke, admonition, and correction; prudent, and he shall know them? For the ways of the Lord, particularly in the manner in which He deals with His children on earth, are right, and the just shall walk in them, finding their delight in doing the Lord’s will; but the transgressors shall fall therein.

— Rashi: who is wise and will understand these: who among you is wise and will ponder to put his heart to all these and return to Me? And the rebellious shall stumble on them: i.e. because of them, because they did not walk in them.

— and as the Targum says of Ephraim earlier, “return to the fear of the Lord . . . and I will have mercy on him.”

~~~

Wikipedia: an east wind (Hosea 13:15) is a wind that originates in the east and blows in a westward direction; and thus a strong king from the east, from areas of Jordan, Iraq and Iran, Afghanistan and Pakistan, will come.

Second, the descendants of Esau: Edom, Idumea and Mount Seir; where and who are they?

What Happened to the Spanish Armada? | DocumentaryTube
What Happened to the Spanish Armada in 1588?

Unto the men of the East with the Ammonites, and will give them in possession, that the Ammonites may not be remembered among the nations, Ezekiel 25:10 — this prophecy against Ammon and the Ammonites has no promise of restoration.

And finally, Revelation 9: fifth angel; came out of the smoke locusts; to kill only those men who have not the seal of God in their foreheads; breastplates like breastplates of iron; sixth angel: “Loose the four angels who are bound in the great river Euphrates;” to slay a third part of men; the army of horsemen was two hundred thousand thousand; And the sixth angel poured out his vial upon the great river Euphrates; and the water thereof was dried up, that the way of the kings of the east might be prepared, Revelation 16:12.

And finally, the East wind shall come to Ephraim (Hosea 13:15); the context is Ephraim (Hosea 13:12), the United States (Manasseh is UK, Canada, Australia and New Zealand).

The Message Bible prophesies of tornadoes rampaging through the house of Ephraim

13-15 “When birth pangs signaled it was time to be born,
    Ephraim was too stupid to come out of the womb.
When the passage into life opened up,
    he didn’t show.
Shall I intervene and pull them into life?
    Shall I snatch them from a certain death?
Who is afraid of you, Death?
    Who cares about your threats, Tomb?
In the end I’m abolishing regret,
    banishing sorrow,
Even though Ephraim ran wild,
    the black sheep of the family.

15-16 “God’s tornado is on its way,
    roaring out of the desert.
It will devastate the country,
    leaving a trail of ruin and wreckage.
The cities will be gutted,
    dear possessions gone for good.
Now Samaria has to face the charges
    because she has rebelled against her God:
Her people will be killed, babies smashed on the rocks,
    pregnant women ripped open.”

~~~ THE END ~~~

Hosea (Ch 11-12)

•October 11, 2021 • Leave a Comment

The Prophecy of Hosea is primarily to the house of Ephraim (mentions 32 times in Hosea, more than in any other books of the Bible). Often, as Ephraim being the chief tribe of the ten tribes, the name is used in place of Israel (used 41 times) when referring to the northern kingdom.

Hosea 11

1 “When Israel was a child, then I loved him, and called My son out of Egypt. — or, “though Israel was a child”; a weak, helpless, foolish, and imprudent one, “yet I loved him”: or, “when a child”; in the infancy of his civil and church state, when in Egypt;

— and in the wilderness; the Lord loved him, not only as his creature, as he does all the works of his hands, but with a more special love than he loved others; choosing them to be a special people above all others; giving them his law, his statutes, and his judgments.

As they called them, so they went from them; they sacrificed unto the Baalim, and burned incense to graven images.

I taught Ephraim also to go, taking them by their arms; but they knew not that I healed them. — I taught Ephraim also to go…. all the tribes of Israel and Ephraim, or the ten tribes with the rest; these the Lord instructed in the way of his commandments;

— and taught them to walk therein; he his angel before them, to conduct them through the wilderness; yea, he himself went before them in the pillar of cloud by day, and in the pillar of fire by night, to which history this seems to refer;

— so the Targum, “I, by an angel sent by me, led Israel in the right way.”

— and just a recollection; the Targum, whose origin in the Aramaic language, could be traced to the work of Ezra, and hence has prominence in giving us further understanding of biblical concepts which, sometimes, are lost in the Masoretic Text.

I drew them with cords of a man, with bands of love; and I was to them as they that take off the yoke from their jaws, and Ilaid meat before them. — I drew them with cords of a man, as with bands which support the first weak steps of a child, with bands of love, not with chains to hold them captive against their will; 

— and I was to them as they that take off the yoke on their jaws, as when a man slips back the yoke on the neck of a draft animal in order to give it the liberty to eat freely, and I laid meat unto them, gently offering them food for their souls.

“He shall not return into the land of Egypt; but the Assyrian shall be his king, because they refused to return. — the Septuagint: “and Ephraim dwelt in Egypt”; he did so indeed with the other tribes formerly; but here it is said he shall not go thither again to be a captive there, but shall go into bondage more severe than that in Egypt, even into captivity in Assyria.

And the sword shall abide on his cities, and shall consume his branches and devour them, because of their own counsels. — because of their own counsels; which they took and pursued, contrary to the counsel of God, notwithstanding all the admonitions, exhortations and threatenings of God by his prophets;

— or else because of their counsels with the Egyptians, and their covenants with them, for help against the Assyrian, whose yoke they were for casting off, and refused to pay tribute to; which provoked him to draw his sword upon them, which made the havoc it did in their cities, and the inhabitants of them.

And My people are bent on backsliding from Me; though they called them to the Most High, none at all would exalt Him. — the Targum says, “my people divide (or hesitate) to return to my law;”

Rashi paraphrases it, “when the prophets teach them to return to Me, they are in doubt whether to return or not to return; it is with difficulty that they return to Me.”

— none at all would exalt him; the most high God, and give him the praise and glory; but they kept looking to earthly things, particularly to their idols; but were deaf to all counsel and reproof.

“How shall I give thee up, Ephraim? How shall I deliver thee, Israel? How shall I make thee as Admah? How shall I set thee as Zeboiim? Mine heart is turned within Me; My repentings are kindled together.

I will not execute the fierceness of Mine anger, I will not return to destroy Ephraim; for I am God, and not man, the Holy One in the midst of thee; and I will not enter into the city. — I will not return to destroy Ephraim; or “again”, or “any more, destroy” him; not twice; he might be destroyed when carried captive into Assyria; but the remnant that shall spring from him in the latter day shall not be destroyed, but saved.

— the Targum says, “my word shall not return to destroy the house of Israel.”

10 “They shall walk after the Lord; He shall roar like a lion. When He shall roar, then the children shall tremble from the west. — the phrase, “from the west”, or “from the sea”, meaning the Mediterranean sea, which lay west of Judea, and is often used for the west, may signify the western or European part of the world, where the house of Israel for the most part are, and from whence they will be regathered;

— the Targum says,”for he shall roar, and the captives shall be gathered from the west.’

11 They shall tremble as a bird out of Egypt, and as a dove out of the land of Assyria; and I will place them in their houses,” saith the Lord. — they shall tremble as a bird out of Egypt…. they shall come from thence with fear and trembling; which may allude to the trembling of birds at the roaring of a lion, or to the trembling motion of their wings in flying to their own land, under divine influence and direction.

12 Ephraim compasseth me about with lies, and the house of Israel with deceit; but Judah yet ruleth with God, and is faithful with the saints. — chronic liars like Mike Pompeo freely admitted those lies about the CIA: We lied, We cheated, We stole.

Hosea 12

1 Ephraim feedeth on wind, and followeth after the east wind; he daily increaseth lies and desolation; and they make a covenant with the Assyrians, and oil is carried into Egypt. — he daily increaseth lies and desolation; while they multiplied idols, which are lies fallacious and deceitful, and idolatrous rites and acts of worship, they continually persecute, spoil, and plunder those who do not give into their false worship:

— the Targum says, “lies and spoil they multiply;” idolaters are generally persecutors;

— and they do make a covenant with the Assyrians: and gave tribute and presents to their kings, as Menahem did to Pul, and Hoshea to Shalmaneser, to strengthen their kingdom; see 2 Kings 15:19;

— and oil is carried into Egypt: while they sent presents to the Assyrians, to obtain their favour; at another time to the Egyptians; to So king of Egypt; see Isaiah 57:9

— the Targum says, “and they carried gifts to Egypt.”

The Lord hath also a controversy with Judah, and will punish Jacob according to his ways; according to his doings will He recompense him. — and will punish Jacob according to his ways; all the posterity of Jacob, whether Ephraim or Judah; those, “will be visited according to his ways”; if right, or if wrong, a divine visiting used both ways.

He took his brother by the heel in the womb, and by his strength he had power with God. — says the Targum,”prophet, say unto them, was it not said of Jacob, before he was born, that he would be greater than his brother?”

Yea, he had power over the angel and prevailed; he wept, and made supplication unto Him; he found Him in Bethel, and there He spoke with us, — yea, he had power over the angel, who is identified with God, and perhaps the revelation of the Son of God, and made supplication, by stating that he would not let go without having received a blessing.

even the Lord God of hosts; the Lord is his memorial. — the Lord is his memorial: or his name, Yehovah; this “angel” is most probably the Son of God.

Therefore turn thou to thy God; keep mercy and judgment, and wait on thy God continually. — keep mercy and judgment; or, “observe” them to do them; to show mercy to persons in misery, to the poor and indigent, which is what the Lord desires and delights in.

Canaan is a merchant, the balances of deceit are in his hand; he loveth to oppress.

And Ephraim said, “Yet I am become rich, I have found myself substance; in all my labors they shall find no iniquity in me that were sin.” — here again Ephraim, or the people of Israel, vainly ascribe all their wealth and riches to their own labour, diligence, and industry, and take no notice of God and his providence, or of his blessing upon them; and pretend to be very upright and honest in their dealings.

“And I that am the Lord thy God from the land of Egypt will yet make thee to dwell in tabernacles, as in the days of the solemn feast. — and I that am the Lord, thy God, from the land of Egypt, where He first revealed the greatness toward Israel; will yet make thee to dwell in tabernacles as in the days of the solemn feast; which brought to the attention of the Israelites the blessings with which the Lord so richly supplied them in the Land of Promise.

10 I have also spoken by the prophets, and I have multiplied visions, and used similitudes (parallelism, analogy) by the ministry of the prophets.” — used by the prophet Hosea, taking a wife and children of whoredoms, and Ezekiel being bound 390 days for the iniquity of Israel and 40 days for Judah (Ezekiel 4).

11 Is there iniquity in Gilead? Surely they are vanity. They sacrifice bullocks in Gilgal; yea, their altars are as heaps in the furrows of the fields. — the Targum says,”they have multiplied their altars, like heaps upon the borders of the fields.”

12 And Jacob fled into the country of Syria, and Israel served for a wife, and for a wife he kept sheep. — and Israel served for a wife, and for a wife he kept sheep;

— and so the last clause is supplied by the Targum: this was after his flight into Syria, and before he fled from Laban, whom he served seven years for Rachel; and seven years more for the same.

13 And by a prophet the Lord brought Israel out of Egypt, and by a prophet was he preserved. — a prophet; Moses is here referred to, and perhaps, a hint that the Lord would yet again save Israel from worse than Egyptian bondage by the words and warnings of a prophet.

14 Ephraim provoked Him to anger most bitterly; therefore shall He leave his blood upon him, and his reproach shall his Lord return unto him. — it was God that Ephraim or the ten tribes provoked to stir up his wrath against them; but this rift in the clouds is closing again, and another severe rebuke will sure follows.

Hosea (Ch 9-10)

•October 10, 2021 • Leave a Comment

Chapter 9 starts with “rejoice not” Ephraim returning to Egypt and eating unclean food in Assyria, both places where O Israel have been in captivity.

Hosea 9

1 Rejoice not for joy, O Israel, as other people, for thou hast gone a whoring from thy God; thou hast loved for reward upon every threshing floor. — for thou hast gone a whoring; playing the harlot with many nations; committing adultery; worshipping idols, making feasts before them, and dancing about them; and so departing from God; the Targum says it this way: “for you have erred from the worship of your God; you have loved to serve idols on all, corn floors.”

The floor and the wine press shall not feed them, and the new wine shall fail in her.

They shall not dwell in the Lord’S land; but Ephraim shall return to Egypt, and they shall eat unclean things in Assyria. — Ephraim returning to Egypt and eating unclean food in Assyria, both places where O Israel have been in captivity; the indication of this word “shall” used three time above is prophetic; back into captivity, “Egypt,” for 190 years.

They shall not offer wine offerings to the Lord, neither shall they be pleasing unto Him; their sacrifices shall be unto them as the bread of mourners. All that eat thereof shall be polluted, for their bread for their soul shall not come into the house of the Lord. — they have gone too deep into idolatress that any sacrifices would be viewed as the bread of mourners; and, instead of being acceptable to God, were abominable to him; and all that partook them should consider them as funeral feasts; God’s feasts are always joyous.

What will ye do in the solemn day, and in the day of the feast of the Lord?

For lo, they are gone because of destruction. Egypt shall gather them up; Memphis shall bury them. Nettles shall possess the pleasant places for their silver; thorns shall be in their tabernacles.

The days of visitation have come, the days of recompense have come; Israel shall know it. The prophet is a fool; the man of the spirit is mad because of the multitude of thine iniquity and great hatred. — the prophet is a fool; so Israel said, before those days came, of a true prophet of the Lord, that he was a fool for prophesying of evil things, but now they shall find it otherwise. So the Targum says: “they of the house of Israel shall (note the subtle change of present ‘is’ to future tense ‘shall’) know that they who had prophesied to them were true prophets;” but rather this is to be understood of false prophets, who, when the day of God’s visitation shall come on Israel in a way of wrath and vengeance, will appear both to themselves and others to be fools, for prophesying good things to them, when evil was at hand.

The watchman of Ephraim was with my God; but the prophet is a snare of a fowler in all his ways, and hatred in the house of his God. — the watchman of Ephraim was with my God…. formerly the watchmen of Ephraim, were with the true God, as Elijah and Elisha, had revelations and instructions from him; and were under the inspiration of his Spirit, and prophesied in his name things according to his will;

— but now the prophet is a snare of a fowler in all his ways; the false prophet, instead of guiding and directing Ephraim in the right way in which he should go, lays snares for him in all the ways he takes, to lead him wrong, and draw him into sin, particularly into false doctrines and false prophecies;

— and after everything is over, these prophets become detestable in the house of God.

They have deeply corrupted themselves, as in the days of Gibeah. Therefore He will remember their iniquity; He will visit their sins.

10 “I found Israel like grapes in the wilderness; I saw your fathers as the first ripe of the fig tree at her first season. But they went to Baalpeor, and separated themselves unto that shame, and their abominations were according as they loved.

11 As for Ephraim, their glory shall fly away like a bird from the birth, and from the womb, and from the conception.

12 Though they bring up their children, yet will I bereave them, that there shall not be a man left; yea, woe also to them when I depart from them!

13 Ephraim, as I saw Tyre, is planted in a pleasant place; but Ephraim shall bring forth his children to the murderer.” — the Septuagint renders: “Ephraim, even as I saw, gave their children for a prey; yea, Ephraim was ready to bring out his children to slaughter;”

— the reference to Tyre is less obscure; and read it as: “I look on Ephraim even as I look on Tyre, planted in a secure resting-place.” The impregnable fortress of Tyre was a conspicuous object in the days of Hosea; so as in today’s Ephraim; the United States has seven fleets plowing up and down the five oceans effortlessly without any challenge.

14 Give them, O Lord — what wilt Thou give? Give them a miscarrying womb and dry breasts. — give them, O Lord; what wilt Thou give? the question interrupting the flow of thought showing the deep indignation of the prophet over the willful corruption of His people. Give them a miscarrying womb and dry breasts, sterility being considered a disgrace and a reproach, one of the sternest punishments of the Lord.

15 “All their wickedness is in Gilgal, for there I hated them; for the wickedness of their doings I will drive them out of Mine house. I will love them no more; all their princes are revolters.

16 Ephraim is smitten, their root is dried up, they shall bear no fruit; yea, though they bring forth, yet will I slay even the beloved fruit of their womb.” — Ephraim is smitten, like a plant struck by the too direct rays of the sun, their root is dried up, they shall bear no fruit; yea, though they bring forth, yet will I slay even the beloved fruit of their womb, by permitting their children to be killed.

17 My God will cast them away, because they did not hearken unto Him; and they shall be wanderers among the nations. — and they shall be wanderers among the nations: exiles, fugitives, and vagabonds. Cf Deuteronomy 28:65.

Hosea 10

Israel is an empty vine; he bringeth forth fruit unto himself. According to the multitude of his fruit he hath increased the altars; according to the goodness of his land they have made goodly images. — Israel is an empty vine…. the people of Israel are often compared to a vine, and such an one from whence fruit might be expected, sometimes planted in good soil, other times in poor soil;

— the Targum renders it, “a spoiled vine;” spoiled by their enemies, who robbed them of their wealth and riches, and trampled them under foot;

— the Septuagint version understand it in a sense quite the reverse, rendering it, “a flourishing vine”; putting forth branches, leaves, and fruit.

Their heart is divided; now shall they be found faulty. He shall break down their altars; He shall despoil their images. — their heart is divided; as the Targum says; their hearts were divided between God and their idols; as in Ahab’s time between God and Baal; they pretended to worship God when they worshipped the calves, as if they had done that which was right and good, and were guilty of no evil.

For now they shall say, “We have no king, because we feared not the Lord. What then should a king do to us?” — for now they shall say, we have no king…. this they would say, as if they had no king; they had none to protect and defend them, to sally out at the head of them against the enemy, and fight their battles for them; or rather when the city was taken.

They have spoken words, swearing falsely in making a covenant; thus judgment springeth up as hemlock in the furrows of the field. — judgments, divine judgement shall prevail not as a blessing, but as a curse; not as a precious harvest, but as a poisonous plant.

The inhabitants of Samaria shall fear because of the calves of Bethaven; for the people thereof shall mourn over it, and the priests thereof who rejoiced on it for the glory thereof, because glory has departed from it. — for the people thereof shall mourn over it; either the people of Samaria, the same with the inhabitants of it; who would mourn over their loss, being taken away from their land, and disposed of as in the next verse.

It shall be also carried unto Assyria for a present to King Jareb. Ephraim shall receive shame, and Israel shall be ashamed of his own counsel. — and Israel shall be ashamed of his own counsel; of giving in to such idolatry, contrary to the counsel, mind and will of God; or of the counsel which they and Jeroboam took to set up the calves at Dan and Bethel, and thereby to keep the people from going up to Jerusalem.

As for Samaria, her king is cut off as the foam upon the water.

The high places also of Aven, the sin of Israel, shall be destroyed. The thorn and the thistle shall come up on their altars; and they shall say to the mountains, “Cover us!” and to the hills, “Fall on us!” — shall say to the mountains, Cover us! and to the hills, Fall on us! That is the cry of the unbelievers, mockers, when they see the judgment approaching them, when it is too late for salvation. Cf Isaiah 2:19Luke 23:30.

“O Israel, thou hast sinned from the days of Gibeah. There they stood. The battle in Gibeah against the children of iniquity did not overtake them.

10 It is in My desire that I should chastise them, and the people shall be gathered against them when they shall bind themselves in their two furrows.

11 And Ephraim is as a heifer that is taught and loveth to tread out the corn, but I passed over upon her fair neck. I will make Ephraim to ride, Judah shall plow, and Jacob shall break his clods.” — and Ephraim is as an heifer that is taught, and loveth to tread out the corn…. like a heifer taught to bear the yoke, and to plough; but learned it not,

— as the Targum; does not like it; chooses to tread out the corn where it can feed upon it, its mouth not being then muzzled, according to the law; oxen or heifers were used both in ploughing and treading out corn, to which the allusion is.

12 Sow to yourselves in righteousness, reap in mercy, break up your fallow ground; for it is time to seek the Lord, till He come and rain righteousness upon you.

13 Ye have plowed wickedness, ye have reaped iniquity, ye have eaten the fruit of lies, because thou didst trust in thy way, in the multitude of thy mighty men. — Rashi: you have eaten fruit of lies: You have received the retribution for your deeds; as a sweet morsel though bread of deceit; which could not profit them, nor yield them in the issue the pleasure it promised them, and they hoped for from it.

14 Therefore shall a tumult arise among thy people, and all thy fortresses shall be despoiled, as Shalman despoiled Betharbel in the day of battle: the mother was dashed in pieces upon her children. — in the day of battle; the mother was dashed in pieces upon her children, in an excess of unnatural cruelty.

15 So shall Bethel do unto you because of your great wickedness; in a morning shall the king of Israel be utterly cut off. — in a morning shall the king of Israel be utterly cut off; meaning Hoshea, Hosea, or Osee, the last king of Israel, and the kingdom entirely destroyed; so that afterwards there was no more king in Israel.

Hosea (Ch 7-8)

•October 9, 2021 • Leave a Comment

Right at the start of verse 1, the message is directed at the “iniquity of Ephraim” and the “wickedness of Samaria.” Ephraim is referred collectively as leader of the northern ten tribes; and elsewhere Ephraim and Manasseh has been established as the United States and the United Kingdom. 

And eventually Ephraim will be caught in a snare: “My net also will I spread upon him, and he shall be taken in My [not China’s nor Russia’s] snare; and I will bring him to Babylon to the land of the Chaldeans; yet shall he not see it, though he shall die there,” Ezekiel 12:13.

Hosea 7

1 “When I would have healed Israel, then the iniquity of Ephraim was uncovered, and the wickedness of Samaria. For they commit falsehood; and the thief cometh in, and the troop of robbers despoileth without. — when I would have healed Israel; this is hypothetical and prophetic; when the Lord attempted to remove their corruption, then the iniquity of Ephraim was discovered, it became known openly;

— troop of robbers despoileth without; by a gang of robbers in the streets, or on the highway: so the Targum says: “in the night they thieve in houses, and in the day they rob on the plain.”

And they consider not in their hearts that I remember all their wickedness. Now their own doings have beset them about; they are before My face. — they are before my face; so the Targum says, “which are revealed before me;” manifesting “all their wickedness” in God’s sight, but this they did not know, and therefore they went on in their bold and daring manner as they did. 

They make the king glad with their wickedness, and the princes with their lies. — Prince Mike Pompeo freely admitted those lies about the CIA: We lied, We cheated, We stole

— but what about the kings?

They are all adulterers, as an oven heated by the baker, who ceaseth from raising after he hath kneaded the dough, until it be leavened. — they are all adulterers…. kings, princes, priests, and people, both in a spiritual and corporeal sense; they were all idolaters, given to idols try, eager of it, and constant in it, as the following metaphors show; and they were addicted to corporeal adultery; this was a prevailing vice among all ranks and degrees of men;

— the Targum says, “they all desire to lie with their neighbours’ wives;” Jeremiah 5:7.

In the day of our king, the princes have made him sick with bottles of wine; he stretched out his hand with scorners. — the princes have made him sick with bottles of wine: that is, the courtiers, the swarms of Washington DC, who attended at court on such a day to compliment their king upon his inauguration, or his birthday, to drink to his health in large glasses from big bottles of good wine; making him sick or drunk;

— after becoming drunk, he stretched out his hand with scorners; denying there was a God, or spoke very indecently and irreverently of him.

For they have made ready their heart like an oven, while they lie in wait; their baker sleepeth all the night; in the morning it burneth as a flaming fire. — for they have made ready their heart like an oven, whiles they lie in wait…. their king, prince and scorners before mentioned, being heated with wine and their lust enraged, were ready for any chance of adultery, lying in wait for young interns to appear to debauch them;

— or for rebellion and treason against their king, and even the murder of him, made drunk by them, whom they now despised, and waited for an opportunity to dispatch him.

They are all hot as an oven, and have devoured their judges; all their kings are fallen; there is none among them that calleth unto Me. — and have devoured their judges; that stood in the way of making impartial judgments, but instead, subject themselves to politics;

— and there is none among these kings or judges that calleth upon biblical principles.

“Ephraim, he hath mixed himself among the people; Ephraim is a cake not turned. — Ephraim is a cake not turned, like a pancake burned on the lower side, while the upper side is not yet done. The entire cake is then not fit for eating.

Strangers have devoured his strength, and he knoweth it not; yea, gray hairs are here and there upon him, yet he knoweth not. — signs of senility are upon him; yet he knoweth not, being blind to all evidences of the inevitable end.

10 And the pride of Israel testifieth to his face; and they do not return to the Lord their God, nor seek Him for all this.

11 “Ephraim also is like a silly dove without heart; they call to Egypt, they go to Assyria. — silly dove; birds were captured with nets spread on the ground, in traps and snares; in this powerful metaphor, no creature is less able to defend itself than the dove, which flies from the bird of prey to the net of the fowler.

12 When they shall go, I will spread My net upon them; I will bring them down as the fowls of the heaven; I will chastise them, as their congregation hath heard. — I will chastise them, as their congregation hath heard; what was written in the law, and in the prophets, if they did not observe the laws and statutes of the Lord their God, but neglected and broke them, see Leviticus 26:1,14-39.

13 Woe unto them, for they have fled from Me! Destruction unto them, because they have transgressed against Me! Though I have redeemed them, yet they have spoken lies against Me. — yet they have spoken lies against me; against his being and providence, or pretending repentance for their sins, when they were hypocrites, or setting up idols in opposition to him.

14 And they have not cried unto Me with their heart, when they howled upon their beds; they assemble themselves for corn and wine, and they rebel against Me. — when they howled upon their beds; lying sick or wounded there; or, as some, in their idol temples, those beds of adultery, where they pretended to worship God by them, and to pray to him through them; but such idolatrous prayers were no better than the howlings of clogs to him.

15 Though I have bound and strengthened their arms, yet do they contrive evil against Me.

16 They return, but not to the Most High; they are like a deceitful bow. Their princes shall fall by the sword for the rage of their tongue; this shall be their derision in the land of Egypt. — like a deceitful bow; religious observance has the appearance of a bow with the arrow on the string, apparently aimed at some object, but the string being slack, the aim is diverted.

Hosea 8

1 “Set the trumpet to thy mouth! He shall come as an eagle against the house of the Lord, because they have transgressed My covenant, and trespassed against My law. — “Set the trumpet to thy mouth,” as the Targum, “O prophet, cry with thy throat as with a trumpet, saying;” called upon to blow his trumpet bidding them a warning concerning the approach of judgment.

Israel shall cry unto Me, ‘My God, we know Thee!’ — “they shall cry unto me”; these transgressors of the covenant and the law, these hypocrites, shall pray to God in trouble, saying, “my God, we Israel”, or Israelites, “know thee”; and to this sense is the Targum,”in every time that distress comes upon them, they pray before me, and say, now we know that we have no God besides thee; redeem us, for we are thy people Israel.”

Israel hath cast off the thing that is good; the enemy shall pursue him.

They have set up kings, but not by Me; they have made princes, and I knew it not. Of their silver and their gold have they made them idols, that they may be cut off. — they have set up kings, but not by me…. Not by his authority, order, and command; not by asking advice of him, but of themselves: starting with the case of Jeroboam their first king, though the establishment of the Ten Tribes received Divine sanction initially.

“Thy calf, O Samaria, hath cast thee off; Mine anger is kindled against them. How long will it be ere they attain to innocency? — thy calf, O Samaria, hath cast thee off…. or, is the cause of thy being cast off by the Lord, and of being cast out of thine own land, and carried captive into another; the past tense is used for the future, as is common in prophetic writings.

For from Israel was it also: the workman made it, therefore it is not God; but the calf of Samaria shall be broken in pieces. — but the calf of Samaria shall be broken to pieces; or “for the calf of Samaria”, being another reason to prove it could not be God; this surely be when they should see it broke to pieces by the enemy, from whom it could not save itself.

For they have sown the wind, and they shall reap the whirlwind. It hath no stalk; the bud shall yield no meal. If so it shall yield, the strangers shall swallow it up. — for their idolatry, and continuance in it, the whirlwind of God’s wrath would be raised up against them, and another “Assyrian army” like a storm of wind would rush in and destroy them; so they that sow, shall reap;

— if so it shall yield, the strangers shall swallow it up; the Targum says, “if they got substance, the nations shall spoil them of it.”

“Israel is swallowed up; now shall they be among the nations as a vessel wherein is no pleasure. — when Shalmaneser took Samaria, he carried them as captives and placed them among the nations in the cities of the Medes, 2 Kings 17:6; where they lived poor, mean, and abject, and were treated with the utmost neglect and contempt; not better than a broken vessel.

For they are gone up to Assyria, a wild ass alone by himself; Ephraim hath hired lovers. — As head of Nato, the United States had incorporated many Central and Eastern European countries as “allies and confederates, patrons and defenders” right up to the Russian bounder into her alliance, and is trying to extend this alliance into the Asia-Pacific, but eventually she will be caught in a snare: “My net also will I spread upon him, and he shall be taken in My [not China’s nor Russia’s] snare; and I will bring him to Babylon to the land of the Chaldeans; yet shall he not see it, though he shall die there” Ezekiel 12:13; and shall dwell in captivity like a wild ass.

10 Yea, though they have hired among the nations, now will I gather them, and they shall sorrow a little for the burden of the king of princes. — as the Targum says, “but of the gathering of them together for their destruction.”

11 “Because Ephraim hath made many altars to sin, altars shall be unto him to sin. — because Ephraim hath made many altars to sin, in practicing idolatry to such an exceptional degree, in the sight of God.

12 I have written to him the great things of My law, but they were counted as a strange thing. — I have written to him the great things of My Law, literally, I presented to him a myriad of My Law; the many precepts by which the Israelites might fulfill His will; but they were counted as a strange thing; as though they did not concern them, dismissing them as ceremonial laws.

13 They sacrifice flesh for the sacrifices of Mine offerings, and eat it; but the Lord accepteth them not. Now will He remember their iniquity and visit their sins; they shall return to Egypt. — they shall return to Egypt, once more be delivered into captivity, where they lived miserably for 210 years in bondage; but another one coming, cut short to 190 years.

14 For Israel hath forgotten his Maker, and buildeth temples; and Judah hath multiplied fortified cities. But I will send a fire upon his cities, and it shall devour the palaces thereof.” — but I will send a fire upon his cities, and it shall devour the palaces thereof; that is, from “an enemy” that will set fire to their national icons, particularly New York, Paris, London, Jerusalem, their chief cities, and palaces of their king and nobles, and all the fine houses of their great men; as were done in the past by Shalmaneser the king of the Assyria; and 135 years later, Nebuchadnezzar king of Babylon, Jeremiah 52:13.

Hosea (Ch 5-6)

•October 8, 2021 • Leave a Comment

The Prophecy of Hosea is primarily to the house of Ephraim. Being the chief tribe of the ten tribes, often Ephraim is used in place of Israel when it is referring to northern ten tribes. Elsewhere on this site Ephraim has been established as the United States. So although Hosea may refer to situation in his time, the encoded message of Ephraim and Israel is specially meant primarily for the United States and secondarily its European allies.

Hosea 5

1 “Hear ye this, O priests! And hearken, ye house of Israel! And give ye ear, O house of the king! For judgement is against you, because ye have been a snare on Mizpah, and a net spread upon Tabor. — Hear ye this, O priests, the spiritual leaders of the people; and hearken, ye house of Israel, the family of the ten tribes as such; and give ye ear, in paying most careful attention, O house of the king, as the temporal rulers of the nation; for judgment is against you, it is intended all of them, to strike them down in due time.

And the revolters are deep in slaughter, though I have been a rebuker of them all.

I know Ephraim, and Israel is not hid from Me; for now, O Ephraim, thou committest whoredom, and Israel is defiled. — I know Ephraim, and Israel is not hid from me…. though Ephraim may cover their designs from other nations, and seek deep to hide their counsel from them, and make plausible pretenses for what they do, and put on an appearance of good democracy; yet God, who knows Ephraim and their hearts cannot be deceived.

“They will not frame their doings to turn unto their God; for the spirit of whoredoms is in the midst of them, and they have not known the Lord.

And the pride of Israel doth testify to his face; therefore shall Israel and Ephraim fall in their iniquity; Judah also shall fall with them. — the way this verse is phrased, it seems like Ephraim will fall first, then Judah will fall also; which is true with historical records: Judah also fell into idolatry, and were guilty of the same crimes as Israel, so should be involved in the same punishment, though not at the same time; for the Babylonish captivity, in which Judah was carried captive, was many years after Israel was carried captives by the Assyrians; which were about 135-150 years before Judah.

They shall go with their flocks and with their herds to seek the Lord, but they shall not find Him; He hath withdrawn Himself from them.

They have dealt treacherously against the Lord, for they have begotten strange children. Now shall a month devour them with their portions.

“Blow ye the cornet in Gibeah, and the trumpet in Ramah! Cry aloud at Bethaven! After thee, O Benjamin! — according to the Targum, the words are directed to the prophets, “O ye prophets, lift up your voice like a trumpet” to declare to the house of Israel their sins and transgressions, and the punishment that would be inflicted on them for them; or it may be, this is a call of the people to fasting, mounting, and lamentation, as in Joel 2:1.

Ephraim shall be desolate in the day of rebuke; among the tribes of Israel have I made known that which shall surely be. — the country of the ten tribes shall be laid desolate, the inhabitants of them destroyed either by the sword, or famine, or pestilence, and the rest carried captives, as they were by Shalmaneser; and again in the “days afar off” – our time, of the Lord’s rebuke and chastisement.

10 The princes of Judah were like them that remove the landmarks; therefore I will pour out My wrath upon them like water. — Judah will also go down, following Ephraim, as history recorded them.

11 Ephraim is oppressed and broken in judgment, because he willingly walked after the commandment. — as the Targum says; by the tyranny of their kings, and the injustice of their judges, who looked only for the mammon of unrighteousness.

12 Therefore will I be unto Ephraim as a moth, and to the house of Judah as rottenness. — will I be unto Ephraim as a moth…. which eats garments, penetrates into them, feeds on them quietly, secretly, and gradually consumes them; but at last utterly, they are just of no use left. 

13 “When Ephraim saw his sickness, and Judah saw his wound, then went Ephraim to the Assyrian, and sent to King Jareb. Yet could he not heal you, nor cure you of your wound. — then went Ephraim to the Assyrian, looking for assistance from the heathens instead of consulting the Lord; again, Ephraim is recorded first, Judah following behind in going down; its significance could be prophetic.

14 For I will be unto Ephraim as a lion, and as a young lion to the house of Judah; I, even I, will tear and go away; I will take away, and none shall rescue him. — I, even I, will tear and go away, as a lion withdrawing to his den; I will take away, and none shall rescue him, for with the Lord’s merciful presence removed, there is no hope of deliverance.

15 I will go and return to My place, till they acknowledge their offense and seek My face; in their affliction they will seek Me early.” — this is flashing forward, as if it is a Second Coming, where redemption becomes available again, but the house of Israel will have to go into captivity; for a period of 190 years? On reflection they were in Egypt for about 210 years, so cheers; this coming captivity is 20 years shorter.

— and those who consistently break the Law of Moses (Leviticus 26Deuteronomy 28) in their Judgement shall be more than horsewhipped! They would suffer by the sword, by famine, by pestilence and spending years in captivity to reflect; that is “till they acknowledge their offense and seek My face;” and repent (for more see Ezekiel 4 – 390/40 Years and A Sword from the South!)

Hosea 6

There is a great gap in time in between from their detestable filthy and abominable stage in chapter 5 to one where the house of Israel would be ready to accept God’s new spirits, statues and judgments in chapter 6 below; in fact in the book of Ezekiel, it flashes from chapter 2 to chapter 37.

1 Come, and let us return unto the Lord; for He hath torn, and He will heal us; He hath smitten, and He will bind us up. — it’s very prophetic, rather historical as Rashi comments; he smites, and He will bind us up: Heb. It is a present tense. He smites us, and He will bind us up.

After two days will He revive us; on the third day He will raise us up, and we shall live in His sight. — as a thousand years is to God a single day (II Peter 3:8), rising on the third day is to God rising on the third millennium; from around 740 BC when the Assyrians began taking those three tribes east of the Jordan:

And the God of Israel stirred up the spirit of Pul king of Assyria, and the spirit of Tilgathpilneser king of Assyria, and he carried them away, even the Reubenites, and the Gadites, and the halftribe of Manasseh, and brought them unto Halah, and Habor, and Hara, and to the River Gozan unto this day, I Chronicles 5:26.

Flashing forward into the third millennium will bring the scene to our time, when the house of Israel will be revived; the United States gained independence on July 4, 1776 and grew into a great united nation; but toward the end, preceded by 190 years of captivity for the house of Israel and 40 years for the house of Judah (Ezekiel 4).

Then shall we know, if we follow on to know the Lord; His going forth is prepared as the morning; and He shall come unto us as the rain, as the latter and former rain unto the earth.

“O Ephraim, what shall I do unto thee? O Judah, what shall I do unto thee? For your goodness is as a morning cloud, and as the early dew it goeth away. — O Ephraim, what shall I do unto thee? O Judah, what shall I do unto thee?…. or, the Lord having observed the effect and consequence of of his leaving his people for a long time under afflictions and in distress; namely, their thorough conversion to him in the latter day; until the third day, until the third millennium.

Therefore have I hewn them by the prophets; I have slain them by the words of My mouth; and thy judgments are as the light that goeth forth. — Rashi: Because I have hewed by the prophets: Heb. עַל-כֵּן. Because I hewed My words upon them through the prophets, but they did not take heed, therefore…

— the Targum says it clearer:,“because I admonished them by the message of my prophets, and they returned not, I will bring upon them those that slay, because they have transgressed the word of my will.”

For I desired mercy, and not sacrifice; and the knowledge of God more than burnt offerings. — a parallel verse in I Samuel 15:22 says “And Samuel said, “Hath the Lord as great delight in burnt offerings and sacrifices as in obeying the voice of the Lord? Behold, to obey is better than sacrifice, and to hearken than the fat of rams.”

— and the knowledge of God more than burnt offerings; which were reckoned the greatest and most excellent sacrifices; but knowledge of God is preferred to them; not just knowing the laws of Moses as a lawgiver, judge, and consuming fire, but how to execute them justly and at times where situations require, mercifully;

— to have a form and shell of godliness, but to deny its substance, is the essence of hypocrisy.

But they like Adam have transgressed the covenant; there have they dealt treacherously against Me. — in the covenant they entered into, and then breaking it by offering sacrifices to idols, under a pretense of offering them to God, was dealing treacherously against him.

Gilead is a city of them that work iniquity, and is polluted with blood.

And as troops of robbers wait for a man, so the company of priests murder on the way by consent; for they commit lewdness.

10 I have seen a horrible thing in the house of Israel; there is the whoredom of Ephraim, Israel is defiled. — I have seen an horrible thing in the house of Israel…. idolatry, starting with the calves set up at Dan and Bethel, which God saw with abhorrence and detestation.

11 Also, O Judah, he hath set a harvest for thee, when I returned My people from captivity.

— Israel is always mentioned first, followed by Judah, who didn’t have the wisdom to take the warning seriously, hence they, too, will go into captivity after Israel has gone into captivity for 150 years. Another 40 years to add towards 190 years in total (Ezekiel 4).

Ephraim and Manasseh

•October 7, 2021 • 2 Comments

Who is Ephraim and who is Manasseh

The Ox / Bull / Bullock

More on the Ox and the Unicorn:

Let the blessing come upon the head of Joseph, and upon the top of the head of him that was separated from his brethren. His glory is like the firstling of his ox (bullock), and his horns are like the horns of unicorns. With them he shall push the people together to the ends of the earth; and they are the ten thousands of Ephraim, and they are the thousands of Manasseh,” Deuteronomy 33:16-17.

In the above verse, the Ox and Ephraim are named first, the firstborn of his (Joseph’s) “bullock is his glory”: the reference being to Ephraim; followed by Unicorn and Manasseh.

Saolas or Asian Unicorn in the remote Mountains of Laos and Vietnam

Although Manasseh was the firstborn, Joseph the father crossed his hands and placed Ephraim as firstborn, hence Ephraim, often known as the thirteenth tribe, represents not just the house of Joseph, but more often the house of the 10-tribes Northern Kingdom.

Greater coat of arms of the United States.svg
Great Seal of the United States – thirteen Stars, thirteen Arrows, thirteen Leaves and thirteen Olives – the thirteenth tribe
A Unicorn in the Royal Coat of Arms of the United Kingdom

In Rabbinic teachings: the myriads (ten thousands) slain by Joshua, of the tribe of Ephraim: These are the myriads descended from Ephraim;

— and the thousands of Manasseh: these are the thousands slain by Gideon, who was of the tribe of Manasseh. These are the thousands descended from Manasseh.

In his blessings Jacob ascribes to Ephraim ten thousands, and to Manasseh only thousands; thus foreshowing, that Ephraim the younger was to be the more numerous of the two, as Jacob had before prophesied of them.

Hosea (Ch 3-4)

•October 6, 2021 • Leave a Comment

Chapter 3 starts with a parable expressing the love of God to Israel, but their ingratitude to him; have much reflection again upon the house of Ephraim, often flashing forward when they repent or back as as the state of Ephraim now, and concludes with a prophecy of their conversion to God in the latter days.

Hosea 3

1 Then said the Lord unto me, “Go yet, love a woman beloved of her friend yet an adulteress, according to the love of the Lord toward the children of Israel, who look to other gods and love flagons of wine.” — then said the Lord unto me…. or, as the Targum says, “the Lord said unto me again”; for the Hebrew expression shows that this is a new vision, prophecy or parable.

So I bought her for myself for fifteen pieces of silver, and for a homer of barley and a half homer of barley. — fifteen pieces of silver; an indication she’s made herself very cheap, for a slave would normally be sold for twice the number of silvers.

And I said unto her, “Thou shalt abide for me many days. Thou shalt not play the harlot, and thou shalt not be for another man. So will I also be for thee.”

For the children of Israel shall abide many days without a king, and without a prince, and without a sacrifice, and without an image, and without an ephod, and without teraphim. — for the children of Israel shall abide many days without a king, and without a prince…. without any king or prince as the ten tribes were from their captivity by Shalmaneser; but moe importantly as seen from God’s point of view, no man of character of the likes of David, Hezekiah or Josiah.

Afterward shall the children of Israel return, and seek the Lord their God and David their king, and shall fear the Lord and His goodness in the latter days. — after almost three thousand years, “in the latter days,” the house of Israel will end their abandonment and captivity with the appearance of “My servant David” in the “valley full of dry bones” scenario (Ezekiel 37) where they will dwell securely.

Hosea 4

1 Hear the word of the Lord, ye children of Israel; for the Lord hath a controversy with the inhabitants of the land, because there is no truth nor mercy nor knowledge of God in the land. — “there is no truth;” which is extremely true; a majority (99.99%) of professing “Christians” didn’t know the simplest of what constitutes the Oracles of God; and here.

“By swearing and lying, and killing and stealing and committing adultery, they break out, and blood toucheth blood. — by swearing, and lying…. false swearing, as the Targum interprets it; for it not only takes in all cursing and imprecations, profane oaths, and taking the name of God in vain. And eager to be engaged in crimes of the worst kind, and blood toucheth blood, one act of bloodshed following another.

Therefore shall the land mourn, and every one that dwelleth therein shall languish with the beasts of the field and with the fowls of heaven; yea, the fishes of the sea also shall be taken away.

Yet let no man strive with, nor reprove another; for this people are as they that strive with the priest. — yet let no man strive nor reprove another, that is, conditions being so bad as they are, all attempts to change the corruption would be vain.

Therefore shalt thou fall in the day, and the prophet also shall fall with thee in the night; and I will destroy thy mother. — and I will destroy thy mother; the northern Israelites; so that their nation and name should perish together. Is it not so with the ten tribes? who can tell at this day where to find them or whence to expect them?

My people are destroyed for lack of knowledge. Because thou hast rejected knowledge, I will also reject thee, that thou shalt be no priest to Me. Seeing thou hast forgotten the law of thy God, I will also forget thy children. — again, the Oracles of God are inferred here. To God, these lacks of knowledge are serious stuff! Hence numerous repeats and reminders; repeats and reminders.

“As they were increased, so they sinned against Me; therefore will I change their glory into shame. — therefore will I change their glory into shame, so that their greatness and prosperity would become a mockery in the eyes of the nations.

They eat up the sin of My people, and they set their heart on their iniquity. — they eat up the sin of my people…. that is, pastors and ministers today, as they eat up their sacrifices, in tithes and offerings, which the people brought for their sins: but they have no concern to instruct the people in the right way; all that they regarded are good eating and drinking, and living voluptuously; and careless about instructing the people in the nature of sacrifices, and of their duty.

And it shall be: like people, like priest; and I will punish them for their ways, and reward them their doings.

Two parallel verses reveal more details in Ezekiel:

2 “Son of man, prophesy against the shepherds of Israel, prophesy and say unto them, ‘Thus saith the Lord God unto the shepherds: Woe be to the shepherds of Israel that feed themselves! Should not the shepherds feed the flocks?

3 Ye eat the fat, and ye clothe yourselves with the wool, ye kill the ones that are fed; but ye feed not the flock. Ezekiel 34:2-3 — but ye feed not the flock; did not govern the people well by doing justice and judgment among men, as became civil magistrates; did not deliver out words of faith and sound teachings, to feed the minds of men with, which is the duty of those that preside in the church of God.

10 For they shall eat and not have enough; they shall commit whoredom and shall not increase, because they have left off taking heed of the Lord.

11 “Whoredom and wine and new wine take away the heart. — once a man turns to prostitutes and intoxicating drink for pleasure, he loses his judgment. Harlots and wine take away a man’s mind.

12 My people ask counsel from their stocks, and their staff declareth unto them; for the spirit of whoredoms hath caused them to err, and they have gone a whoring from their God.

13 They sacrifice upon the tops of the mountains, and burn incense upon the hills under oaks and poplars and elms, because the shadow thereof is good; therefore your daughters shall commit whoredom, and your spouses shall commit adultery.

14 I will not punish your daughters when they commit whoredom, nor your spouses when they commit adultery; for the men themselves consort with whores, and they sacrifice with harlots: Therefore the people that doth not understand shall fall. — I will not punish your daughters when they commit whoredoms, nor your spouses when they commit adultery…. the words are rendered interrogatively, “shall I not punish your daughters?” Verily I will; and not them only, but their parents and husbands too, who deserve more severe corrections.

15 “Though thou, Israel, play the harlot, yet let not Judah offend; and come not ye unto Gilgal, neither go ye up to Bethaven, nor swear, ‘The Lord liveth.’ — though the Ephraimites or people of the other ten tribes committed adultery, both corporeal and spiritual, in their idolatrous worship, let Judah be warned of the same crimes.

16 For Israel slideth back as a backsliding heifer; now the Lord will feed them as a lamb in a large place.

17 “Ephraim is joined to idols; leave him alone. — Ephraim is joined to idols…. that is, the ten tribes of Israel, frequently so called after their separation from the rest, because Jeroboam, by whom the revolt was made, was the top dog, and Samaria, the metropolis of their kingdom, was in it: and

so the Targum renders it, “the house of Israel are joined to idols;” to the calves at Dan and Bethel; to Baal, and other idols, they worshipped.

18 Their drink is sour; they have committed whoredom continually; her rulers with shame do love, ‘Give ye.’ — their drink is sour…. in their stomachs, having drank so much that they cannot digest it; hence nauseous eructations, with a filthy stench, are belched out; so it is a charge of drunkenness which Ephraim or the ten tribes were addicted to, and are accused of.

19 The wind hath bound her up in her wings, and they shall be ashamed because of their sacrifices. — the wind hath bound her up in her wings…. that is, the wind in its wings hath bound up Ephraim, or the ten tribes; meaning, that the wind of God’s wrath and vengeance, or the enemy, the Assyrian, should come like a whirlwind, and carry them swiftly, suddenly, and irresistibly, out of their own land, into a foreign country, into captivity.

— because of their sacrifices; the Targum says, “because of the altars of their idols.”

Hosea (Ch 1-2)

•October 5, 2021 • Leave a Comment

The Prophecy of Hosea is primarily to the house of Ephraim (mentions 32 times in Hosea, and more than in any other books of the Bible). Often, as Ephraim being the chief tribe of the ten tribes, the name is used in place of Israel (used 41 times) when it is referring to the northern kingdom. Elsewhere on this site Ephraim has been established as the United States. So although the prophet Hosea may refer to situation in his time, the encoded message of Ephraim and Israel is meant primarily for the United States and secondarily its European allies.

Elsewhere, there are more detailed parallel passages in Ezekiel:

In Ezekiel 6:2 it say: ‘Ye mountains of Israel, hear the word of the Lord God. Thus saith the Lord God to the mountains and to the hills, to the rivers and to the valleys: Behold I, even I, will bring a sword upon you, and I will destroy your high places. — this message to the “mountains of Israel” — these mountains refer to the United States, UK and France. . . . “and to the hills, to the rivers and to the valleys” — the hills: Ireland, Switzerland and the Scandinavian countries: Denmark, Norway, and Sweden, Finland, and Iceland; and the valleys, the low countries: Belgium, the Netherlands, and Luxembourg.

In Ezekiel 7:2 it says, “Also, thou son of man, thus saith the Lord God unto the land of Israel: “An end! The end is come upon the four corners of the land. — The Targum version for the above is: “the punishment of the end, or the punishment determined to come upon the four winds of the earth.” The Targum recognizes that the Israelites are all over the face of the earth, spread over the four winds!

This would include Australia, New Zealand, Canada (and perhaps South Africa?) and numerous small islands around the world.

And in this context, “the land of Israel” and “over the face of the earth” would most probably include the modern state of Israel in Palestine.

Hosea 1

1 The word of the Lord that came unto Hosea, the son of Beeri, in the days of Uzziah, Jotham, Ahaz, and Hezekiah, kings of Judah, and in the days of Jeroboam the son of Joash, king of Israel. — the word of the Lord that came unto Hosea…. whose name is the same with Joshua and Yeshua/Jesus, and signifies a savior; he was a type of a savior, to deliver their souls from going into the pit, as all true prophets are to be; so rouse and ripple up these drunkards of Ephraim with their crown of pride, Isaiah 28:1.

in the days of. . . Hezekiah: the throne of Judah had some periods of good princes: but the message was to Israel, which had none at all.

The beginning of the word of the Lord by Hosea: And the Lord said to Hosea, “Go, take unto thee a wife of whoredoms and children of whoredoms; for the land hath committed great whoredom, departing from the Lord.” — for the land hath committed great whoredoms most frequently and most filthily; Ezekiel 23:2-4; Aholah, that is, Israel, played the harlot when she was Mine, Ezekiel 23:5.

 God asks Hosea to marry a harlot, so he marries Gomer

So he went and took Gomer the daughter of Diblaim, who conceived and bore him a son.

— the Targum, whose origin in the Aramaic language could be traced to Ezra, has the following: “and he went and prophesied over them, that if they returned, it should be forgiven them: but, if not, as fig tree leaves drop off, so should they; but they added, and did evil works.”

Rabbi Rashi (1040-1105 France): that was her name by dint of her harlotry, for all would gratify their lust on her (גּוֹמְרִין) and they would tread upon her like a pressed fig (דְּבֵלָה; that is a euphemism for sexual contact). Jonathan, however, paraphrases: גֹּמֶר, that if they would return from their way, their retribution would be finished, and if not, they will be like unripe figs falling from the fig tree.

And the Lord said unto him, “Call his name Jezreel; for in yet a little while I will avenge the blood of Jezreel upon the house of Jehu, and will cause to cease the kingdom of the house of Israel. — and will cause to cease the kingdom of the house of Israel; that is, in the family of Jehu; Zachariah the son of the then reigning prince being the last, and his reign only the short reign of six months; and second, this could also has a reference to the utter cessation of this kingdom as such in the times of Hoshea by Shalmaneser king of Assyria, 2 Kings 17:6.

Rashi: name him Jezreel: Jonathan renders: Call their name the scattered ones; i.e. prophesy over them that they will be exiled, and they will be sown among the peoples.

And it shall come to pass at that day, that I will break the bow of Israel in the Valley of Jezreel.”

And she conceived again, and bore a daughter. And God said unto him, “Call her name Loruhamah [that is, Not having obtained mercy]; for I will no more have mercy upon the house of Israel, but I will utterly take them away. — and God said unto him, call her name Loruhamah; which signifies, “she hath not obtained mercy;”

the Targum explains the same sense: “and they added and did evil works; and he said unto him call their name, who obtained not mercy by their works.”

But I will have mercy upon the house of Judah, and will save them by the Lord their God, and will not save them by bow, nor by sword, nor by battle, by horses, nor by horsemen.” — but I will have mercy on the house of Judah…. the three tribes of Judah, Levi and Benjamin, which retained the true worship of God among them; see Hosea 11:12 and though they often sinned against the Lord, God showed them mercy, and spared them longer than the ten tribes; and though they suffered being carried captives into Babylon, they returned after seventy years. This is mentioned as an aggravation of the punishment of Israel that Judah was spared, when Israel were not.

Now when she had weaned Loruhamah, she conceived and bore a son. — in the times of Pekah, king of Israel, who reigned twenty years; he was too powerful for Judah, and slew multitudes of them, and even assisted Rezin king of Syria against Ahaz king of Judah; the Targum says, “and the generation of them who are carried captive among the nations are found not to have obtained mercy by their works, but they added and did evil works.”

Then said God, “Call his name Loammi [that is, Not My people], for ye are not My people, and I will not be your God. — for ye are not my people; though he had chosen them to be his people and had distinguished them from others by various blessings and privileges; but they offered back the calves at Dan and Bethel; and therefore did not deserve the designation of God’s people.

— this time lap to the next verse is so huge that some Orthodox Bibles end Chapter 1 here and push the next few verses into chapter 2.

10 Yet the number of the children of Israel shall be as the sand of the sea, which cannot be measured nor numbered; and it shall come to pass that in the place where it was said unto them, ‘Ye are not My people,’ there it shall be said unto them, ‘Ye are the sons of the living God.’ — there seems a great time gap of over two thousand years, from “Ye are not My people,” to “Ye are the sons of the living God,” and like every Bollywood movies, they end with lots of high notes – HOOPLA!

11 Then shall the children of Judah and the children of Israel be gathered together, and appoint themselves one head; and they shall come up out of the land, for great shall be the day of Jezreel. — this is time flashing forward to the appearance of “My servant David,” in the “valley full of dry bones” scenario (Ezekiel 37) where the full house of Israel would dwell securely rather than in captivity.

the Targum paraphrases it as: “one head of the house of David.”

“the day of Jezreel;” by the arm of God, by his power and grace, and that in large numbers, so great will be on that day; so the Targum paraphrases it: “for great will be the day of their [re]gathering.”

Hosea 2

1 “Say ye unto your brethren, ‘Ammi’ [that is, My people], and to your sisters, ‘Ruhamah’ [that is, Having obtained mercy]. — these words are to be considered either in connection with the latter part of the preceding chapter, and as directed to the sons of the living God, who had not been, but now were, “Ammi”, the Lord’s people; and who had not, but now have, “Ruhamah,” obtained mercy.

“Plead with your mother, plead; for she is not My wife, neither am I her Husband. Let her therefore put away her whoredoms out of her sight, and her adulteries from between her breasts, — let her therefore put away her whoredoms out of her sight, namely, the shameless idolatry which was practiced throughout Israel at the time, and her adulteries from between her breasts, for Israel, in her shamelessness, was like a public harlot, who displays her profession in her bared breasts.

Gill: the Septuagint and Arabic versions are, “I will take away her whoredoms.”

lest I strip her naked and set her as in the day that she was born, and make her as a wilderness, and set her like a dry land, and slay her with thirst. — lest I strip her naked, as a punishment for her shameless exposure of herself in the practice of her spiritual wantonness, and set her as in the day that she was born.

And I will not have mercy upon her children, for they are the children of whoredoms.

— the above verse (and probably until verse 13) is best read:

(a) as a flashback before their repentance; or

(b) in context of the first word of the previous verse, “lest,” — lest I will not have any mercy upon her children, for they are children of whoredoms, all of them being guilty of the same shameless idolatry.

For their mother hath played the harlot; she that conceived them hath done shamefully. For she said, ‘I will go after my lovers that give me my bread and my water, my wool and my flax, mine oil and my drink.’

“Therefore, behold, I will hedge up thy way with thorns and make a wall, that she shall not find her paths.

And she shall follow after her lovers, but she shall not overtake them; and she shall seek them, but shall not find them. Then shall she say, ‘I will go and return to my first husband, for then was it better with me than now.’ — I will go and return to my first husband; either the God of Israel, whom the ten tribes departed from by worshipping the calves Jeroboam set up; but in the latter day will seek the Lord their God again, who was a husband to them, and shall cleave to him again, and all Israel shall be saved:

so the Targum says, “I will go and return to the service of my first master, for it was well with me when I served him; henceforth I will not serve idols.”

For she did not know that I gave her corn and wine and oil, and multiplied her silver and gold, which they prepared for Baal.

Therefore will I return and take away My corn at the harvest thereof, and My wine in the season thereof, and will recover My wool and My flax given to cover her nakedness.

10 And now will I uncover her lewdness in the sight of her lovers, and none shall deliver her out of Mine hand.

11 I will also cause all her mirth to cease, her feast days, her new moons, and her Sabbaths, and all her solemn feasts. — her feast days; which “Christians” understand and practice are:

(a) Christmas, which honor the Mithraism – a form of nature worship based on the Sun-Goddess Mithra who on the darkest night of the year (December 20/21), gives birth to “Light” causing each day thereafter to grow longer until the Summer solstice; and

(b) Easters, a celebration of Ishtar, the Assyrian and Babylonian goddess of fertility and sex. Her symbols (like the egg and bunny) were and still are fertility and sex symbols; and to those who actually think eggs and bunnies have something to do with the resurrection; and

(c) her sabbaths which is Sundays, where the original keepers were the Samaritans, brought from Assyria: And the king of Assyria brought men from Babylon, and from Cuthah, and from Ava, and from Hamath, and from Sepharvaim, and placed them in the cities of Samaria instead of the children of Israel; and they possessed Samaria and dwelt in the cities thereof, II Kings 17:24.

12 And I will destroy her vines and her fig trees, whereof she hath said, ‘These are my rewards that my lovers have given me’; and I will make them a forest, and the beasts of the field shall eat them.

13 And I will visit upon her the days of the Baalim, wherein she burned incense to them, and she decked herself with her earrings and her jewels, and she went after her lovers, and forgot Me,” saith the Lord.

14 “Therefore, behold, I will allure her, and bring her into the wilderness, and speak comfortingly unto her.

Parallel verses are:

“And many among them shall stumble and fall and be broken, and be snared and be taken” Isaiah 8:15.

“And I will spread My net upon him, and he shall be taken in My snare, and I will bring him to Babylon and will plead with him there for his trespass that he hath trespassed against Me” Ezekiel 17:20.

15 And I will give her her vineyards from thence, and the Valley of Achor for a door of hope; and she shall sing there, as in the days of her youth, and as in the day when she came up out of the land of Egypt.

16 “And it shall be at that day,” saith the Lord, “that thou shalt call Me ‘Ishi’ [that is, My husband], and shalt call Me no more ‘Baali’ [that is, My Lord].

17 For I will take away the names of the Baalim out of her mouth, and they shall no more be remembered by their name. — the sense is, that idolatry shall be utterly abolished, even of every kind; not the worship of Baalim only, but of all other idols, Exodus 23:13,

— and so the Targum says, “and I will take away the name of the idols of the people out of their mouth.”

18 And in that day will I make a covenant for them with the beasts of the field, and with the fowls of the heavens, and with the creeping things of the ground; and I will break the bow and the sword and warfare out of the earth, and will make them to lie down safely. — and I will break the bow and the sword and the battle out of the earth; all the instruments of war shall be no more, these mentioned being put for all the rest; the Pentagon and West Point will be demolished, swords shall be beat into ploughshares, and spears into pruning hooks; people will enjoy being farmers, and lots of them; some go on learning folk songs, dancing away, like Tibetan and Mongolian folk songs and dances, practicing their vocal cords praising God;

19 And I will betroth thee unto Me for ever; yea, I will betroth thee unto Me in righteousness, and in judgment, and in lovingkindness, and in mercies.

20 I will even betroth thee unto Me in faithfulness, and thou shalt know the Lord.

21 “And it shall come to pass in that day I will hear,” saith the Lord, “I will hear the heavens, and they shall hear the earth.

22 And the earth shall hear the corn and the wine and the oil, and they shall hear Jezreel. — see, people will enjoy being farmers, and even herders, lots of them; and with plenty of good wine and time, many will go on learning folk songs, dancing away into the clouds.

23 And I will sow her unto Me in the earth; and I will have mercy upon her that had not obtained mercy; and I will say to those who were not My people, ‘Thou art My people’; and they shall say, ‘Thou art my God.’”

~~

— as said above, people will enjoy being farmers and herders, lots of them; and with plenty of time on hand and during in-between breaks along their open fields, they will go on learning and perfecting their folk songs, of their ethnic groups that had been accumulated over hundreds and even thousands of years, now singing and dancing away, like Mongolian, Pashtuni, Kashmiri among numerous other ethnic groups hills and valleys; and especially the Tibetan, among their shangri la idyllic hideaway mountains, and with good wine, their vocal cords moist and loosen further, singing and praising God with sweeter songs: “Thou art our God, too,” beaming with an even higher pitch from the roof of the world, like this one;

— and during the annual Feast of Tabernacles in Jerusalem, these ethnic groups singing and dancing with their finest ethnic colorful silk costumes from the enlarged outer court of a new Temple could pose a challenge to those Levites singing from inside the confine of the inner court; “Don’t be so loud,” some annoyed-looking officials appears from the inner court admonishing those singing too loud outside;

— but the loudest and most uncontrollable cheers comes upon the appearance of the dancing and singing Gypsies: “Beyond Our Wildest Dream” whose fortunes had greatly fallen since the great days of the great Pharaohs of Egypt; now their honor restored, displaying much renew joy and restraint cool pride than others, which greatly enlighten the whole world following some surrealistic chills running down their spines flooding their face with socking tears and more applause in response;

— and of course, the Shekinah has returned, filling the much bigger Ezekiel Temple and its precinct with nice smell incense (five hundred cubits in length with five hundred in breadth: Ezekiel 45:2 – “875 by 875 feet”); the whole idyllic atmosphere permeanting all our five senses with surreal clouds rolling overhead and moving continuously along with the Glory of God.

Ezekiel 4 – 390/40 Years

•October 3, 2021 • 3 Comments

There were much additions since the original posting of Ezekiel (Ch 3-4), hence this update and excerpt here. Just wondering if there is any thoughts to the contrary? Any other possibilities? Thanks for reading.

Ezekiel 4

Below is the Septuagint (and Arabic versions; Gill says so) and putting all together, a possible explanation to the mystery of the 390/190/150/40 years:

Ezekiel 4

4 And thou shalt lie upon thy left side, and lay the iniquities of the house of Israel upon it, according to the number of the hundred and fifty days which thou shalt lie upon it: and thou shalt bear their iniquities.  start with the ten tribes house of Israel and last for 150 years

5 For I have appointed thee their iniquities for a number of days, for a hundred and ninety days: so thou shalt bear the iniquities of the house of Israel start with the 10 tribes but end with the full house of Israel; all 12 tribes: end of the 190 years

6 And thou shalt accomplish this, and shalt lie on thy right side, and shalt bear the iniquities of the house of Juda forty days: I have appointed thee a day for a year. Ezekiel 4:4-6 Septuagint.  after the start of the 10 tribes house of Israel and last for 150 years, the house of Judah; 3 tribes join in for 40 years

Take thou also to thee wheat, and barley, and beans, and lentils, and millet, and bread-corn; and thou shalt cast them into one earthen vessel, and shalt make them into loaves for thyself; and thou shalt eat them a hundred and ninety days, according to the number of the days which thou sleepest on thy side. Ezekiel 4:4-9 Septuagint.  from the start with 10 tribes and ends with the full house of Israel: 190 years: why the difference? Perhaps Judah had undergo numerous pogroms and cleanings whereas Ephraim has none since the day when went captivity and into apparent oblivion

We’re now in the Hebrew year 5782 and we’ll need another 217 years to usher the Divine Plan into the 7th Millennium as we believe. Of course, this is on the assumption that God’s oracles have been accurately kept since the day Adam was created as the Orthodox custodians claim.

If we add 217 years to the Gregorian calendar year 2022 we’ll come to 2239 when the 7th Millennium starts. Working backward 190 years will bring us to the Gregorian year 2049. So could the year 2049 be the start of the house of Israel’s “iniquity?” — “thus shall the children of Israel eat their defiled bread among the Gentiles, whither I will drive them;” Ezekiel 4:13 in captivity to start the 190 years?

No, not really: the 190 years should end with the appearance of “My servant David,” in the “valley full of dry bones” scenario (Ezekiel 37) where the full house of Israel would dwell securely rather than in captivity. Indications are that this period is a hundred year period involving “Gog and all his multitude” to the beginning of the Millennium (Ezekiel 40). If so, the start of the 190 years would be pushed back another hundred years, which would be the Gregorian year 2048; which seems having a higher possibility than the figures offered by the Masoretic Text.

On reflection the children of Israel were in Egypt for about 210 years, so cheers; this captivity of 190 years is 20 years shorter. These analyses may run away with imaginations, but the incorporation of prophecies always has elements of uncertainties and so these predictions could be prone to errors.

Okay, one Question that comes to mind is, “Why the iniquity for Israel is much longer than Judah?” Perhaps the answer could be broken into two parts: (1) the house of Judah, the Jews, have undergone pogroms numerous times over the last two and a millenium whereas the house of Israel have remained largely unscatched since their captivity was only once by the Assyrians; to be truly qualified to be a kingdom of priests (Exodus 19:6) requiries numerous immense purifications; and that’s how the prophets of God see things. Prime examples are Daniel and his three friends, Shadrach, Meshach and Abed-Nego.

And a related second reason: (2) the house of Judah has already been restored to the Land of Promise; whereas the house of Israel are still largely intact and still in exile from its Promised Land. It would take decades for adverse conditions to build up for the whole house of Israel to want to return back into their homeland to team up with the house of Judah for the fulfilment of the prophecy of the joining of the two sticks in Ezekiel 37.

Third, forty years for the house of Judah rhymes a few parallels (a) when the children of Israel rejected Joshua’s and Caleb’s suggestion to take the land immediately, they were punished by wandering in the wilderness for forty years, Numbers 14:33; (b) when the children of Israel rejected God’s judgement under the rule of the judges, God abandoned them and subjected them under the Philistines for forty years, Judges 13:1. For the Lord had said ““You only have I known of all the families of the earth; therefore I will punish you for all your iniquities” Amos 3:2.

And finally these analyses are not written in stone and so any thoughts to the contrary are most welcome. Are there any other possibilities or factors that have been left out but could or should be considered? Thanks for your thoughts.

For more, see a possible scenario how such a scene could come about: A Sword from the South!

Ezekiel (Ch 39-40)

•September 29, 2021 • Leave a Comment

Practically fragments of all the previous chapter are repeated in chapter 39, namely, Ezekiel 39:2-4,14-17. Comments on Gog, the chief (Rosh) prince of Meshech and Tubal continues. Meshech and Tubal; these are names associated with Russia. Meshech in Hebrew is Mosoch and the Muscovites are said to descend from Meshech. Being brothers, Meschech is also closely associated with Tubal. Assyrian annals have them as Tabali and Mushki. The Russian city Tobolsk is said to derive from Tubal. Tbilisi is the Capital of the country of Georgia. A picture of a geographical area begins to be apparent with names associated with these tribes.

Ezekiel 39

1 “Therefore, thou son of man, prophesy against Gog and say, ‘Thus saith the Lord God: Behold, I am against thee, O Gog, the chief prince of Meshech and Tubal.

And I will turn thee back and leave but a sixth part of thee, and will cause thee to come up from the north parts and will bring thee upon the mountains of Israel; — Gill: I will lead thee and turn thee wheresoever I please: thou shalt not proceed any further than I shall permit thee, but shalt be driven back. And leave but a sixth part of thee; Or, as others render it, I will strike thee with six plagues, those mentioned in Ezekiel 38:22.

and I will smite thy bow out of thy left hand, and will cause thine arrows to fall out of thy right hand.

Thou shalt fall upon the mountains of Israel, thou and all thy forces and the people that are with thee. I will give thee unto the ravenous birds of every sort and to the beasts of the field to be devoured. — I will give thee to the ravenous birds of every sort, and to the beasts of the field to be devoured: a great part of his army being slain, should not be buried, but be devoured by birds of prey, and savage beasts; such as eagles and vultures of the former sort, and lions, bears, wolves. These birds of prey and savage beasts are behaving as before, so this doesn’t sound like the Millennium, is it?

One scene about the peace and tranquility of the Millennium is given by Isaiah below:

“The wolf also shall dwell with the lamb, and the leopard shall lie down with the kid; and the calf and the young lion and the fatling together; and a little child shall lead them” Isaiah 11:6.

Thou shalt fall upon the open field, for I have spoken it, saith the Lord God.

And I will send a fire on Magog and among them that dwell confidently in the isles; and they shall know that I am the Lord. — Magog and those that dwell in islands will also be called.

“‘So will I make My holy name known in the midst of My people Israel, and I will not let them pollute My holy name any more; and the nations shall know that I am the Lord, the Holy One in Israel. — and I will not let them pollute my holy name any more: either the nations round about who before blasphemed it, saying that God was not able to deliver his people from such a potent enemy; but now they will not dare to speak any more after this manner.

Behold, it is come, and it is done, saith the Lord God. This is the day whereof I have spoken.

“‘And they that dwell in the cities of Israel shall go forth, and shall set on fire and burn the weapons, both the shields and the bucklers, the bows and the arrows, and the javelins and the spears; and they shall burn them with fire seven years, — “seven years” – some consider this an hyperbolical expression, but it may be very well taken in literally, and the meaning be, that so great will be the quantity of warlike weapons that will be found and gathered, that they will serve for fuel for the space of seven years.

10 so that they shall take no wood out of the field, neither cut down any out of the forests. For they shall burn the weapons with fire, and they shall despoil those that despoiled them, and rob those that robbed them, saith the Lord God.

11 “‘And it shall come to pass on that day that I will give unto Gog a place there of graves in Israel, the valley of the passersby on the east of the sea; and it shall stop the noses of the passersby. And there shall they bury Gog and all his multitude; and they shall call it the Valley of Hamongog [that is, The multitude of Gog]. — and there shall they bury Gog, and all his multitude; all his army, such of it as the fowls and beasts had not devoured, and the bones they had left.

12 And seven months shall the house of Israel be burying them, that they may cleanse the land.

13 Yea, all the people of the land shall bury them; and it shall be to them a day of renown the day that I shall be glorified, saith the Lord God.

14 And they shall separate out men for continual employment, passing through the land, to bury with the passersby those who remain upon the face of the earth to cleanse it. At the end of seven months shall they search.

15 And the passersby who pass through the land, when any seeth a man’s bone, then shall he set up a sign by it till the buriers have buried it in the Valley of Hamongog.

16 And also the name of the city shall be Hamonah [that is, The multitude]. Thus shall they cleanse the land.’

17 “And, thou son of man, thus saith the Lord God: Speak unto every feathered fowl and to every beast of the field: ‘Assemble yourselves and come. Gather yourselves on every side to My sacrifice that I do sacrifice for you, even a great sacrifice upon the mountains of Israel, that ye may eat flesh and drink blood. — “that ye may eat flesh and drink blood” maybe taken metaphorically; perhaps just “Gather from all sides for the sacrificial feast I am preparing for you, a magnificent sacrificial feast on the mountains of Israel.”

18 Ye shall eat the flesh of the mighty and drink the blood of the princes of the earth, of rams, of lambs and of goats, of bullocks, all of them fatlings of Bashan.

19 And ye shall eat fat till ye be full and drink blood till ye be drunken of My sacrifice which I have sacrificed for you.

Temple of Heaven, Beijing Tiantan Park - History, Attractions...

The Temple of Heaven, built without nails, in Central Beijing, where the Emperor annually sacrificed a carefully selected bull to Shangdi (上帝), the Supreme Deity. The religious ritual was meant as an atonement for the nation’s sins; but the ceremony ended in 1911.

20 Thus ye shall be filled at My table with horses and chariots, with mighty men and with all men of war,’ saith the Lord God.

21 “And I will set My glory among the nations, and all the nations shall see My judgment that I have executed and My hand that I have laid upon them. — and all the nations, and there is no exception, shall see my judgment that I have executed, and my hand that I have laid upon them; his glory and greatness, his omniscience and omnipotence. Even the Chinese will come to realize He is the ShangDi (上帝) that they have some knowledge before, but that He has never fully revealed to them.

22 So the house of Israel shall know that I am the Lord their God from that day and forward.

23 And the nations shall know that the house of Israel went into captivity for their iniquity. Because they trespassed against Me, therefore hid I My face from them and gave them into the hand of their enemies; so fell they all by the sword. — Here is the reconciliation between the full house of Israel and all the nations of the world, the full 70 nations of the world under one Sovereign, one God! Hallelujah!

24 According to their uncleanness and according to their transgressions have I done unto them, and hid My face from them. therefore hid I my face from them; took no notice of them, showed them no favour, took no care of them; disregarded their prayers and cries, and removed his presence from them, and all the tokens of it.

So the Targum, “I caused my Shechaniah (or majesty) to remove from them.”

Internal structure of The Hall of Prayer for Good Harvests
Originaly known as “The Hall of Great Sacrifice” to honor ShangDi (上帝), the Hall was renamed to a man-centered “The Hall of Prayer for Good Harvests” in 1751 (when its GDP was estimated to be 35% of the world’s total), and was dedicated to praying for good harvests only, no more an atonement for the nation’s sins, setting the stage for China’s decline and eventually the “Century of Humiliation.”

25 “Therefore thus saith the Lord God: Now will I bring back the captives of Jacob, and have mercy upon the whole house of Israel, and will be jealous for My holy name

26 after they have borne their shame and all their trespasses whereby they have trespassed against Me, when they dwelt safely in their land and none made them afraid.

27 When I have brought them back from the people and gathered them out of their enemies’ lands, and am sanctified in them in the sight of many nations,

28 then shall they know that I am the Lord their God, who caused them to be led into captivity among the nations. But I have gathered them unto their own land, and have left none of them any more there;

29 neither will I hide My face any more from them, for I have poured out My Spirit upon the house of Israel, saith the Lord God.” — for I have poured out my Spirit upon the house of Israel, saith the Lord God; this refers not to the effusion of the Spirit on the day of Pentecost, but to one that is yet to come, when all nations will be converted in the latter day; after which God will no more depart from them, nor shall they depart from him; “Christians” will repent for their adoration and worship of the SUN and come to the full meaning of what full the Oracles of God are; and even the Jews will repent profusely for the One they had pierced; see Zechariah 12:10.

Ezekiel 40

Maybe here is the start for the peace and tranquility of the Millennium? What we have here is a very detailed description of a magnificent physical Temple, somewhat loosely patterned after the Temple of Solomon, only much larger, complete with special living quarters for priests, and an elaborate system of animal sacrifices and other material offerings, along with the faithful observance of New Moons and Sabbaths, the whole picture rivaling the Book of Leviticus itself.

1 In the five and twentieth year of our captivity, at the beginning of the year, on the tenth day of the month, in the fourteenth year after the city was smitten, on the selfsame day the hand of the Lord was upon me, and brought me thither. — in the self-same day the hand of the Lord was upon me, and brought me hither; which is sometimes called the finger of God, or the power of God, this fell upon him, or was laid on him, and impressed his mind and soul; the Targum interprets “the hand of the Lord” the spirit of prophecy.

In the visions of God brought He me into the land of Israel and set me upon a very high mountain, by which there was, as it were, the form of a city on the south. — by, which was as the flame of a city on the south: the prophet in the vision, and as to his view of things coming from Babylon, which lay north of Judea, has a view of the south which is the city of Jerusalem and the Temple.

And He brought me thither, and behold, there was a man whose appearance was like the appearance of brass, with a line of flax in his hand and a measuring reed; and he stood in the gate. — there was a man; one in human form; appearance of brass, a cherub?

And the man said unto me, “Son of man, behold with thine eyes and hear with thine ears, and set thine heart upon all that I shall show thee; for with the intent that I might show them unto thee art thou brought hither. Declare all that thou seest to the house of Israel.”

And behold, a wall on the outside of the house round about, and in the man’s hand a measuring reed of six cubits long by a cubit and a hand breadth. So he measured the breadth of the building, one reed; and the height, one reed. — the cubit is a cubit and a hand’s breadth; to which may be added, that such was the royal cubit at Babylon, where Ezekiel now was, “the royal cubit is larger by three fingers than that which was usually measured with, or the common cubit;”

in this way Rashi and Kimchi understand it; though they make the common cubit to be but five hands’ breadth, or fifteen inches, and this six hands’ breadth, or eighteen inches.

Several modern translation have these measurements in feet and inches: an example is Voice, CSB, CEB, CJB, CEV, EXB, GW, GNT, etc:

VOICE: I saw a wall surrounding the temple. The measuring reed in the man’s hand was about 10½ feet long. He measured the wall and found it to be about 10½ feet thick and 10½ feet high.

Then came he unto the gate which looketh toward the east, and went up the stairs thereof and measured the threshold of the gate, which was one reed broad, and the other threshold of the gate, which was one reed broad.

Ezekiel Temple

And every little chamber was one reed long and one reed broad; and between the little chambers were five cubits; and the threshold of the gate by the porch of the gate within was one reed.

He measured also the porch of the gate within, one reed.

Then measured he the porch of the gate, eight cubits; and the posts thereof, two cubits; and the porch of the gate was inward.

10 And the little chambers of the gate eastward were three on this side and three on that side; they three were of one measure, and the posts had one measure on this side and on that side.

11 And he measured the breadth of the entry of the gate, ten cubits; and the length of the gate, thirteen cubits.

12 The space also before the little chambers was one cubit on this side, and the space was one cubit on that side; and the little chambers were six cubits on this side and six cubits on that side.

13 He measured then the gate from the roof of one little chamber to the roof of another; the breadth was five and twenty cubits, door against door.

14 He made also posts of threescore cubits, even unto the post of the court round about the gate.

15 And from the face of the gate of the entrance unto the face of the porch of the inner gate were fifty cubits.

16 And there were narrow windows to the little chambers, and to their posts within the gate round about and likewise to the arches; and windows were round about within; and upon each post were palm trees.

17 Then he brought me into the outer court, and lo, there were chambers and a pavement made for the court round about; thirty chambers were upon the pavement.

18 And the pavement by the side of the gates over against the length of the gates was the lower pavement.

Ezekiel's Temple and the Christian Gospels — Ezekiel's Temple

19 Then he measured the breadth from the forefront of the lower gate unto the forefront of the inner court from outside, a hundred cubits eastward and northward.

20 And the gate of the outer court that looked toward the north, he measured the length thereof and the breadth thereof.

21 And the little chambers thereof were three on this side and three on that side; and the posts thereof and the arches thereof were the same measure as the first gate; the length thereof was fifty cubits, and the breadth five and twenty cubits.

22 And their windows and their arches and their palm trees were the same measure as the gate that looketh toward the east; and they went up unto it by seven steps, and the arches thereof were before them.

23 And the gate of the inner court was opposite the gate toward the north and toward the east; and he measured from gate to gate a hundred cubits.

24 After that he brought me toward the south, and behold, a gate toward the south; and he measured the posts thereof and the arches thereof according to these measures.

25 And there were windows in it and in the arches thereof round about like those windows; the length was fifty cubits, and the breadth five and twenty cubits.

26 And there were seven steps to go up to it, and the arches thereof were before them; and it had palm trees, one on this side and another on that side, upon the posts thereof.

27 And there was a gate in the inner court toward the south; and he measured from gate to gate toward the south a hundred cubits.

28 And he brought me to the inner court by the South Gate. And he measured the South Gate according to these measures,

29 and the little chambers thereof and the posts thereof and the arches thereof according to these measures. And there were windows in it and in the arches thereof round about; it was fifty cubits long, and five and twenty cubits broad.

30 And the arches round about were five and twenty cubits long, and five cubits broad.

31 And the arches thereof were toward the outer court, and palm trees were upon the posts thereof; and the going up to it had eight steps. — and the going up to it had eight steps, for the inner court rose higher above the outer court than the latter did above the exterior.

32 And he brought me into the inner court toward the east; and he measured the gate according to these measures.

33 And the little chambers thereof and the posts thereof and the arches thereof were according to these measures. And there were windows therein and in the arches thereof round about; it was fifty cubits long, and five and twenty cubits broad.

34 And the arches thereof were toward the outer court; and palm trees were upon the posts thereof, on this side and on that side; and the going up to it had eight steps. — it had eight steps, the symmetry of the entire structure thus being shown once more.

35 And he brought me to the North Gate and measured it according to these measures —

36 the little chambers thereof, the posts thereof and the arches thereof, and the windows to it round about. The length was fifty cubits, and the breadth five and twenty cubits.

37 And the posts thereof were toward the outer court, and palm trees were upon the posts thereof, on this side and on that side; and the going up to it had eight steps. — eight steps again! Eight signifies a new beginning.

38 And the chambers and the entries thereof were by the posts of the gates, where they washed the burnt offering.

39 And in the porch of the gate were two tables on this side and two tables on that side, to slay thereon the burnt offering and the sin offering and the trespass offering.

40 And at the side outside, as one goeth up to the entry of the North Gate, were two tables; and on the other side, which was at the porch of the gate, were two tables.

41 Four tables were on this side and four tables on that side by the side of the gate, eight tables upon which they slew their sacrifices.

42 And the four tables were of hewn stone for the burnt offering, of a cubit and a half long and a cubit and a half broad and one cubit high, upon which also they laid the instruments wherewith they slew the burnt offering and the sacrifice. burnt offering and animal sacrifices will be brought back into practice. Why brought these back for those who preached: “Christ died and the ceremonial laws are therefore obsolete”?

Planted: Ezekiel's Temple Vision

43 And within were hooks, a handbreadth wide, fastened round about; and upon the tables was the flesh of the offering.

44 And outside the inner gate were the chambers of the singers in the inner court, which was at the side of the North Gate, and their prospect was toward the south, one at the side of the East Gate having the prospect toward the north. — Rashi: the chambers of the choristers: the chambers of the Levites who sing; whose duty and privilege it is to sing psalms, hymns and spiritual songs.

Kretzmann: And without the inner gate were the chambers of the singers in the inner court, these two cells being immediately at the entrance of the court, which was at the side of the north gate, and their prospect was toward the south, that is, the one faced in that direction; one at the side of the east gate having the prospect toward the north, so that the two faced each other.

45 And he said unto me, “This chamber whose prospect is toward the south is for the priests, the keepers of the charge of the house.

46 And the chamber whose prospect is toward the north is for the priests, the keepers of the charge of the altar; these are the sons of Zadok among the sons of Levi, who come near to the Lord to minister unto Him.”

47 So he measured the court, a hundred cubits long and a hundred cubits broad, foursquare, and the altar that was before the house.

48 And he brought me to the porch of the house and measured each post of the porch, five cubits on this side and five cubits on that side; and the breadth of the gate was three cubits on this side and three cubits on that side.

49 The length of the porch was twenty cubits and the breadth eleven cubits; and he brought me by the steps by which they went up to it; and there were pillars by the posts, one on this side and another on that side. — all nine chapters 40-48 are devoted mainly to the Grand New Temple in Jerusalem; the City and the land allocation for each tribe following Israel’s return to the Promised Land.

The Laws, statutes and both the weekly and annual Sabbaths will be brought back:

“And in controversy they shall stand in judgment, and they shall judge it according to My judgments; and they shall keep My laws and My statutes in all Mine assemblies, and they shall hallow My Sabbaths,” Ezekiel 44:24.

And despite Ephraim being the birthright holder, the Lord chooses Judah to oversee His Temple ceremony and worship:

“Moreover He refused the tabernacle of Joseph and chose not the tribe of Ephraim, but chose the tribe of Judah, the Mount Zion which He loved,” Psalm 78:68-69.

This Ezekiel Temple and its courts will be five hundred cubits in length with five hundred in breadth: – “875 by 875 feet” — much enlarged compared to Solomon’s or Herod’s to reduce chances of stampedes during festivals when Jerusalem will be flooded by people from all the nations:

“Of this there shall be for the sanctuary five hundred in length with five hundred in breadth, square round about, and fifty cubits round about for the open places thereof,” Ezekiel 45:2.

Various forms of offerings and sacrifices will be reinstated:

“It shall be the prince’s duty to furnish the burnt offerings, grain offerings, and drink offerings, at the feasts, the new moons, and the Sabbaths, all the appointed feasts of the house of Israel: he shall provide the sin offerings, grain offerings, burnt offerings, and peace offerings, to make atonement on behalf of the house of Israel,” Ezekiel 45:17.

And the Ephraimites, who had been stiffed-necked all along, will no longer be quarreling with Judah pertaining as to how many days to observe Passover, a composite feast of seven days where only the unleavened is to be eaten:

“‘In the first month, on the fourteenth day of the month, ye shall have the Passover, a feast of seven days. Unleavened bread shall be eaten,” Leviticus 45:21.

And about the Law, both written and case Laws:

Judah is My lawgiver, Psalm 108:8.

Ezekiel (Ch 37-38)

•September 27, 2021 • 1 Comment

Chapter 37 contains a prophecy of both the Jews’ and Israelites’ return from captivity to their own land; of the union of the each tribes with one another; their restoration is represented by a vision of dry bones made alive. But is this the start of the Millennium?

Ezekiel 37

1 The hand of the Lord was upon me, and carried me out in the Spirit of the Lord and set me down in the midst of the valley which was full of bones, — More on Ezekiel 23:25:

And I will set My jealousy against thee, and they shall deal furiously with thee. They shall take away thy nose and thine ears, and thy remnant shall fall by the sword. They shall take thy sons and thy daughters, and thy residue shall be devoured by the fire. Ezekiel 23:25

Since Ezekiel’s message is for the endtime and meant for the house of Israel, which is the United States and its European allies and “thy remnant shall fall by the sword . . . and thy residue shall be devoured by the fire”: — if those remnant are put to the sword, and any residue be put to the fire, then no more will be left, reaffirming there is no place of safety for those hopeful to have one. Second, any living will have to be resurrected from the valley of dry bones!!!

and caused me to pass by them round about; and behold, there were very many in the open valley, and lo, they were very dry.

And He said unto me, “Son of man, can these bones live?” And I answered, “O Lord God, Thou knowest.” — and he said unto me, son of man, can these bones live?… is there any probability to believe they shall live?

Again He said unto me, “Prophesy upon these bones and say unto them, ‘O ye dry bones, hear the word of the Lord.

Thus saith the Lord God unto these bones: Behold, I will cause breath to enter into you, and ye shall live.

And I will lay sinews upon you, and will bring up flesh upon you, and cover you with skin, and put breath in you, and ye shall live; and ye shall know that I am the Lord.’” — God said of these dry bones “and ye shall know that I am the Lord” implying that they never have known God, despite many claim they were Christians. How could they? In today’s world, no less than 99.99 percent of professing Christians don’t even know the basic tenet of understanding the Oracles of God!

So I prophesied as I was commanded; and as I prophesied,there was a noise, and behold, a shaking, and the bones came together, bone to his bone.

And when I beheld, lo, the sinews and the flesh came up upon them, and the skin covered them above; but there was no breath in them.

Then said He unto me, “Prophesy unto the wind. Prophesy, son of man, and say to the wind, ‘Thus saith the Lord God: Come from the four winds, O breath, and breathe upon these slain, that they may live.’” — and breathe upon these slain, that they may live; and so looked comely and beautiful, as in the proper form of men; and yet no principle of spiritual life in them; but, like Adam’s body, of the earth, earthly, and breathless, till the Lord stirred up their spirits.

10 So I prophesied as He commanded me, and the breath came into them, and they lived and stood up upon their feet, an exceeding great army.

11 Then He said unto me, “Son of man, these bones are the whole house of Israel. Behold, they say, ‘Our bones are dried and our hope is lost. We are cut off from our parts.’ — these bones are the whole house of Israel; this phrase takes in the ten tribes, as well as the two tribes of Benjamin and Judah inclusive.

12 Therefore prophesy and say unto them, ‘Thus saith the Lord God: Behold, O My people, I will open your graves and cause you to come up out of your graves, and bring you into the land of Israel.

13 And ye shall know that I am the Lord when I have opened your graves, O My people, and brought you up out of your graves, — in God’s view, death is both unclean and an insignificant event, hence He forbid His priests to come near the dead among his people; and the high priests, not even near their parents if they died (Ezekiel 21:1-11).

14 and shall put My Spirit in you and ye shall live, and I shall place you in your own land. Then shall ye know that I, the Lord, have spoken it and performed it, saith the Lord.’”

15 The word of the Lord came again unto me, saying,

16 “Moreover, thou son of man, take thee one stick and write upon it, ‘For Judah and for the children of Israel, his companions.’ Then take another stick and write upon it, ‘For Joseph, the stick of Ephraim, and for all the house of Israel, his companions.’ — earlier in Ezekiel 36:1 these are described as “the mountain of Israel;” this prophecy is concerning the top dog, the United States and its European allies, UK and France. And in Ezekiel 36:4  “the hills, to the rivers and to the valleys;” these are the hills: Ireland, Switzerland and the Scandinavian countries: Denmark, Norway, and Sweden, Finland, and Iceland; and the valleys, the low countries: Belgium, the Netherlands, and Luxembourg.

17 And join them one to another into one stick, and they shall become one in thine hand.

18 And when the children of thy people shall speak unto thee, saying, ‘Wilt thou not show us what thou meanest by these?’

19 say unto them, ‘Thus saith the Lord God: Behold, I will take the stick of Joseph, which is in the hand of Ephraim, and the tribes of Israel, his fellows, and will put them with him, even with the stick of Judah, and make them one stick, and they shall be one in Mine hand.’ — Rashi: Behold I will take the stick, etc: that they shall no longer be two kingdoms.

20 And the sticks whereon thou writest shall be in thine hand before their eyes.

21 “And say unto them, ‘Thus saith the Lord God: Behold, I will take the children of Israel from among the nations whither they have gone, and will gather them on every side and bring them into their own land.

22 And I will make them one nation in the land upon the mountains of Israel, and one King shall be King to them all; and they shall be no more two nations, neither shall they be divided into two kingdoms any more at all. — and I will make them one nation in the land upon the mountains of Israel, as they were during the times of David and Solomon.

23 Neither shall they defile themselves any more with their idols, nor with their detestable things, nor with any of their transgressions; but I will save them out of all their dwelling places wherein they have sinned and will cleanse them. So shall they be My people, and I will be their God.

24 “‘And David My servant shall be King over them, and they all shall have one Shepherd. They shall also walk in My judgments, and observe My statutes, and do them. — is this the Millennium? Is this the same King David of ancient Israel? Or is he an equivalent? and they shall also walk in my judgments, and keep my statutes, and do them; these would definitely include the statutes and ordinances of the “ceremonial law” since the temple will be rebuilt; and which the Jews, who control Jerusalem, will be performing them for and on behalf of all the nations.

25 And they shall dwell in the land that I have given unto Jacob My servant, wherein your fathers have dwelt; and they shall dwell therein, even they and their children and their children’s children for ever. And My servant David shall be their Prince for ever. — is this the Millennium? Is this the same King David of ancient Israel? Or is he an equivalent?

26 Moreover I will make a covenant of peace with them. It shall be an everlasting covenant with them. And I will place them, and multiply them, and will set My sanctuary in the midst of them for evermore. — the Temple will be rebuilt, and the Glory of God, the Shekhinah will return.

27 My tabernacle also shall be with them. Yea, I will be their God, and they shall be My people.

28 And the nations shall know that I, the Lord, do sanctify Israel, when My sanctuary shall be in the midst of them for evermore.’” — the Temple will be filled with the Glory of God; the Shekhinah will be manifested before all the nations of the world.

The question is, is this the start of the Millennium? If so the Messiah (Christ) and His saints would rule the world, some over one city, others ten. Would these saints be given power over the nations, yet so powerless with no power to allow their subjects to go all the way to Jerusalem and mount a war against its inhabitants? And all the way from east Asia, say the Philippines? It seems inconceivable. Or, is “My servant David” a form of John the Baptist that came in the name of Elijah? Your thoughts?

“Behold, I will send you Elijah the prophet before the coming of the great and dreadful day of the Lord. Malachi 4:5

Ezekiel 38

1 And the word of the Lord came unto me, saying,

“Son of man, set thy face against Gog, in the land of Magog, the chief prince of Meshech and Tubal, and prophesy against him — these are the sons of Japheth.

The sons of Japheth: Gomer, and Magog, and Madai, and Javan, and Tubal, and Meshech, and Tiras. Genesis 10:2

and say, ‘Thus saith the Lord God: Behold, I am against thee, O Gog, the chief prince of Meshech and Tubal. — Gog is not a name among the sons of Japheth, but designated as the chief prince of Meshech and Tubal.

And I will turn thee back and put hooks into thy jaws, and I will bring thee forth and all thine army, horses and horsemen, all of them clothed with all sorts of armor, even a great company with bucklers and shields, all of them handling swords;

Persia, Ethiopia, and Libya with them, all of them with shield and helmet;

Gomer and all his bands; the house of Togarmah of the north quarters and all his bands — and many people with thee; in Revelation 20:8 Gog and Magog shall go out to deceive the nations to the four quarters of the earth, but here, Persia is from the extreme east; Ethiopia or Cush is from the south; Libya or Put represent the extreme west; and the house of Togarmah was in the extreme north.

“‘Be thou prepared and prepare for thyself, thou and all thy company that are assembled unto thee, and be thou a guard unto them. — TLB translation says “Be prepared! Stay mobilized. You are their leader, Gog!”

After many days thou shalt be visited. In the latter years thou shalt come into the land that is brought back from the sword and is gathered out of many people, against the mountains of Israel, which have been always waste; but it is brought forth out of the nations and they shall dwell safely, all of them. — led by Gog and Magog ‘in the latter years,’ numerous Gentile nations will launch an attack on Israel from all directions.

Thou shalt ascend and come like a storm. Thou shalt be like a cloud to cover the land, thou and all thy troops, and many people with thee.

10 “‘Thus saith the Lord God: It shall also come to pass that at the same time shall things come into thy mind, and thou shalt think an evil thought; — at the same time shall things come into thy mind; when the Israelites shall be in their own land, dwelling in great security; and when Gog and his companions shall make preparation to enter into their land suddenly and furiously; and thou shall think an evil thought, many schemes and devices; to do mischief, to dispossess them of their land, and plunder their substance.

11 and thou shalt say, “I will go up to the land of unwalled villages; I will go to them that are at rest, who dwell safely, all of them dwelling without walls and having neither bars nor gates”—

12 to take a spoil and to take a prey, to turn thine hand upon the desolate places that are now inhabited and upon the people who are gathered out of the nations, who have gotten cattle and goods, who dwell in the midst of the land. — this will be against Gog as the chief of numerous rebellious nations with him.

13 Sheba and Dedan and the merchants of Tarshish, with all the young lions thereof, shall say unto thee, “Art thou come to despoil us? Hast thou gathered thy company to take a prey, to carry away silver and gold, to take away cattle and goods, to take a great spoil?”’

14 “Therefore, son of man, prophesy and say unto Gog, ‘Thus saith the Lord God: On that day when My people of Israel dwelleth safely, shalt thou not know it?

15 And thou shalt come from thy place out of the north parts, thou and many people with thee, all of them riding upon horses, a great company and a mighty army. — in relation to Jerusalem, Gog is indicated as coming from the north. So who is Gog? The two major nations lying north of Jerusalem are Turkey and Russia. Joel Richardson says Gog is Turkey; whereas most CoG Communities say it’s Russia. So who is Gog? We’ll see.

16 And thou shalt come up against My people of Israel as a cloud to cover the land. It shall be in the latter days; and I will bring thee against My land, that the nations may know Me when I shall be sanctified in thee, O Gog, before their eyes.

17 “‘Thus saith the Lord God: Art thou he of whom I have spoken in old times by My servants the prophets of Israel who prophesied in those days many years that I would bring thee against them? — besides Ezekiel, there maybe other prophet/s that spoke of Gog, hence the plural form of prophet.

18 And it shall come to pass at the same time when Gog shall come against the land of Israel, saith the Lord God, that My fury shall come upon My face.

19 For in My jealousy and in the fire of My wrath have I spoken: Surely on that day there shall be a great shaking in the land of Israel,

20 so that the fishes of the sea, and the fowls of the heaven, and the beasts of the field, and all creeping things that creep upon the earth, and all the men that are upon the face of the earth, shall shake at My presence; and the mountains shall be thrown down and the steep places shall fall, and every wall shall fall to the ground. — this scene appears like when the Israelites were at the foot of Mount Sinai when the mountain quaked with thunders getting louder and louder, with Moses speaking with God in a voice also like thunders that frightened the Israelites as written in Exodus 19:18–20.

21 And I will call for a sword against him throughout all My mountains, saith the Lord God. Every man’s sword shall be against his brother. — this will be a civil war within Gog, with numerous nations warring against each other.

22 And I will plead against him with pestilence and with blood; and I will rain upon him and upon his troops and upon the many people that are with him an overflowing rain, and great hailstones, fire, and brimstone. — and I will plead against him with pestilence and with blood…. not only the sword against the confederates and the sword of Gog’s soldiers against one another; but the Lord himself would plead with him by his judgments, or take vengeance on him;

as the Targum; and send a pestilence in his army, which should destroy vast numbers of it; as the army of Sennacherib was destroyed by one when before Jerusalem; and make a great slaughter among them by that and other judgments.

23 Thus will I magnify Myself and sanctify Myself, and I will be known in the eyes of many nations; and they shall know that I am the Lord.’ — “and I will be known in the eyes of many nations” could be known by another term, “the times of the Gentiles.” Lastly, “and they shall know that I am the Lord,” (together with verse 16 “that the nations may know Me”) indicate they’ll have learned their lessons and survive at the end.

Ezekiel (Ch 35-36)

•September 26, 2021 • Leave a Comment

Chapter 35 is a prophecy of the destruction of Edom, who had threatened Israel, their hatred and slaughter of the Israelites, the cause of their downfall.

But who is Edom/Esau today? The answer lies in the book of Obadiah; and Jonathan Targum identifies Esau (Sepharad of the Southland identified) as Spain! Obadiah 1:20; the Targums identified Sepharad with Spain, hence, Spanish Jews are called Sephardim;

Wikipedia: Sepharad (/sɛfəræd/or səˈfɛərəd/ Hebrew: סְפָרַד Sp̄āraḏ; also Sefarad, Sephared, Sfard) is the Hebrew name for Spain. A place called Sepharad, probably referring to Sardis in Lydia (‘Sfard’ in Lydian), in the Book of Obadiah (Obadiah 1:20, 6th century BC) of the Hebrew Bible. The name was later applied to Spain.

Ezekiel 35

1 Moreover the word of the Lord came unto me, saying,

“Son of man, set thy face against Mount Seir, and prophesy against it — Son of man set thy face against Mount Seir…. which had its name from Seir the Horite, who first possessed it; and was succeeded in it by Esau and his posterity, the Edomites; (Genesis 36:8; Deuteronomy 2:12), so that the country of Edom or Idumea is intended here.

and say unto it, ‘Thus saith the Lord God: Behold, O Mount Seir, I am against thee, and I will stretch out Mine hand against thee, and I will make thee most desolate. — behold, O Mount Seir, I am against thee: not the face of the prophet only, but the face of God himself was against them; and a terrible thing it is for any to have God to be against them, whether a nation, or a particular person.

The Targum is, “behold, I send my fury upon thee.”

I will lay thy cities waste, and thou shalt be desolate, and thou shalt know that I am the Lord.

Because thou hast had a perpetual hatred and hast shed the blood of the children of Israel by the force of the sword in the time of their calamity, in the time that their iniquity had an end, — because thou hast had a perpetual hatred…. there was an old grudge and enmity subsisting in the posterity of Esau against the posterity of Jacob, because the latter supplanted the former, and got the birthright and blessing from him;

— it started on the part of Edom led to their refusal of permission for Israel to pass through their land (Numbers 20:14-21); to their invasion of Judah (2 Chronicles 20:10-11); to their aiding Nebuchadnezzar in the overthrow of Jerusalem (Obadiah 1:1,13); and to the outrageous conduct of the Herods and their dynasty against the purposes of God during the days of Christ and the apostles. The Herods were Idumaeans (Edomites). See much more on this in Isaiah 34-43;

(More at the end: “Rage it, rage it, even to the foundation thereof!” Psalm 137:7)

therefore, as I live, saith the Lord God, I will prepare thee for blood, and blood shall pursue thee. Since thou hast not hated blood, even blood shall pursue thee. since thou hast loved cruelty, and taken delight in shedding blood, vengeance and slaughter shall pursue thee, and thou shalt fall into the hands of those that will be as eager to shed blood.

Thus will I make Mount Seir most desolate, and cut off from it him that passeth out and him that returneth.

And I will fill his mountains with his slain men; in thy hills and in thy valleys and in all thy rivers shall they fall that are slain with the sword.

I will make thee perpetual desolations, and thy cities shall not return; and ye shall know that I am the Lord. — thy cities shall not be restored to thee again. This was exactly fulfilled; for the Nabatheans having driven the Edomites out of their ancient habitations, in the time of the Babylonish captivity, they settled themselves in the southern part of Judea, where they were afterward conquered by Hyrcanus, and obliged to embrace the Jewish religion, and so became at length incorporated with that nation. 

Petra Jordan Facts, Ancient City Of Petra Jordan, History - Journey To Egypt
The Ruins of Petra, Jordan – a “Place of Safety” for CoG Communities

10 “‘Because thou hast said, “These two nations and these two countries shall be mine and we will possess it,” though the Lord was there, — “these two nations and these two countries …” these are Israel and Judah, the covenant people after the division of the monarchy, the northern and the southern Israels, Samaria and Jerusalem.

11 therefore, as I live, saith the Lord God, I will even do according to thine anger and according to thine envy which thou hast used out of thy hatred against them; and I will make Myself known among them when I have judged thee.

— Petra, “when I have judged thee” is now described as:

“This land, once so rich in flocks and herds, so mighty in its rock-hewn cities, so extensive in its commercial activities, so renowned for the architectural splendor of its palaces, is now a desolated and deserted wilderness. Its whole population consists of three or four miserable tiny villages. No merchant would now dare to enter it; its highways are unused; its cities are in ruins.”

12 And thou shalt know that I am the Lord, and that I have heard all thy blasphemies which thou hast spoken against the mountains of Israel, saying, “They are laid desolate. They are given us to consume.” — and that I have heard all thy blasphemies which thou hast spoken against the mountains of Israel; the people of Israel and Judah literally, and the churches and people of God figuratively.

13 Thus with your mouth ye have boasted against Me and have multiplied your words against Me; I have heard them.

14 Thus saith the Lord God: When the whole earth rejoiceth, I will make thee desolate.

15 As thou didst rejoice at the inheritance of the house of Israel because it was desolate, so will I do unto thee. Thou shalt be desolate, O Mount Seir, and all Edom, even all of it; and they shall know that I am the Lord.’” — even though all Edom were made desolate, they survive at the end: “and they shall know that I am the Lord.”

and finally the remnant of Israel are not lead into “a place of safety” but are to be “scattered into all the winds.”

. . . and I will execute judgments in thee [Israel], and the whole remnant of thee will I scatter into all the winds Ezekiel 5:10.

~~~

The Lord was asked to remember in Psalms 137 against the Edomites who had asked that Jerusalem be razed to its foundations:

7 Remember, O Lord, the children of Edom in the day of Jerusalem’s fall, who said, “Raze it, raze it, even to the foundation thereof!” Psalms 137:7

To call for the razing of the Temple of God “Raze it, raze it, even to the foundation thereof!” is a heavy crime against the God of the Most High. The Most High dwelled there and these Edomites cheered the Babylonians to burn it down? Madness! Just Madness!!!

Ezekiel 36

1 “Also, thou son of man, prophesy unto the mountains of Israel and say, ‘Ye mountains of Israel, hear the word of the Lord. — “the mountain of Israel;” this prophecy is concerning the desolations of the United States, UK and France. And Israel is judged in relation to the “nations” used 15 times in this chapter alone.

Thus saith the Lord God: Because the enemy hath said against you, “Aha, even the ancient high places are ours in possession,”’ — because the enemy had said against you, aha: rejoicing at the calamity of Israel, particularly the Edomites or Idumeans, as in the preceding chapter; and who are chiefly meant; and also the Ammonites and Tyrians, Ezekiel 25:3.

therefore prophesy and say, ‘Thus saith the Lord God: Because they have made you desolate and swallowed you up on every side, that ye might be a possession unto the residue of the nations, and ye are taken up on the lips of talkers and are an infamy (gossip: the state of being well known for some bad quality or deed; or scoffing) of the people, — and swallowed you up on every side; all their neighbours, being their enemies, were like ravenous beasts of prey, gaping upon them with their mouths; and, observing the low condition into which they were brought by the king of Babylon, helped forward the destruction; and everyone shared in the spoil and plunder nearest to them they could conveniently come at.

therefore, ye mountains of Israel, hear the word of the Lord God. Thus saith the Lord God to the mountains and to the hills, to the rivers and to the valleys, to the desolate wastes and to the cities that are forsaken, which became a prey and derision to the residue of the nations that are round about” — before only the mountains are spoken to, but now, “and to the hills, to the rivers and to the valleys;” these are the hills: Ireland, Switzerland and the Scandinavian countries: Denmark, Norway, and Sweden, Finland, and Iceland; and the valleys, the low countries: Belgium, the Netherlands, and Luxembourg.

therefore thus saith the Lord God: Surely in the fire of My jealousy have I spoken against the residue of the nations and against all Edom, who have appointed My land into their possession with the joy of all their heart, with despiteful minds, to cast it out as a prey.’ — to those neighbouring nations that “have appointed My land into their possession” were Ammon, Moab and Edom.

— with the joy of all their heart, with despiteful minds, to cast it out for a prey; with the utmost joy they joined Nebuchadnezzar’s army when he invaded the land of Judea and besieged Jerusalem, out of pure malice and spite to the people of the Jews, in order to eject them from the possession of their land, that it might become a prey to them; see Psalms 137:7.

Prophesy therefore concerning the land of Israel, and say unto the mountains and to the hills, to the rivers and to the valleys, ‘Thus saith the Lord God: Behold, I have spoken in My jealousy and in My fury, because ye have borne the shame of the nations. — because ye have borne the shame of the nations; their reproaches and scoffings, their injuries and abuses; all which were resented by the Lord.

Therefore thus saith the Lord God: I have lifted up Mine hand. Surely the nations who are about you, they shall bear their shame. — Gill: surely the nations that are about you, they shall bear their shame; the punishment of their shame; that which is justly due to them for reproaching and putting to shame the people of God:

— or they shall be a laughing stock to others, and be reproached and derided themselves, and so be paid in their own coin; a just retaliation this for their treatment of the Jews.

“‘But ye, O mountains of Israel, ye shall shoot forth your branches and yield your fruit to My people of Israel, for they are at hand to come. — ye shall shoot forth your branches; that is, the trees that grew upon them should; the vines, and the olive trees, planted on hills and mountains;

— these could be their colonies: Canada, Australia, New Zealand, South Africa; American Samoa, Guam, the Northern Mariana Islands, Puerto Rico, and the Virgin Islands (US); Anguilla, Bermuda, Cayman Islands, Falkland Islands, Gibraltar, Virgin Islands (UK); Guadeloupe, Martinique, French Guiana, Mayotte, Réunion (France).

For behold, I am for you, and I will turn unto you, and ye shall be tilled and sown.

10 And I will multiply men upon you, all the house of Israel, even all of it; and the cities shall be inhabited and the wastes shall be built. — all the house of Israel, all the tribes of Israel, the ten tribes as well as the other two: for all shall return.

11 And I will multiply upon you man and beast, and they shall increase and bring fruit. And I will settle you according to your old estates, and will do better unto you than at your beginnings; and ye shall know that I am the Lord. — and I will settle you after your old estates; that is, you mountains shall be inhabited by those that formerly dwelt in you, and you shall be enjoyed by your right owners; by those who had you in possession from the beginning, from the times of Joshua; by whom you were settled on them by lot, according to their several tribes. These land to be taken back from Ammon, Moab and Edom (verse 5 above).

12 Yea, I will cause men to walk upon you, even My people Israel; and they shall possess thee and thou shalt be their inheritance, and thou shalt no more henceforth bereave them of men.

13 Thus saith the Lord God: Because they say unto you, “Thou, land, devourest up men and hast bereaved thy nations,”

14 therefore thou shalt devour men no more, neither bereave thy nations any more, saith the Lord God.

15 Neither will I cause men to hear in thee the shame of the nations any more, neither shalt thou bear the reproach of the people any more, neither shalt thou cause thy nations to fall any more, saith the Lord God.’” — neither shalt thou cause thy nations to fall any more, saith the Lord God; by famine, sword, or pestilence, or any other judgment caused by sin:

— or, “thou shalt not bereave” as the marginal reading is; and which the Targum and many versions follow: now what is here promised, in this and the preceding verse, had not its full accomplishment upon the Jews’ return from the Babylonish captivity.

CSB says: I will no longer allow the insults of the nations to be heard against you, and you will not have to endure the reproach of the peoples anymore; you will no longer cause your nation to stumble. This is the declaration of the Lord God.’”

16 Moreover the word of the Lord came unto me, saying,

17 “Son of man, when the house of Israel dwelt in their own land, they defiled it by their own way and by their doings; their way was before Me as the uncleanness of a removed woman.

18 Therefore I poured My fury upon them for the blood that they had shed upon the land and for their idols wherewith they had polluted it.

19 And I scattered them among the nations, and they were dispersed through the countries; according to their way and according to their doings I judged them.

20 And when they entered unto the nation whither they went, they profaned My holy name, when they said to them, ‘These are the people of the Lord, and are gone forth out of His land.’ — they profaned my holy name; by their pornography, sexual immorality and promiscuity, by their violation of both tables of laws; by their gun violence, family breakdown, homelessness;

— and by their use of dirty language while invoking God’s name, whereby they gave the Gentiles an occasion to reproach them, their religion, and their God, Romans 2:24; and not only do they promote LGBTQIA and other filths at home but being hubris and narcissistic they also try to promote and enforce them onto other nations; in doing so “they profaned My holy name,” so said the Lord!

21 But I had pity for Mine holy name, which the house of Israel had profaned among the nations whither they went.

22 “Therefore say unto the house of Israel, ‘Thus saith the Lord God: I do not this for your sakes, O house of Israel, but for Mine holy name’s sake, which ye have profaned among the nations whither ye went.

23 And I will sanctify My great name which was profaned among the nations, which ye have profaned in the midst of them; and the nations shall know that I am the Lord, saith the Lord God, when I shall be sanctified in you before their eyes.

24 For I will take you from among the nations and gather you out of all countries, and will bring you into your own land.

25 “‘Then will I sprinkle clean water upon you, and ye shall be clean; from all your filthiness and from all your idols will I cleanse you.

26 A new heart also will I give you and a new spirit will I put within you; and I will take away the stony heart out of your flesh, and I will give you a heart of flesh.

27 And I will put My Spirit within you and cause you to walk in My statutes, and ye shall keep My judgments and do them.

28 And ye shall dwell in the land that I gave to your fathers; and ye shall be My people, and I will be your God. and ye shall dwell in the land which I gave to your fathers…. not only shall be brought into it, but shall inhabit it, and continue there, and that in great safety and plenty; because this land between the rivers is the gift of God, and what he gave to their fathers, Abraham, Isaac, and Jacob, by promise so long ago, and to their seed.

29 “‘I will also save you from all your uncleannesses; and I will call for the corn and will increase it, and lay no famine upon you.

30 And I will multiply the fruit of the tree and the increase of the field, that ye shall receive no more reproach of famine among the nations.

31 Then shall ye remember your own evil ways and your doings that were not good, and shall loathe yourselves in your own sight for your iniquities and for your abominations.

32 Not for your sakes do I this, saith the Lord God, be it known unto you: be ashamed and confounded for your own ways, O house of Israel!

33 “‘Thus saith the Lord God: In the day that I shall have cleansed you from all your iniquities I will also cause you to dwell in the cities, and the wastes shall be rebuilt.

34 And the desolate land shall be tilled, whereas it lay desolate in the sight of all that passed by.

35 And they shall say, “This land that was desolate has become like the Garden of Eden, and the waste and desolate and ruined cities have become fortified and are inhabited.”

36 Then the nations that are left round about you shall know that I, the Lord, build the ruined places and plant that which was desolate. I, the Lord, have spoken it, and I will do it.’

37 “Thus saith the Lord God: I will yet for this be inquired of by the house of Israel to do it for them. I will increase them with men like a flock.

38 As the holy flock, as the flock of Jerusalem in her solemn feasts, so shall the waste cities be filled with flocks of men; and they shall know that I am the Lord.” — God said of the house of Israel that “they shall know that I am the Lord” this implies that they do not know God at this time, despite many claim they are Christians, a few pretentious at best. How could they? In today’s world of professing Christians, no less than 99.99 percent of them don’t even know the Oracles of God!

Ezekiel (Ch 33-34)

•September 25, 2021 • Leave a Comment

Chapter 33 specifies the duty of watchman, and the people’s sins; contains a vindication of the justice of God; a threatening of destruction to those who remained in the land after the taking of the city; and in chapter 34, a hypocrisy of the prophets who choose to feed themselves than feed the flock. Earlier, we have established that although Ezekiel has his face set toward Jerusalem, this prophecy is meant for the house of Israel at the endtime “for many years to come” (Ezekiel 12:27). And, here, remember, the house of Israel is primarily the United States of America, and secondarily its European allies. . .

Ezekiel 33

1 Again the word of the Lord came unto me, saying,

“Son of man, speak to the children of thy people and say unto them: ‘When I bring the sword upon a land, if the people of the land take a man from their borders and set him as their watchman, and

if when he seeth the sword come upon the land, he blow the trumpet and warn the people, — if what he seeth the sword come upon the land…. or those that kill with the sword, as the Targum; as soon as he observes a body of armed men, more or less, marching towards the borders of the land with a manifest intention to enter and invade it;

he blow the trumpet, and warn the people; warn the people by blowing the trumpet, the signal agreed on; by which they would understand that an enemy was at hand, or danger near; or warn them by word of mouth, as well as by the trumpet, where he could do it, and when it was necessary.

then whosoever heareth the sound of the trumpet and taketh not warning, if the sword come and take him away, his blood shall be upon his own head.

He heard the sound of the trumpet and took not warning: his blood shall be upon him. But he that taketh warning shall deliver his soul.

But if the watchman see the sword come and blow not the trumpet, and the people be not warned, if the sword come and take any person from among them, he is taken away in his iniquity; but his blood will I require at the watchman’s hand.’ — but his blood will I require at the watchman’s hands; he shall be punished for not doing his duty, for not giving the due warning of danger, on which account the man was surprised with the enemy, and taken away unawares; and therefore his death shall be laid to the watchman, and he must be answerable for it.

“So thou, O son of man, I have set thee as a watchman unto the house of Israel. Therefore thou shalt hear the word at My mouth and warn them from Me. — this prophecy is meant for the house of Israel which is primarily the United States of America, and secondarily its European allies.

When I say unto the wicked, ‘O wicked man, thou shalt surely die,’ if thou dost not speak to warn the wicked from his way, that wicked man shall die in his iniquity; but his blood will I require at thine hand

Nevertheless, if thou warn the wicked of his way to turn from it, if he do not turn from his way, he shall die in his iniquity; but thou hast delivered thy soul.

10 “Therefore, O thou son of man, speak unto the house of Israel: ‘Thus ye speak, saying, “If our transgressions and our sins be upon us and we pine away in them, how should we then live?”’ — “the house of Israel” reemphasizing a prophecy which is meant for the United States and its European allies.

11 Say unto them: ‘As I live, saith the Lord God, I have no pleasure in the death of the wicked, but that the wicked turn from his way and live. Turn ye, turn ye from your evil ways; for why will ye die, O house of Israel?’

12 Therefore, thou son of man, say unto the children of thy people: ‘The righteousness of the righteous shall not deliver him in the day of his transgression. As for the wickedness of the wicked, he shall not fall thereby in the day that he turneth from his wickedness, neither shall the righteous be able to live for his righteousness in the day that he sinneth.’

13 When I shall say to the righteous that he shall surely live, if he trust to his own righteousness and commit iniquity, all his righteousnesses shall not be remembered; but for his iniquity that he hath committed, he shall die for it.

14 Again, when I say unto the wicked, ‘Thou shalt surely die,’ if he turn from his sin and do that which is lawful and right,

15 if the wicked restore the pledge, give back that which he had robbed, walk in the statutes of life without committing iniquity, he shall surely live; he shall not die.

16 None of his sins that he hath committed shall be mentioned unto him. He hath done that which is lawful and right: he shall surely live.

17 “Yet the children of thy people say, ‘The way of the Lord is not equal.’ But as for them, their way is not equal. — instead of turning away and by repenting, the house of Israel complains even further; that His way is not according to the rules of justice and equity.

18 When the righteous turneth from his righteousness and committeth iniquity, he shall even die thereby.

19 But if the wicked turn from his wickedness and do that which is lawful and right, he shall live thereby.

20 Yet ye say, ‘The way of the Lord is not equal.’ O ye house of Israel, I will judge you every one according to his ways.” — still obstinately persisting in their false charges as their complaint repeated: “The way of the Lord is not equal.”

21 And it came to pass in the twelfth year of our captivity, in the tenth month, on the fifth day of the month, that one who had escaped out of Jerusalem came unto me, saying, “The city is smitten!” — that one that had escaped out of Jerusalem came unto me; as it was foretold and promised he should, Ezekiel 24:26;

saying, the city is smitten; the city of Jerusalem; the walls were broken down, the houses burnt, and the whole destroyed.

22 Now the hand of the Lord was upon me in the evening before he that had escaped came, and He had opened my mouth until he came to me in the morning; and my mouth was opened, and I was no more dumb. — and had opened my mouth, until he came to me in the morning; the hand of the Lord, or the power of the Lord, had done it, as he promised he would, Ezekiel 3:26-27 so that he spoke freely and boldly.

23 Then the word of the Lord came unto me, saying,

24 “Son of man, they that inhabit those wastes in the land of Israel speak, saying, ‘Abraham was one, and he inherited the land. But we are many; the land is given us for inheritance.’ — ‘if Abraham, being only a single person, had the whole region of Judea and Samaria (and more) given him, there is much greater reason to conclude, that God will preserve the possession of more to us, who are a numerous part of Abraham’s posterity.’

25 Therefore say unto them, ‘Thus saith the Lord God: Ye eat meat with the blood, and lift up your eyes toward your idols, and shed blood. And shall ye possess the land?

26 Ye stand upon your sword, ye work abomination, and ye defile every one his neighbor’s wife. And shall ye possess the land?’

27 Say thou thus unto them, ‘Thus saith the Lord God: As I live, surely they that are in the wastes shall fall by the sword, and him that is in the open field will I give to the beasts to be devoured, and they that are in the forts and in the caves shall die of the pestilence. — and him that is in the open field will I give to the beasts to be devoured; a reminder of “so will I send upon you famine and evil beasts” Ezekiel 5:17.

Ezekiel 14:21“For thus saith the Lord God: How much more when I send My four sore judgments upon Jerusalem — the sword and the famine and the noisome beast and the pestilence — to cut off from it man and beast?

28 For I will lay the land most desolate, and the pomp of her strength shall cease; and the mountains of Israel shall be desolate, that none shall pass through.

29 Then shall they know that I am the Lord, when I have laid the land most desolate because of all their abominations which they have committed.’

30 “Also, thou son of man, the children of thy people still are talking against thee by the walls and in the doors of the houses, and speak one to another, every one to his brother, saying, ‘Come, I pray you, and hear what is the word that cometh forth from the Lord.’ — every man to his brother, saying, come, l pray you, and hear what is the word that cometh forth from the Lord; let us go perhaps we shall hear some new thing, which may be pleasing.

31 And they come unto thee as the people cometh, and they sit before thee as My people, and they hear thy words, but they will not do them; for with their mouth they show much love, but their heart goeth after their covetousness.

32 And lo, thou art unto them as a very lovely song of one that hath a pleasant voice and can play well on an instrument; for they hear thy words, but they do them not.

33 And when this cometh to pass — lo, it will come — then shall they know that a prophet hath been among them.” — and when this cometh to pass…. the prophecy before delivered out, concerning the desolations in the land of Israel, by the sword, pestilence, and wild beasts;

lo, it will come; whatever is predicted by the Lord; in the mouth of his prophets, certainly comes to pass: then shall they know that a prophet hath been among them; that Ezekiel was one such prophet by the exact accomplishment of his predictions.

Ezekiel 34

In this chapter, God is against the shepherds of Israel, that is, their rulers, both in church and state, are called to an account, as having been very much accessory to the sin and ruin of Israel, by their neglect of the duties of their station.

1 And the word of the Lord came unto me, saying,

“Son of man, prophesy against the shepherds of Israel, prophesy and say unto them, ‘Thus saith the Lord God unto the shepherds: Woe be to the shepherds of Israel that feed themselves! Should not the shepherds feed the flocks?

Ye eat the fat, and ye clothe yourselves with the wool, ye kill the ones that are fed; but ye feed not the flock. — but ye feed not the flock; did not govern the people well, by doing justice and judgment among men, as became civil magistrates; did not deliver out words of faith and sound teachings, to feed the minds of men with, which is the duty of those that preside in the church of God.

The diseased have ye not strengthened, neither have ye healed that which was sick, neither have ye bound up that which was broken, neither have ye brought again that which was driven away, neither have ye sought that which was lost; but with force and with cruelty have ye ruled them.

And they were scattered because there is no shepherd, and they became meat to all the beasts of the field when they were scattered. — and they became meat to all beasts of the field when they were scattered; the Targum says, “and they were delivered to all the kingdoms of the people to be consumed;”

— such as the Assyrians, Babylonians, Ammonites, Moabites, and others; and may be applied to false teachers, those grievous wolves, which spare not the flock, into whose hands members of churches, professors of religion, fall, when neglected by their shepherds.

My sheep wandered through all the mountains and upon every high hill; yea, My flock was scattered upon all the face of the earth, and none did search or seek after them.

“‘Therefore, ye shepherds, hear the word of the Lord:

As I live, saith the Lord God, surely because My flock became a prey and My flock became meat to every beast of the field because there was no shepherd, neither did My shepherds search for My flock, but the shepherds fed themselves and fed not My flock,

therefore, O ye shepherds, hear the word of the Lord.

10 Thus saith the Lord God: Behold, I am against the shepherds; and I will require My flock at their hand and cause them to cease from feeding the flock, neither shall the shepherds feed themselves any more. For I will deliver My flock from their mouth, that they may not be meat for them. — thus saith the Lord, Behold, I am against the shepherds; they have made me their enemy by their negligence and abuse of their power, and I will appear and act as such; they have been enemies to my sheep, though pretending to be their shepherds;

— I will be an open enemy to them; and will require my flock at their hands; I will require a severe account from their kings and princes, their priests and prophets.

11 “‘For thus saith the Lord God: Behold I, even I, will both search My sheep and seek them out.

12 As a shepherd seeketh out his flock on the day that he is among his sheep that are scattered, so will I seek out My sheep and will deliver them out of all places where they have been scattered on the cloudy and dark day.

13 And I will bring them out from the people and gather them from the countries, and will bring them to their own land, and feed them upon the mountains of Israel by the rivers and in all the inhabited places of the country.

14 I will feed them in a good pasture, and upon the high mountains of Israel shall their fold be; there shall they lie in a good fold, and in a fat pasture shall they feed upon the mountains of Israel.

15 I will feed My flock, and I will cause them to lie down, saith the Lord God.

16 I will seek that which was lost and bring back that which was driven away, and will bind up that which was broken and will strengthen that which was sick. But I will destroy the fat and the strong: I will feed them with judgment. — I will feed them with judgment; I will judge, chastise, and punish them.

17 “‘And as for you, O My flock, thus saith the Lord God: Behold, I judge between cattle and cattle, between the rams and the hegoats. — behold, I judge between cattle and cattle, between the rams and the he goats: between the smaller and weaker cattle, the sheep and the lambs; now, the Lord, as he observed a difference between them, he would make this manifest, and take the part of the one against the other; even the part of the weaker against the stronger.

— the Targum says, “behold, judge between man and man, sinners and the ungodly.”

18 Seemeth it a small thing unto you to have eaten up the good pasture, but ye must tread down with your feet the residue of your pastures? And to have drunk of the deep waters, but ye must foul the residue with your feet?

19 And as for My flock, they eat that which ye have trodden with your feet, and they drink that which ye have fouled with your feet.

20 “‘Therefore thus saith the Lord God unto them: Behold I, even I, will judge between the fat cattle and between the lean cattle. — behold, I, even I, will judge between the fat cattle and between the lean cattle. The Targum says, “between the rich man and the poor man.”

21 Because ye have thrust with side and with shoulder, and pushed all the diseased with your horns till ye have scattered them abroad,

22 therefore will I save My flock, and they shall no more be a prey; and I will judge between cattle and cattle.

23 And I will set up one Shepherd over them, and He shall feed them, even My servant David. He shall feed them, and He shall be their Shepherd. — perhaps this indicates the reunion of the Northern and Southern kingdoms of the old and new Israel.

24 And I, the Lord, will be their God, and My servant David a prince among them. I, the Lord, have spoken it.

25 “‘And I will make with them a covenant of peace, and will cause the evil beasts to cease out of the land; and they shall dwell safely in the wilderness and sleep in the woods.

26 And I will make them and the places round about My hill a blessing, and I will cause the shower to come down in his season; there shall be showers of blessing.

27 And the tree of the field shall yield her fruit and the earth shall yield her increase, and they shall be safe in their land and shall know that I am the Lord, when I have broken the bands of their yoke and delivered them out of the hand of those that served themselves by them.

28 And they shall no more be a prey to the nations, neither shall the beast of the land devour them; but they shall dwell safely, and none shall make them afraid.

29 And I will raise up for them a plant of renown, and they shall be no more consumed with hunger in the land, neither bear the shame of the nations any more.

30 Thus shall they know that I, the Lord their God, am with them, and that they, even the house of Israel, are My people, saith the Lord God.

31 And ye My flock, the flock of My pasture, are men, and I am your God, saith the Lord God.’” — these words at the conclusion of the chapter, explain the metaphor which runs through the whole of it; namely, that what was said of a flock and its shepherds, is to be understood of men and their governors;

— and of God’s people, whom their ecclesiastical ministers misled and oppressed, but whom God watches over, provides for, and takes care as a shepherd does. This too lays an obligation upon civil princes and magistrates, to govern faithfully and justly the people committing their trust.

Ezekiel (Ch 31-32)

•September 24, 2021 • Leave a Comment

Chapter 31 opens with the Lord speaking to the Pharaoh of Egypt, giving him an example of Assyria, and to anyone else, as a warning of what could happen to them (or us) too.

Ezekiel 31

1 And it came to pass in the eleventh year, in the third month, on the first day of the month, that the word of the Lord came unto me, saying,

“Son of man, speak unto Pharaoh king of Egypt and to his multitude: “‘Whom art thou like in thy greatness?

Behold, the Assyrian was a cedar in Lebanon with fair branches, and with a shadowing shroud, and of a high stature; and his top was among the thick boughs. — behold, the Assyrian was a cedar in Lebanon…. the king of Assyria is compared to a large and flourishing cedar, for the extent of his dominions, the prosperous state of his empire, and his exaltation above all other princes, which drew upon him their envy. Here grew the tallest, most stately, broad and flourishing ones.

The waters made him great, the deep set him up on high with her rivers running round about his plants, and sent out her little rivers unto all the trees of the field. — the waters made him great…. the waters of the river Tigris, near to which stood the city of Nineveh, the metropolis of the Assyrian monarchy; the traffic brought by which river made it rich and great, and the whole empire, and the king of it.

Therefore his height was exalted above all the trees of the field, and his boughs were multiplied, and his branches became long because of the multitude of waters when he shot forth.

All the fowls of heaven made their nests in his boughs, and under his branches did all the beasts of the field bring forth their young; and under his shadow dwelt all great nations. — and under his shadow dwelt all great nations; under his protection, care, and government, many large kingdoms and states were; yea, all were either subject to him, or sought to be his friends and allies: this explains the above figurative expressions;

— the Targum says, “by his army he subdued all the strong towers; and under his governors he subjected all the provinces of the earth; and in the shadow of his kingdom dwelt all the numerous people.”

Thus was he fair in his greatness, in the length of his branches, for his root was by great waters.

The cedars in the garden of God could not hide him; the fir trees were not like his boughs, and the chestnut trees were not like his branches, nor any tree in the garden of God was like unto him in his beauty.

I have made him fair by the multitude of his branches, so that all the trees of Eden that were in the garden of God envied him. — so that all the trees of Eden, that were in the garden of God, envied him; all the kings of the earth, though they dared not openly speak against him, or oppose him; yet they inwardly grieved at and secretly grudged his grandeur and majesty, superior to theirs;

— the Targum says, “I have made him beautiful by the multitude of his mighty ones; and all the kings of the east trembled before him, because of the strength of his power, which he had from the Lord.”

10 “‘Therefore thus saith the Lord God: Because thou hast lifted up thyself in height, and he hath shot up his top among the thick boughs, and his heart is lifted up in his height,

11 I have therefore delivered him into the hand of the mightiest of the nations. He shall surely deal with him. I have driven him out for his wickedness.

12 And strangers, the terrible of the nations, have cut him off and have left him. Upon the mountains and in all the valleys his branches are fallen, and his boughs are broken by all the rivers of the land; and all the people of the earth are gone down from his shadow and have left him.

13 Upon his ruin shall all the fowls of the heaven remain, and all the beasts of the field shall be upon his branches,

14 to the end that none of all the trees by the waters exalt themselves for their height, neither shoot up their top among the thick boughs, neither their trees stand up in their height—all that drink water. For they are all delivered unto death, to the nether parts of the earth, in the midst of the children of men, with them that go down to the pit. — for they are delivered unto death in the nether parts of the earth; they are mortal by nature, as other men; they are appointed to die, and will be delivered into the hands of death, when the time is come, who will not spare them because of their crowns and sceptres; and when they will be laid in the grave, in the lowest parts of the earth, who used to sit upon elevated thrones of state.

15 “‘Thus saith the Lord God: In the day when he went down to the grave I caused a mourning. I covered the deep for him, and I restrained the floods thereof, and the great waters were stayed; and I caused Lebanon to mourn for him, and all the trees of the field fainted for him.

16 I made the nations to shake at the sound of his fall, when I cast him down to hell with them that descend into the pit; and all the trees of Eden, the choice and best of Lebanon, all that drink water, shall be comforted in the nether parts of the earth. — and all the trees of Eden, the choice and best of Lebanon, all that drink water; the greatest kings and potentates of the world, the chief and principal of the Assyrian empire; all that ruled over multitudes of people, and partook of their wealth and riches, and were supported in grandeur and dignity; who had been in the state of the dead before this time.

17 They also went down into hell with him unto them that are slain with the sword, and they that were his arm, that dwelt under his shadow in the midst of the nations.

18 To whom art thou thus like in glory and in greatness among the trees of Eden? Yet shalt thou be brought down with the trees of Eden unto the nether parts of the earth. Thou shalt lie in the midst of the uncircumcised with them that are slain by the sword. “‘This is Pharaoh and all his multitude, saith the Lord God.’” — this is Pharaoh, and all his multitude, saith the Lord God; this account represents Pharaoh, his grandeur, his pride, and his ruin; this shows what will be the end of him, and of his numerous subjects. The Septuagint renders it, “so will be Pharaoh” in like manner will he fall, and all his people with him for the Lord God has said it, and it shall assuredly come to pass.

the Targum says, “to whom art thou like now in glory and greatness among the kings of the east? and thou shall be brought down with the kings of the east into the lower part of the earth; in the midst of sinners thou shalt sleep, with those that are slain by the sword; this is Pharaoh, and all his multitude, saith the Lord God.”

Ezekiel 32

Chapter 32 opens with a lamentation for the Pharaoh of Egypt, giving him a warning of being carried away by Babylon.

1 And it came to pass in the twelfth year, in the twelfth month, on the first day of the month, that the word of the Lord came unto me, saying,

“Son of man, take up a lamentation for Pharaoh king of Egypt and say unto him, “‘Thou art like a young lion of the nations, and thou art as a whale in the seas; and thou camest forth with thy rivers, and troubled the waters with thy feet and fouled their rivers. — thou art like a young lion of the nations; for strength and fierceness, for cruelty and tyranny.

“‘Thus saith the Lord God: I will therefore spread out My net over thee with a company of many people; and they shall bring thee up in My net. — the king of Egypt is compared to a large fish taken in a net, and brought to land, and left on it, to be the prey of the fowls of the air and beasts of the field.

Then will I leave thee upon the land; I will cast thee forth upon the open field and will cause all the fowls of the heaven to remain upon thee, and I will fill the beasts of the whole earth with thee.

And I will lay thy flesh upon the mountains, and fill the valleys with thy height.

I will also water with thy blood the land wherein thou swimmest, even to the mountains; and the rivers shall be full of thee.

And when I shall put thee out, I will cover the heaven and make the stars thereof dark; I will cover the sun with a cloud, and the moon shall not give her light.

All the bright lights of heaven will I make dark over thee, and set darkness upon thy land, saith the Lord God.

“‘I will also vex the hearts of many people when I shall bring thy destruction among the nations, into the countries which thou hast not known. — and the ruin of that kingdom is further amplified by the casting of it on the mountains and valleys; by the land flowing with its blood; by the darkness of the heavens; by the vexation in the hearts of many people; and by the amazement of kings and nations.

10 Yea, I will make many people amazed at thee, and their kings shall be horribly afraid for thee when I shall brandish My sword before them; and they shall tremble at every moment, every man for his own life, in the day of thy fall.

11 “‘For thus saith the Lord God: The sword of the king of Babylon shall come upon thee;

12 by the swords of the mighty will I cause thy multitude to fall, the terrible of the nations, all of them. And they shall despoil the pomp of Egypt, and all the multitude thereof shall be destroyed. — “thy multitude” this is not talking of the Pharaoh but its people.

13 I will destroy also all the beasts thereof from beside the great waters; neither shall the foot of man trouble them any more, nor the hoofs of beasts trouble them.

14 Then will I make their waters deep, and cause their rivers to run like oil, saith the Lord God.

15 When I shall make the land of Egypt desolate, and the country shall be destitute of that whereof it was full, when I shall smite all them that dwell therein, then shall they know that I am the Lord.’ — “then shall they know that I am the Lord” indicates they wouldn’t be put an end to, but come to know that God is known for his omnipotence, omniscience, holiness, justice, and by the judgments He executes.

16 “This is the lamentation wherewith they shall lament her. The daughters of the nations shall lament her; they shall lament for her, even for Egypt, and for all her multitude, saith the Lord God.”

— scatter or scattered the Egyptians; found 4 times in Ezekiel 29:12,13; 30:23,26; disperse/d: found 3 times in Ezekiel 29:12, 30:23,26.

17 It came to pass also in the twelfth year, on the fifteenth day of the month, that the word of the Lord came unto me, saying,

18 “Son of man, wail for the multitude of Egypt and cast them down, even her and the daughters of the famous nations, unto the nether parts of the earth with them that go down into the pit. — “wail for the multitude of Egypt and cast them down. . . unto the nether parts of the earth” — the Gypsies, an ethnic group of traditionally itinerant people now living in various parts of central Europe and the Balkans (Romania, Bulgaria, Serbia, Montenegro, Macedonia, Croatia, Bosnia and Herzegovina, Slovenia, the Czech and Slovak republics, and Hungary) and Southern France, as well as Turkey;

but allegedly to have originated from northern India, yet only scanty evidence are given and none seems to be living there today. In fact all evidence point to the fact that they have originated from Egypt, and scattered around various countries (Ezekiel 29:12 “And I will make the land of Egypt desolate in the midst of the countries that are desolate, and her cities among the cities that are laid waste shall be desolate forty years; and I will scatter the Egyptians among the nations and will disperse them through the countries”).

Wiki: Distribution of Egipciens in Europe (about 10 million)

today, Gypsies are known as Roma, but in Hebrew, their name is derived from the Egyptian city of Zoan, known as “the royal city of the Pharaohs” or Tanis (as the Targum says), at one time the royal and capital of the country; and this is from Wikipedia (Romani people):

Hebrew: צוענים‎, romanized: Tzoanim. Derives either from the biblical Egyptian city of Zoan, or from the linguistic root צ־ע־נ‎, meaning “wander”

The English term Gypsy (or Gipsy) originates from the Middle English gypcian, short for Egipcien.

— and from the French entry:

French: gitan/tsigane, English gypsygipsy / dʒɪpsiː/, Irish: giofóg, Spanish/Catalan/Italian gitano, Basque: ijito, Turkish: çingene, all from Greek: Αἰγύπτιος, romanized: Aigýptios “Egyptian” (corrupted form: Γύφτος, Gýftos), and Hungarian: fáraónépe from Greek: φαραώ, romanized: pharaó “pharaoh” – referring to their allegedly Egyptian provenance.

19 ‘Whom dost thou pass in beauty? Go down, and be thou laid with the uncircumcised.’ — instead of “the nations” it’s the uncircumcised used 10 times with a pejorative connotation in this chapter alone;

go down, and be thou laid with the uncircumcised; go down to the grave, and take thy place, and lie there among the wicked and most profligate of mankind, and such as might be most despised by the Egyptians, since they used circumcision.

the Targum says, “go down and sleep with sinners.”

20 They shall fall in the midst of them that are slain by the sword. She is delivered to the sword; draw her and all her multitudes.

21 The strong among the mighty shall speak to him out of the midst of hell with them that help him: ‘They are gone down; they lie uncircumcised, slain by the sword.’

22 “Assyria is there and all her company; his graves are about him, all of them slain, fallen by the sword, — Ashur is there, and all her company…. in the state of the dead, or in a most desolate and ruinous condition; the great Assyrian monarchy, the kings of it, the princes, nobles, generals, soldiers, and the vast number of subjects in all the dominions of it; all his army.

23 whose graves are set in the sides of the pit and her company is round about her grave; all of them slain, fallen by the sword, which caused terror in the land of the living.

24 “There is Elam and all her multitude round about her grave, all of them slain, fallen by the sword, who are gone down uncircumcised into the nether parts of the earth, who caused their terror in the land of the living; yet have they borne their shame with them that go down to the pit.

25 They have set her a bed in the midst of the slain with all her multitude. Her graves are round about him, all of them uncircumcised, slain by the sword. Though their terror was caused in the land of the living, yet have they borne their shame with them that go down to the pit. He is put in the midst of them that are slain.

26 “There is Meshech, Tubal, and all her multitude. Her graves are round about him, all of them uncircumcised, slain by the sword, though they caused their terror in the land of the living.

27 And they shall not lie with the mighty that are fallen of the uncircumcised, who are gone down to hell with their weapons of war; and they have laid their swords under their heads, but their iniquities shall be upon their bones, though they were the terror of the mighty in the land of the living.

28 Yea, thou shalt be broken in the midst of the uncircumcised, and shalt lie with them that are slain with the sword. — the word “sword” is used 16 times, mostly about being slain or fell by the sword in this chapter along, showing much emphasis about how their fate lies.

29 “There is Edom, her kings and all her princes, who with their might are laid by them that were slain by the sword. They shall lie with the uncircumcised and with them that go down to the pit.

30 “There are the princes of the north, all of them, and all the Sidonians, who are gone down with the slain. With their terror they are ashamed of their might, and they lie uncircumcised with them that are slain by the sword, and bear their shame with them that go down to the pit.

31 “Pharaoh shall see them, and shall be comforted over all his multitude, even Pharaoh and all his army slain by the sword, saith the Lord God.

32 For I have caused My terror in the land of the living; and he shall be laid in the midst of the uncircumcised with them that are slain with the sword, even Pharaoh and all his multitude, saith the Lord God.” — Egypt was described as “the great dragon that lieth in the midst of his river” (Ezekiel 29:3) are now being “are slain with the sword, even Pharaoh and all his multitude.” What a drastic fall!

Under “Romani people” from Wikipedia:

The English term Gypsy (or Gipsy) originates from the Middle English gypcian, short for Egipcien. The Spanish term Gitano and French Gitan have similar etymologies. They are ultimately derived from the Greek Αιγύπτιοι (Aigyptioi), meaning Egyptian, via Latin. This designation owes its existence to the belief, common in the Middle Ages, that the Romani, or some related group (such as the Middle Eastern Dom people), were itinerant Egyptians. This belief appears to be derived from verses in the Biblical Book of Ezekiel (29:6 and 12–13) which refer to the Egyptians being scattered among the nations by an angry God.  In his book The Zincali: an account of the Gypsies of Spain, George Borrow notes that when they first appeared in Germany, it was under the character of Egyptians doing penance for their having refused hospitality to Mary and her son. As described in Victor Hugo’s novel The Hunchback of Notre Dame, the medieval French referred to the Romanies as Egyptiens.

Ezekiel (Ch 29-30)

•September 23, 2021 • Leave a Comment

Chapters 29-30 contain a prophecy against the Pharaoh of Egypt and of its destruction and restoration and show how the God of Israel will be manifested to them and to all the rest of the nations.

Ezekiel 29

1 In the tenth year, in the tenth month, on the twelfth day of the month, the word of the Lord came unto me, saying,

“Son of man, set thy face against Pharaoh king of Egypt, and prophesy against him and against all Egypt. — to prophesy against indicates something bad is to happen.

Speak, and say, ‘Thus saith the Lord God: “‘Behold, I am against thee, Pharaoh king of Egypt, the great dragon that lieth in the midst of his rivers, which hath said, “My river is mine own, and I have made it for myself.” — the great dragon that lieth in the midst of his rivers; the chief river of Egypt was the Nile, which opened in seven mouths or gates into the sea, and out of which canals were made to water the whole land; and which abounding with rivers and watery places, hence the king of it is compared to a great fish, a dragon.

But I will put hooks in thy jaws, and I will cause the fish of thy rivers to stick unto thy scales; and I will bring thee up out of the midst of thy rivers, and all the fish of thy rivers shall stick unto thy scales.

And I will leave thee thrown into the wilderness, thee and all the fish of thy rivers; thou shalt fall upon the open fields. Thou shalt not be brought together, nor gathered. I have given thee for meat to the beasts of the field and to the fowls of the heaven.

And all the inhabitants of Egypt shall know that I am the Lord, because they have been a staff of reed to the house of Israel. “And all the inhabitants of Egypt shall know that I am the Lord,” indicates they survive at the end.

When they took hold of thee by thy hand, thou didst break and rend all their shoulder; and when they leaned upon thee, thou brokest and madest all their loins to be at a halt.

“‘Therefore thus saith the Lord God: Behold, I will bring a sword upon thee, and cut off man and beast out of thee.

And the land of Egypt shall be desolate and waste; and they shall know that I am the Lord, because he hath said, “The river is mine, and I have made it.” — and the land of Egypt shall be desolate and waste…. men few or none being left in it, to till it, nor cattle found upon it.

10 “‘Behold, therefore I am against thee and against thy rivers, and I will make the land of Egypt utterly waste and desolate, from the tower of Syene even unto the border of Ethiopia.

11 No foot of man shall pass through it, nor foot of beast shall pass through it, neither shall it be inhabited forty years.

12 And I will make the land of Egypt desolate in the midst of the countries that are desolate, and her cities among the cities that are laid waste shall be desolate forty years; and I will scatter the Egyptians among the nations and will disperse them through the countries. — and I will scatter the Egyptians among the nations, and will disperse them through the countries; such as were not carried captive into Babylon fled into other countries, as Arabia, Ethiopia, Romania, Bulgaria, and other places. Are these scattered Egyptians the Egyptiens, the Egipcien, who later are better known as Gypsies? More evidence and comments in Ezekiel 32.

Wiki: Distribution of Egipciens in Europe (about 10 million)

13 “‘Yet thus saith the Lord God: At the end of forty years will I gather the Egyptians from the people whither they were scattered. — yet thus saith the Lord God, at the end of forty years…whither they were scattered. Reckoning from its devastation by Nebuchadnezzar to the taking of Babylon by Cyrus and scattered around various countries.

14 And I will bring back the captives of Egypt and will cause them to return into the land of Pathros, into the land of their habitation, and they shall be there a base kingdom. — and they shall be there a base kingdom; Egypt throughout all subsequent history has continued to remain a nation of secondary strength and importance: Babylon dominated her; then Persia dominated her; then the Greeks under Alexander the Great were her masters; after them came the Seleucids, and still later the Romans, the Ottomans, the British; the Egyptians never had a strong king of their own to reign over them.

15 It shall be the least of the kingdoms, neither shall it exalt itself any more above the nations; for I will diminish them, that they shall no more rule over the nations. — for I will demolish them, that they shall no more rule over the nations; for though they made war upon other nations yet they did not subdue them, nor annex them, being much weakened both as to men and money.

16 And it shall be no more the confidence of the house of Israel which bringeth their iniquity to remembrance when they shall look after them; but they shall know that I am the Lord God.’ — Rashi: and it will no longer be: [i.e.] Egypt [will no longer be] a source of confidence for the House of Israel, bringing iniquity into remembrance for them, since the Holy One, blessed be he, said to them (Exod. 14: 13): “You shall no longer continue to see them.” — the house of Israel will no longer see Egypt as a great nation.

“but they shall know that I am the Lord God,” reaffirms they survive at the end.

17 And it came to pass in the seven and twentieth year, in the first month, on the first day of the month, the word of the Lord came unto me, saying,

18 “Son of man, Nebuchadnezzar king of Babylon caused his army to serve a hard service against Tyre: every head was made bald and every shoulder was peeled; yet had he no wages, nor his army, from Tyre for the service that he had served against it.

19 Therefore thus saith the Lord God: Behold, I will give the land of Egypt unto Nebuchadnezzar king of Babylon; and he shall take her multitude, and take her spoil, and take her prey; and it shall be the wages for his army.

Coffman: Despite the fall of Tyre and its subsequent domination under a high commissioner from Babylon, Nebuchadnezzar received no significant spoil from its capture. Many have suggested that perhaps Tyre had had sufficient time to ship all of their treasures elsewhere.

— Egypt may well have been a cooperating partner with Tyre in such a project, giving credence to suggestion that such actions on Egypt’s part would have been a sufficient “casus belli” to result in Nebuchadnezzar’s immediate declaration of war against Egypt.

20 I have given him the land of Egypt for his labor for which he served against it, because they wrought for Me, saith the Lord God. — and while the Babylonians besieged Tyre, the Egyptians came to Tyre’s aid. Thus God deemed it right for the Babylonians to ravage, plunder and subdue Egypt: they were doing Lord’s will and executing his righteous judgments on these enemies for their offenses.

21 “In that day will I cause the horn of the house of Israel to bud forth, and I will give thee the opening of the mouth in the midst of them; and they shall know that I am the Lord.”

“and they shall know that I am the Lord,” repeated four times (verses 6, 9, 16, 21) reaffirms they survive at the end.

Ezekiel 30

1 The word of the Lord came again unto me, saying,

“Son of man, prophesy and say, ‘Thus saith the Lord God: “‘Howl ye, “Woe be the day!”

For the day is near; even the day of the Lord is near, a cloudy day; it shall be the time of the nations. — this is also called the “the time of the Gentile [H1471 gō·w·yim],” but what does it mean?

And the sword shall come upon Egypt, and great pain shall be in Ethiopia when the slain shall fall in Egypt; and they shall take away her multitude, and her foundations shall be broken down. — great pain shall be upon Ethiopia; great trouble and distress; when the slain shall fall in Egypt.

Ethiopia, and Libya, and Lydia, and all the mingled people, and Chub, and the men of the land that is in league, shall fall with them by the sword.

“‘Thus saith the Lord: They also that uphold Egypt shall fall, and the pride of her power shall come down; from the tower of Syene shall they fall in it by the sword, saith the Lord God. — thus saith the Lord, they also that uphold Egypt shall fall…. that is, by the sword; either their allies and auxiliaries without, that supported the Egyptians with men and money; or their principal people within, their nobles that supported their state with their estates, their counsellors with their wisdom, their soldiers with their valour and courage.

And they shall be desolate in the midst of the countries that are desolate, and her cities shall be in the midst of the cities that are wasted.

And they shall know that I am the Lord, when I have set a fire in Egypt, and when all her helpers shall be destroyed. “and they shall know that I am the Lord,” reaffirms they survive at the end.

“‘In that day shall messengers go forth from Me in ships to make the careless Ethiopians afraid, and great pain shall come upon them, as in the day of Egypt; for lo, it cometh.

10 “‘Thus saith the Lord God: I will also make the multitude of Egypt to cease by the hand of Nebuchadnezzar king of Babylon.

11 He and his people with him, the terrible of the nations, shall be brought to destroy the land; and they shall draw their swords against Egypt and fill the land with the slain. — the terrible of the nations shall be brought to destroy the land; the Chaldeans, the most fierce, cruel, and terrible of all people, and others the most terrible that could be collected out of all nations under the yoke of the king of Babylon; and all of them terrible to the nations against whom they came, as now against Egypt to destroy it; see Habakkuk 1:6.

12 And I will make the rivers dry, and sell the land into the hand of the wicked; and I will make the land waste and all that is therein, by the hand of strangers. I, the Lord, have spoken it.” — and I will make the rivers dry …” we have no historical record of such a drought falling upon the Nile; so if the Lord had spoken it, this could only refer to a time into the future, that is, a prophecy. The forty years of desolation that has been mentioned again and again with reference to God’s judgment upon Egypt would indeed have included such a disaster as the drying up of the Nile. There is also the possibility that the language here may be allegorical or figurative;

— and I will make the rivers dry up; the waters from the Nile shall be wasted and dried up, perhaps none flow from the Grand Ethiopian Renaissance Dam; this drying up would be a calamity for Egypt since the country depended entirely upon the Nile for drinking and irrigation (see also Isaiah 19:5 and Zechariah 10:11).

13 “‘Thus saith the Lord God: I will also destroy the idols, and I will cause their images to cease out of Noph; and there shall be no more a prince of the land of Egypt, and I will put a fear in the land of Egypt. — and there shall be no more a prince of the land of Egypt; that is, a native of that country; or that should rule over the whole of it; and in that grandeur the kings of Egypt had before; will be no more

— Egypt was conquered by Nebuchadnezzar, under the Babylonians; then the Persians; the Greeks; the Romans; the Saracens and Mamalucks; the Turks; the British so that it never recovered its former glory; and indeed, it never really had a king: “no more a prince of the land of Egypt.”

14 And I will make Pathros desolate, and will set fire in Zoan, and will execute judgments in No. — today, Gypsies are known as Roma, but in Hebrew, their name is derived from the Egyptian city of Zoan; and this is from Wikipedia (Romani people);

Hebrew: צוענים‎, romanized: Tzoanim. Derives either from the biblical Egyptian city of Zoan, or from the linguistic root צ־ע־נ‎, meaning “wander”.

— for more, see a study commentary in Ezekiel 32.

15 And I will pour My fury upon Sin, the strength of Egypt, and I will cut off the multitude of No.

16 And I will set fire in Egypt; Sin shall have great pain, and No shall be rent asunder, and Noph shall have distresses daily.

17 The young men of Aven and of Pibeseth shall fall by the sword; and these cities shall go into captivity.

18 At Tehaphnehes also the day shall be darkened when I shall break there the yokes of Egypt, and the pomp of her strength shall cease in her. As for her, a cloud shall cover her, and her daughters shall go into captivity.

19 Thus will I execute judgments in Egypt; and they shall know that I am the Lord.’” — “and they shall know that I am the Lord,” repeated four times (verses 8, 19, 25, 26) reaffirms they survive at the end.

20 And it came to pass in the eleventh year, in the first month, on the seventh day of the month, that the word of the Lord came unto me, saying,

21 “Son of man, I have broken the arm of Pharaoh king of Egypt; and lo, it shall not be bound up to be healed, to put on a bandage to bind it, to make it strong to hold the sword.

22 Therefore thus saith the Lord God: Behold, I am against Pharaoh king of Egypt, and will break his arms, the strong and that which was broken; and I will cause the sword to fall out of his hand.

23 And I will scatter the Egyptians among the nations and will disperse them through the countries.

24 And I will strengthen the arms of the king of Babylon and put My sword in his hand; but I will break Pharaoh’s arms, and he shall groan before him with the groanings of a deadly wounded man.

25 But I will strengthen the arms of the king of Babylon, and the arms of Pharaoh shall fall down. And they shall know that I am the Lord when I shall put My sword into the hand of the king of Babylon, and he shall stretch it out upon the land of Egypt. “And they shall know that I am the Lord,” affirms they will survive, despite being dispersed through the nations.

26 And I will scatter the Egyptians among the nations and disperse them among the countries; and they shall know that I am the Lord.”

— “and they shall know that I am the Lord,” reaffirms their survival at the end, by then knowing that the God of Israel is both omniscient and omnipotent.

Ezekiel (Ch 27-28)

•September 22, 2021 • Leave a Comment

Chapter 27 and 28 continue with the same prophecy and lamentation against Tyre that started in Chapter 26. Why three chapters? Something must be rather significant. Whereas Chapter 26 centers on Tyre, chapter 27 branches out to surrounding territories and many trading outposts. And chapter 28 goes beyond the temporal.

Ezekiel 27

1 The word of the Lord came again unto me, saying,

“Now, thou son of man, take up a lamentation for Tyre, — take up a lamentation for Tyre; this alludes to the mournful lamentations as practiced at funerals.

and say unto Tyre, ‘O thou that art situate at the entry of the sea, who art a merchant of the people for many isles, thus saith the Lord God: “‘O Tyre, thou hast said, “I am of perfect beauty.” — which art a merchant of the people for many isles; the inhabitants of many isles brought the produce of them to her; who took them off their hands, or sold them for them to others; these came from several quarters to trade with her in her markets; and who supplied other isles and countries with all sorts of commodities, for which they either resorted to her, or she sent by ships unto them.

Thy borders are in the midst of the seas; thy builders have perfected thy beauty. — thy borders are in the midst of the seas, fixed by the Lord himself, and which could never be removed. Tyre stood about half a mile from the continent, surrounded with the waters of the sea, till it was made a peninsula by Alexander;

thy builders have perfected thy beauty. The Sidonians were the first builders of the city.

They have made all thy ship boards of fir trees of Senir; they have taken cedars from Lebanon to make masts for thee. they have taken cedars from Lebanon, to make masts for thee; large poles for the yards and sails to be fastened to, for receiving the wind necessary in navigation; all these are only in large vessels; most were made from the cedars of Lebanon; the Tyrians are said to be the first inventors of navigation.

Of the oaks of Bashan have they made thine oars; the company of the Ashurites have made thy benches of ivory, brought out of the isles of Cyprus.

Fine linen with embroidered work from Egypt was that which thou spreadest forth to be thy sail; blue and purple from the isles of Elishah was that which covered thee.

The inhabitants of Sidon and Arvad were thy mariners; thy wise men, O Tyre, that were in thee, were thy pilots.

The ancients of Gebal and the wise men thereof were in thee thy caulkers; all the ships of the sea with their mariners were in thee to trade for thy merchandise. all the ships of the sea with their mariners were in thee to occupy thy merchandise; ships from all parts were in her harbours, which brought goods into her, and carried goods out of her, by way of merchandise.

— so the Targum, “all that go down into the sea, and the ships; they were rowers, and they brought merchandise into the midst of thee.”

10 “‘They of Persia and of Lud and of Phut were in thine army, thy men of war. They hanged the shield and helmet in thee; they set forth thy comeliness.

11 The men of Arvad with thine army were upon thy walls round about, and the Gammadims were in thy towers. They hanged their shields upon thy walls round about; they have made thy beauty perfect.

12 “‘Tarshish was thy merchant by reason of the multitude of all kinds of riches; with silver, iron, tin, and lead, they traded in thy fairs.

13 Javan, Tubal, and Meshech, they were thy merchants; they traded the persons of men and vessels of brass in thy market. — these are Japhet’s sons as documented in Genesis 10:2; so Tyre was even trading with people from east Asia.

14 Those of the house of Togarmah traded in thy fairs with horses and horsemen and and mules is listed in Genesis 10:3 as the third son of Gomer, and grandson of Japheth, brother of Ashkenaz and Riphath.

the name is again mentioned in the Book of Ezekiel as a nation from the “far north.” Ezekiel 38:6 mentions Togarmah together with Tubal as supplying soldiers to the army of Gog. Ezekiel 27:14 mentions Togarmah together with Tubal, Javan and Meshech as supplying horses to the Tyrians.

15 The men of Dedan were thy merchants; many isles were the merchandise of thine hand; they brought thee for a present horns of ivory and Dedan (now part of Al-‘Ula, Saudi Arabia) was an oasis and city-state of north-western Arabia.

16 Syria was thy merchant by reason of the multitude of the wares of thy making; they traded in thy fairs with emeralds, purple, and embroidered work, and fine linen, and coral, and agate.

17 Judah and the land of Israel, they were thy merchants; they traded in thy market wheat of Minnith, and pannag, and honey, and oil, and balm.

18 Damascus was thy merchant in the multitude of the wares of thy making, for the multitude of all riches, in the wine of Helbon and white wool.

19 Dan also and Javan, going to and fro, traded in thy fairs; bright iron, cassia, and calamus were in thy market.

20 Dedan was thy merchant in precious clothes for chariots.

21 Arabia, and all the princes of Kedar, they traded with thee in lambs and rams and goats; in these were they thy merchants.

22 The merchants of Sheba and Raamah, they were thy merchants; they traded in thy fairs with chief of all spices, and with all precious stones, and gold. according to Josephus Sheba was also the home of the biblical “Princess Tharbis” said to have been the first wife of Moses when he was still Prince of Egypt.

Raamah or Rama is a name found in the Bible (Hebrew: רעמה, Ra‛mâh), means “lofty” or “exalted” and also may mean “thunder”. The name is first mentioned as the fourth son of Cush, who is the son of Ham, who is the son of Noah in Genesis 10:7.

23 Haran, and Canneh, and Eden, the merchants of Sheba, Asshur, and Chilmad were thy merchants.

24 These were thy merchants in all sorts of things—in blue clothes, and embroidered work, and in chests of rich apparel, bound with cords and made of cedar, among thy merchandise.

25 The ships of Tarshish did sing of thee in thy market, and thou wast replenished and made very glorious in the midst of the seas. even the ships of Tarshish sung or spake great things of Tyre’s riches, like sing praises.

26 Thy rowers have brought thee into great waters; the east wind hath broken thee in the midst of the seas.

27 Thy riches and thy fairs, thy merchandise, thy mariners, and thy pilots, thy caulkers, and the traders of thy merchandise, and all thy men of war that are in thee, and in all thy company which is in the midst of thee shall fall into the midst of the seas in the day of thy ruin. thy riches and all thy company, shall fall into the midst of the seas; shall be as utterly ruined and destroyed as if they were sunk in the sea by a shipwreck.

28 The suburbs shall shake at the sound of the cry of thy pilots.

29 And all that handle the oar, the mariners, and all the pilots of the sea shall come down from their ships; they shall stand upon the land,

30 and shall cause their voice to be heard against thee, and shall cry bitterly and shall cast up dust upon their heads; they shall wallow themselves in the ashes.

31 And they shall make themselves utterly bald for thee, and gird themselves with sackcloth, and they shall weep for thee with bitterness of heart and bitter wailing.

32 And in their wailing they shall take up a lamentation for thee and lament over thee, saying, “What city is like Tyre, like the destroyed in the midst of the sea?”

33 When thy wares went forth out of the seas, thou filled many people; thou didst enrich the kings of the earth with the multitude of thy riches and of thy merchandise.

34 In the time when thou shalt be broken by the seas in the depths of the waters, thy merchandise and all thy company in the midst of thee shall fall.

35 All the inhabitants of the isles shall be astonished at thee, and their kings shall be sore afraid; they shall be troubled in their countenance.

36 The merchants among the people shall hiss at thee; thou shalt be a terror, and never shalt be any more.’”” the merchants of the peoples hiss at thee …” how fickle are the people of mankind! Tyre was then the most popular nation on earth; but the very merchants who were delighted to be “her traffickers” are here revealed as “hissing at their former leader.”

“They totally disowned her; they hissed at her in a derogatory manner, perhaps thinking thereby to gain favor with the Babylonians.

— and never shalt be any more — historically Tyre was still an important city centuries later during the times of Alexander the Great, so this must be for the endtime; and is this a prophecy against Tyre that has no promise of restoration? Seems so as the end of chapter 26 says the same thing that Tyre “shalt be no more.”

Other concluding versions for Tyre:

— from now on you are nothing;

— and you will never exist again;

— and you are gone forever;

— for you are gone, never to return.

Ezekiel 28

Chapter 28 is still a prophecy of the destruction and a lamentation of Tyre, starting as the “prince of Tyre,” but ends up as the “king of Tyre.”

1 The word of the Lord came again unto me, saying,

“Son of man, say unto the prince of Tyre, ‘Thus saith the Lord God: “‘Because thine heart is lifted up and thou hast said, “I am a god, I sit in the seat of God in the midst of the seas,” yet thou art a man, and not God, though thou set thine heart as the heart of God. because thy heart is lifted up In pride and self-conceit; and thou hast said: Namely, in thy heart; I am a god I am like a god. I sit in the seat of God Inaccessible by mortals.

Behold, thou art wiser than Daniel; there is no secret that they can hide from thee. — the Septuagint render it by way of interrogation, “art thou not wiser than Daniel?

it is just like Nebuchadnezzar’s pride but under God who said of him Daniel 4:30-31. Yet thou art man, and not God 

With thy wisdom and with thine understanding thou hast gotten thee riches, and hast gotten gold and silver into thy treasuries. — with thy wisdom and with thy understanding thou hast gotten thee riches…. through skill in navigation and trade, for which the Tyrians and their princes were famous, they acquired great wealth: by carnal policy has amassed vast treasures through the sale of pardons and indulgences has brought immense riches into the pope’s coffers, and the paying of three tithes among the CoG Communities when temple services had been abolished long ago.

By thy great wisdom and by thy traffic hast thou increased thy riches, and thine heart is lifted up because of thy riches. and thine heart is lifted up because of thy riches; which are apt to puff up and swell with a vain opinion of themselves, and to make haughty, insolent, and scornful, in their behaviour to others; the whore of Rome is represented as proud, vain, and haughty, Revelation 18:7.

“‘Therefore thus saith the Lord God: Because thou hast set thine heart as the heart of God, because thou hast set thine heart as the heart of God; seeking thine own glory; setting up thyself above all others; assuming that to thyself which belongs to God; and making thyself equal to him, or showing thyself as if thou wast God.

behold, therefore I will bring strangers upon thee, the terrible of the nations; and they shall draw their swords against the beauty of thy wisdom, and they shall defile thy brightness. — “strangers” refugees — Afghans, Syrians, Iraqis, Palestinians, Sudanese, Moroccans, Algerians, Mexicans, Haitians; are coming;

“the terrible of the nations”; the most heinous and depraved of the nations: al-Qaeda, ISIS and their affiliates; and they shall draw their swords against the beauty of thy wisdom”;

— their beautiful city and spacious buildings, the palaces of their king and nobles, their walls and towers erected and warriors so well skilled in military affairs.

They shall bring thee down to the pit, and thou shalt die the deaths of them that are slain in the midst of the seas. — “and thou shalt die the deaths of them that are slain in the midst of the seas”; that die in a sea battles, whose carcasses are thrown overboard, and devoured by fishes.

Wilt thou yet say before him that slayeth thee, “I am God”? But thou shalt be a man, and no god in the hand of him that slayeth thee.

10 Thou shalt die the deaths of the uncircumcised by the hand of strangers; for I have spoken it, saith the Lord God.’” thou shalt die the deaths of the uncircumcised…. or the death of the wicked.

11 Moreover the word of the Lord came unto me, saying, — here is a new scene, a change of scene.

12 “Son of man, take up a lamentation over the king of Tyre, and say unto him, ‘Thus saith the Lord God: “‘Thou sealest up the sum, full of wisdom and perfect in beauty. — take up a lamentation upon the king of Tyrus…. who is before called the prince of Tyre (Ezekiel 28:2); and who he was. Note a subtle change of scene, from, “the prince” to here, “the king.”

13 Thou hast been in Eden the garden of God; every precious stone was thy covering: the sardius, topaz, and the diamond, the beryl, the onyx, and the jasper, the sapphire, the emerald, and the carbuncle, and gold; the workmanship of thy taborets and of thy pipes was prepared in thee in the day that thou wast created. — now this prophecy of Tyre has again moved beyond the temporal, for none in the modern days has been to the Garden of Eden.

14 Thou art the anointed cherub that covereth, and I have set thee so; thou wast upon the holy mountain of God; thou hast walked up and down in the midst of the stones of fire.

15 Thou wast perfect in thy ways from the day that thou wast created, till iniquity was found in thee. — this being, the adversary, was created; till iniquity was found in thee; pride, blasphemy against God, and contempt of his people, as well as violence and deceit;

all this was found in “the king of Tyre.”

16 By the multitude of thy merchandise they have filled the midst of thee with violence, and thou hast sinned; therefore I will cast thee as profane out of the mountain of God; and I will destroy thee, O covering cherub, from the midst of the stones of fire. and I will destroy thee, O covering cherub, from the midst of the stones of fire; from among the creation (people, angels) of God.

17 Thine heart was lifted up because of thy beauty; thou hast corrupted thy wisdom by reason of thy brightness. I will cast thee to the ground; I will lay thee before kings, that they may behold thee. — thine heart was lifted up because of thy beauty…. riches, wealth, power and authority.

thou hast corrupted thy wisdom by reason of thy brightness; outward lustre and glory, which dazzled his eyes.

18 Thou hast defiled thy sanctuaries by the multitude of thine iniquities, by the iniquity of thy traffic. Therefore will I bring forth a fire from the midst of thee; it shall devour thee; and I will bring thee to ashes upon the earth in the sight of all them that behold thee. and I will bring thee to ashes upon the earth, in the sight of all them that behold thee; the kings and merchants of the earth, who shall stand and look on the city as it is burning, and when reduced to ashes; which denotes the utter destruction of it, Revelation 18:9.

The Targum is, “I will give thee as ashes on the earth,’ and shall be no more.

19 All they that know thee among the people shall be astonished at thee; thou shalt be a terror, and never shalt thou be any more.’” — and never shalt thou be any moresimilar to Ammon, this prophecy against the king of Tyre has no promise of restoration.

20 Again the word of the Lord came unto me, saying,

21 “Son of man, set thy face against Sidon, and prophesy against it — Sidon is a city in Lebanon, but further north of Tyre.

22 and say, ‘Thus saith the Lord God: “‘Behold, I am against thee, O Sidon, and I will be glorified in the midst of thee; and they shall know that I am the Lord, when I shall have executed judgments in her and shall be sanctified in her.

23 For I will send into her pestilence, and blood into her streets; and the wounded shall be judged in the midst of her by the sword upon her on every side; and they shall know that I am the Lord. “and they shall know that I am the Lord” repeated four times (verses 22, 23, 24, 26) — Sidon survives, unlike Tyre, which perished and be remembered no more: Ezekiel 26:21.

24 And there shall be no more a pricking brier unto the house of Israel, nor any grieving thorn of all who are round about them, who despised them; and they shall know that I am the Lord God.

25 “‘Thus saith the Lord God: When I shall have gathered the house of Israel from the people among whom they are scattered, and shall be sanctified in them in the sight of the heathen, then shall they dwell in their land that I have given to My servant Jacob.

26 And they shall dwell safely therein, and shall build houses and plant vineyards; yea, they shall dwell with confidence when I have executed judgments upon all those that despise them round about them; and they shall know that I am the Lord their God.’” and they shall know that I am the Lord their God; Sidon survives, after they could see the hand of God in it, acknowledge his justice, and confess that their gods were idols, and that the God of Israel is the only true God.

Ezekiel (Ch 25-26)

•September 20, 2021 • Leave a Comment

Chapter 25 continues with the same prophecy against the Ammonites which started in Chapter 21. Just a recap: We might speculate why the Ammonites were singled out here for this special oracle; but it might have pertained to the share they had in the murder of Gedaliah, by the hand of Ishmael and the Ammonites gave these killers refuge.

Second, in historic time, when Nebuchadnezzar took his route to Jerusalem, and destroyed the city, returned to Babylon, he went about without making any attempt upon the Ammonites; which so flushed the Ammonites that they insulted the Jews and laughed at their destruction, as if their God couldn’t save them.

And perhaps thirdly, the Ammonites are modern Jordan, sitting on land allocated to three of the tribes of Israel, and they are taking their ancestral land back, land that could even stretch to the Euphrates River.

Ezekiel 25

1 The word of the Lord came again unto me, saying,

“Son of man, set thy face against the Ammonites and prophesy against them;

and say unto the Ammonites, ‘Hear the word of the Lord God. Thus saith the Lord God: Because thou saidst, “Aha,” against My sanctuary when it was profaned, and against the land of Israel when it was desolate, and against the house of Judah when they went into captivity, — Gill: and against the house of Judah, when they went into captivity; the two tribes of Judah and Benjamin, who were carried captives by Nebuchadnezzar;

— under Jehoiakim (succeeded Jehoahaz, who replaced Josiah but reigned only 3 months); began giving tribute to Nebuchadnezzar in 605 BC; first deportation, purportedly including Daniel;

— another captives under Jeconiah, (Reign: 598 – 597 BC);

— and the rest would be under Zedekiah (Reign 597–586 BC); which completed the destruction of Israel and Judah;

— and gave the utmost pleasure to their enemies the Ammonites; who were so impious as to rejoice at the destruction of God’s temple: “’Aha,’ against My sanctuary” which they abhorred; this brutish and barbarous behaviour of theirs is resented by the Lord.

behold, therefore I will deliver thee to the men of the East as a possession; and they shall set their palaces in thee and make their dwellings in thee. They shall eat thy fruit, and they shall drink thy milk. the men of the east for a possession…. the Chaldeans, the Medes and Persians, they lay eastward of Jerusalem; and/or it may be the Arabians, who are often called the men of the east.

And I will make Rabbah a stable for camels and Ammon a couching place for flocks; and ye shall know that I am the Lord. Rabbah is the capital of Ammon;

— and I will make Rabbath a stable for camels…. creatures much used by the eastern nations, especially the Arabians; who pitching their tents about Rabbath, the royal city,

For thus saith the Lord God: Because thou hast clapped thine hands and stamped with the feet and rejoiced in heart with all thy contemptuous hate against the land of Israel, because thou hast clapped thine hands, and stamped with thy feet: gestures expressive of joy and gladness;

— the Ammonites clapped their hands together, and leaped and skipped for joy, when they heard of the calamities of the Jews; who yet had more reason to be sorrowful, since they might expect their turn would be next; for the king of Babylon had a design against them, at the same time he came against Jerusalem, and was in doubt for a while which he should attack first; see Ezekiel 21:20.

behold, therefore I will stretch out Mine hand upon thee and will deliver thee as spoil to the nations; and I will cut thee off from the people, and I will cause thee to perish out of the countries. I will destroy thee, and thou shalt know that I am the Lord.’ and I will cut thee off from the people, and I will cause thee to perish out of the countries; so as to be no more a people and a country; or be reckoned among the people and countries; or have any alliance with them, or help from them.

“Thus saith the Lord God: ‘Because Moab and Seir do say, “Behold, the house of Judah is like unto all the heathen,” — the Moabites are first prophesied of, and then the Edomites who both joined in saying, behold, the house of Judah is like unto all the heathens;

— it fares no better with them than with the rest of the nations, who do not profess and serve the same God they do; they are fallen into the hands of the king of Babylon;

— and yet are brought into the same miserable circumstances, and left in them, as others are; where is their God they boast of, and their superior excellence to the rest of the world?

thus blasphemously, as well as wickedly, did they insult them, which was provoking to the Lord.

the Targum renders it interrogatively, “in what do the house of Judah differ from all people?”

the Septuagint, “behold, are not the house of Israel and Judah in like manner as all nations?”

therefore, behold, I will open the side of Moab from the cities, from his cities which are on his frontiers, the glory of the country — Bethjeshimoth, Baalmeon, and Kiriathaim—

10 unto the men of the East with the Ammonites, and will give them in possession, that the Ammonites may not be remembered among the nations. — this prophecy against Ammon and the Ammonites has no promise of restoration; for the Lord have spoken it.

11 And I will execute judgments upon Moab, and they shall know that I am the Lord.’ — and Moab, too, would suffer the same fate, no, not quite, as “and they shall know that I am the Lord,” indicates they will survive and come to acknowledge God.

12 “Thus saith the Lord God: ‘Because Edom hath dealt against the house of Judah by taking vengeance, and hath greatly offended and revenged himself upon them, because Edom hath dealt against the house of Judah by taking vengeance: the Edomites bore an old grudge against the Jews, not only because their father Jacob had got the birthright and blessing from their father Esau; but because they were made tributaries to them in David’s time, and afterwards severely chastised by Amaziah; these things they laid up in their minds, and vowed revenge whenever they had an opportunity; and now one offered at the destruction of Jerusalem, which they took;

Edom dwelt to the South of the house of Israel in ancient history; the book of Obadiah incorporates the prophecy of Edom in more details; but briefly here, it’s Spain and the Latinos, who live South of the children of Israel today.

13 therefore thus saith the Lord God: I will also stretch out Mine hand upon Edom and will cut off man and beast from it, and I will make it desolate from Teman; and they of Dedan shall fall by the sword.

— One other theory is that the Ottoman Turks (or today’s Turkey) are the sons of Teman. Perhaps they could be another branch.

14 And I will lay My vengeance upon Edom by the hand of My people Israel, and they shall do in Edom according to Mine anger and according to My fury; and they shall know My vengeance, saith the Lord God.’

Some nations that “clap thine hands and stamp your feet” when these happen again will get a Spanking so bad that their names will be remembered no more!

15 “Thus saith the Lord God: ‘Because the Philistines have dealt by revenge and have taken vengeance with a scornful heart to destroy it for the old hatred,

16 therefore thus saith the Lord God: Behold, I will stretch out Mine hand upon the Philistines, and I will cut off the Cherethites and destroy the remnant of the seacoast.

17 And I will execute great vengeance upon them with furious rebukes; and they shall know that I am the Lord, when I shall lay My vengeance upon them.’” — “and they shall know that I am the Lord,” indicates they will survive and come to acknowledge God; “when I shall lay my vengeance upon them”

they will see the hand of God in it, acknowledge his justice, and confess that their gods were idols, and that the God of Israel is the only true God.

Ezekiel 26

Coffman: Tyre, and its sister city Sidon, both in Lebanon, were pagan to the center of their existence. It was Jezebel, the daughter of Eth-Baal, king of the Sidonians, who brought the whole pagan institution into Israel in the days of Ahab, precipitating the contest with Elijah on Mount Carmel.

Incidentally, that development demonstrated the godless influence of Israel’s apostate kings and their foreign wives. Jezebel was the wife of Ahab.

1 And it came to pass in the eleventh year, on the first day of the month, that the word of the Lord came unto me, saying,

“Son of man, because Tyre hath said against Jerusalem, ‘Aha, she is broken that was the gates of the people; she is turned unto me; I shall be replenished, now she is laid waste,’ Son of man, because that Tyrus hath said against Jerusalem, aha…. as rejoicing at her destruction, and insulting over her in it; which was barbarous and inhuman, and resented by the Lord.

therefore thus saith the Lord God: Behold, I am against thee, O Tyre, and will cause many nations to come up against thee, as the sea causeth his waves to come up. and will cause many nations to come up against thee, as the sea causeth his waves to come up; the Chaldean army, consisting of soldiers of many nations; who for their number, noise, and fury, are compared to the raging waves of the sea;

— so the Targum says, “I will bring up against thee an army of many people, as the sea ascendeth in the raging of its waves.”

And they shall destroy the walls of Tyre and break down her towers. I will also scrape her dust from her, and make her like the top of a rock. Tyre, at that time the most famous city for trade and commerce in the world; and make her like the top of a rock means Tyre will be made barren.

It shall be a place for the spreading of nets in the midst of the sea, for I have spoken it, saith the Lord God; and it shall become a spoil to the nations.

And her daughters who are in the field shall be slain by the sword; and they shall know that I am the Lord. and they shall know that I am the Lord: and when they shall see all these things exactly accomplished, that the omniscient God could foretell events and come to their senses, thus they survive rather having their names remember no more.

“For thus saith the Lord God: Behold, I will bring upon Tyre Nebuchadnezzar king of Babylon, a king of kings from the north, with horses and with chariots and with horsemen and companies, and many people.

He shall slay with the sword thy daughters in the field; and he shall make a fort against thee, and cast a siege mound against thee, and lift up the buckler against thee.

And he shall set engines of war against thy walls, and with his axes he shall break down thy towers.

10 By reason of the abundance of his horses, their dust shall cover thee. Thy walls shall shake at the noise of the horsemen and of the wheels and of the chariots when he shall enter into thy gates, as men enter into a city wherein is made a breach.

11 With the hoofs of his horses shall he tread down all thy streets. He shall slay thy people by the sword, and thy strong garrisons shall go down to the ground. — Josephus wrote: “that Nebuchadnezzar besieged Tyre thirteen years,” before the fruits fell onto the ground. Tyre had a large fleet and were very rich with merchandise.

12 And they shall make a spoil of thy riches and make a prey of thy merchandise; and they shall break down thy walls and destroy thy pleasant houses; and they shall lay thy stones and thy timber and thy dust in the midst of the water. — and they shall make a spoil of thy riches…. the Chaldean army, when they entered the city, and got possession of it, would plunder it, and divide the riches of it among them.

13 And I will cause the noise of thy songs to cease, and the sound of thy harps shall be no more heard.

14 And I will make thee like the top of a rock; thou shalt be a place to spread nets upon. Thou shalt be built no more; for I the Lord have spoken it, saith the Lord God.

15 “Thus saith the Lord God to Tyre: Shall not the isles shake at the sound of thy fall, when the wounded cry, when the slaughter is made in the midst of thee?

16 Then all the princes of the sea shall come down from their thrones, and lay away their robes and put off their embroidered garments. They shall clothe themselves with trembling; they shall sit upon the ground, and shall tremble at every moment and be astonished at thee.

17 And they shall take up a lamentation for thee and say to thee: “‘How art thou destroyed, that wast inhabited by seafaring men, the renowned city, which wast strong in the sea, she and her inhabitants, who cause their terror to be on all that haunt it!

18 Now shall the isles tremble in the day of thy fall; yea, the isles that are in the sea shall be troubled at thy departure.’ Benson: shall not the isles shake at the sound of thy fall? all those that dwell upon the sea-coast near thee shall be thrown into a consternation at the news of thy being taken and destroyed;

— All the princes of the sea shall come down from their thrones All the princes and rich merchants (or the merchants who are as princes, as Isaiah speaks) of Zidon, Carthage, and other maritime cities that maintained a trade with Tyre, and got great wealth by that means, shall express a deep grief and concern for the fall of it;

— They shall clothe themselves with trembling With fear productive of trembling; or, they shall be afraid on every side, and full of fear and trembling;

— And they shall take up a lamentation for thee Shall bitterly bewail thy fall.

19 “For thus saith the Lord God: When I shall make thee a desolate city like the cities that are not inhabited, when I shall bring up the deep upon thee and great waters shall cover thee,

20 when I shall bring thee down with them that descend into the pit with the people of olden times, and shall set thee in the low parts of the earth, in places desolate of old with them that go down to the pit, that thou be not inhabited, and I shall set glory in the land of the living”

21 I will make thee a terror, and thou shalt be no more. Though thou be sought for, yet shalt thou never be found again, saith the Lord God.” — Oops, it seems here that Tyre “shalt be no more,” contrary to what verse 6 says. Perhaps verse 6 was meant for the time of Nebuchadnezzar, but here it’s the endtime? Any other possibilities?

Ezekiel (Ch 23-24)

•September 19, 2021 • Leave a Comment

Chapter 23 exposes the idolatries of Israel, or the ten tribes, under the name of Aholah, which they committed with the Assyrians, of whom they had learned them, are exposed, and their punishment for them is declared, then the idolatries of Judah, or the two tribes, under the name of Aholibah, are represented as greater than those of the ten tribes.

Ezekiel 23

1 The word of the Lord came again unto me, saying,

“Son of man, there were two women, the daughters of one mother,

and they committed whoredoms in Egypt; they committed whoredoms in their youth. There were their breasts pressed, and there they bruised the teats of their virginity. — “they played the harlot in Egypt …”; the proof of this is their apostasy with their reverence and worship of the Golden Calf which started in Egypt.

And the names of them were Oholah the elder and Oholibah her sister; and they were Mine, and they bore sons and daughters. Thus were their names: Samaria is Oholah, and Jerusalem, Oholibah. in allegory, Samaria is Israel or the ten tribes, under the name of Aholah, which they committed with the Assyrians, and their punishment for them is declared; and Aholibah represents the idolatries of Judah or the two tribes.

“And Oholah played the harlot when she was Mine; and she doted on her lovers, on the Assyrians her neighbors,

who were clothed with blue, captains and rulers, all of them desirable young men, horsemen riding upon horses.

Thus she committed her whoredoms with them, with all them that were the chosen men of Assyria and with all on whom she doted. With all their idols she defiled herself.

Neither left she her whoredoms brought from Egypt; for in her youth they lay with her, and they bruised the breasts of her virginity and poured their whoredom upon her.

Therefore I have delivered her into the hand of her lovers, into the hand of the Assyrians, upon whom she doted.

10 These uncovered her nakedness. They took her sons and her daughters and slew her with the sword; and she became notorious among women, for they had executed judgment upon her. for they had executed judgment upon her; that is, the Assyrians, who were the instruments in God’s hand in doing justice and inflicting judgments on her. God is the true executor in their Assyrian captivity, same as in 70 AD during the Jerusalem inferno.

11 “And when her sister Oholibah saw this, she was more corrupt in her inordinate love than she, and in her whoredoms more than her sister in her and in her whoredoms more than her sister in her whoredoms; guilty of more idolatries than the ten tribes, as in the times of Manasseh.

12 She doted upon the Assyrians her neighbors, captains and rulers clothed most gorgeously, horsemen riding upon horses, all of them desirable young men.

13 Then I saw that she was defiled, that they both took one way,

14 and that she increased her whoredoms. For when she saw men portrayed upon the wall, the images of the Chaldeans portrayed with vermilion,

15 girded with girdles upon their loins, exceeding in dyed attire upon their heads, all of them princes to look to, in the manner of the Babylonians of Chaldea, the land of their nativity—

16 and as soon as she saw them with her eyes, she doted upon them and sent messengers unto them into Chaldea.

17 And the Babylonians came to her into the bed of love, and they defiled her with their whoredom, and she was polluted with them, and her mind was alienated from them.

18 So she uncovered her whoredoms and uncovered her nakedness. Then My mind was alienated from her, as My mind was alienated from her sister.

19 Yet she multiplied her whoredoms in calling to remembrance the days of her youth, wherein she had played the harlot in the land of Egypt.

20 For she doted upon their paramours, whose flesh is as the flesh of asses and whose issue is like the issue of horses.

21 Thus thou called to remembrance the lewdness of thy youth, in bruising thy teats by the Egyptians for the paps of thy youth.”

22 “Therefore, O Oholibah, thus saith the Lord God: Behold, I will raise up thy lovers against thee from whom thy mind is alienated, and I will bring them against thee on every side:

23 the Babylonians, and all the Chaldeans, Pekod, and Shoa, and Koa, and all the Assyrians with them, all of them desirable young men, captains and rulers, great lords and renowned, all of them riding upon horses.

24 And they shall come against thee with chariots, wagons, and wheels, and with an assembly of people, who shall set against thee buckler and shield and helmet round about; and I will set judgment before them, and they shall judge thee according to their judgments. — and I will set judgment before them, and they (your enemies) shall judge thee according to their judgments;

— that is, I will deliver you into their hands, and they shall judge and condemn you; not according to my laws and yours, but according to their own laws, according to the customs and usages among them, according to the law of nations;

they shall deal with you as rebels and covenant breakers, such Zedekiah was: he broke the covenant with the king of Babylon, and rebelled against him: and this was fulfilled when he fell into his hands, and when he slew his children before his face, and then put out his eyes.

25 And I will set My jealousy against thee, and they shall deal furiously with thee. They shall take away thy nose and thine ears, and thy remnant shall fall by the sword. They shall take thy sons and thy daughters, and thy residue shall be devoured by the fire. Gill: they shall take away thy nose and thine ears, and thy remnant shall fall by the sword; as gallants use their harlots when they leave them, or jealous husbands their adulterous wives, disfiguring them, that they may be marked and known what they are, and be despised by others;

— as has been the custom in some countries, particularly with the Egyptians, to cut off the noses of adulterous persons; here it is to be understood figuratively: by the “nose”, is meant the king, who is higher than his people, as the nose is the highest part in a man’s face;

— and by the “ears” the priest, who caused a noise to be heard when he entered into the temple with his bells; or rather because it was the priest’s office to attend to the word of God, and teach it the people; in general, these denote everything that was excellent among the Jews, their city, temple, king, kingdom, princes, priests, and prophets, which should be demolished and removed;

— and by the remnant is meant the common people, that should come into the hands of the Chaldeans, and fall by their sword.

— so the Targum paraphrases it, “thy princes and thy nobles shall go into captivity, and thy people shall be killed with the sword:” they shall take thy sons and thy daughters, and thy residue shall be devoured by the fire; take and carry their sons and daughters captive, and burn with fire the city left by them.

that is, the city of Jerusalem, the temple, the king’s palaces, the houses of the great men, and others in it, which were all burnt with fire when taken by the Chaldeans, Jeremiah 52:13;

— and thy residue shall be devoured by the fire; so would all be consumed? No remnant at all? (more details at the end of this chapter).

26 They shall also strip thee out of thy clothes and take away thy fair jewels.

27 Thus will I make thy lewdness to cease from thee and thy whoredom brought from the land of Egypt, so that thou shalt not lift up thine eyes unto them, nor remember Egypt any more.

28 For thus saith the Lord God: Behold, I will deliver thee into the hand of those whom thou hatest, into the hand of those from whom thy mind is alienated, for thus saith the Lord God, I will deliver thee into the hand of them whom thou hatest…. historically the the Chaldeans and Babylonians, before loved by her, and doted upon, but now hated and rebelled against;

— but who are those enemies of the future? where they are to fall into similar hands; and this the Lord threatens to bring upon them for their sins; and he having said it, it might be performed; and it is to be repeated in the endtime.

29 And they shall deal with thee hatefully, and shall take away all thy labor and shall leave thee naked and bare; and the nakedness of thy whoredoms shall be uncovered, both thy lewdness and thy whoredoms.

30 I will do these things unto thee, because thou hast gone a whoring after the nations, and because thou art polluted with their idols.

31 Thou hast walked in the way of thy sister; therefore will I give her cup into thine hand.

32 “Thus saith the Lord God: “Thou shalt drink of thy sister’s cup deep and large; thou shalt be laughed to scorn and held in derision; it containeth much.

33 Thou shalt be filled with drunkenness and sorrow, with the cup of dismay and desolation, with the cup of thy sister Samaria.

34 Thou shalt even drink it and suck it out, and thou shalt break the shards thereof, and pluck off thine own breasts. For I have spoken it, saith the Lord God.

35 “Therefore thus saith the Lord God: Because thou hast forgotten Me and cast Me behind thy back, therefore bear thou also thy lewdness and thy whoredoms.”

36 The Lord said moreover unto me: “Son of man, wilt thou judge Oholah and Oholibah? Yea, declare unto them their abominations,

37 that they have committed adultery, and blood is on their hands; and with their idols have they committed adultery and have also caused their sons, whom they bore unto Me, to pass for them through the fire, to devour them.

38 Moreover this they have done unto Me: They have defiled My sanctuary on the same day and have profaned My Sabbaths. — notice the plural, Sabbaths; and instead of observing the Sabbaths, they observe by following the sun-worshipping Samaritans, where they observe the SUN; on SUNday; facing the East; their backs against the Temple;

39 For when they had slain their children to their idols, then they came the same day into My sanctuary to profane it; and lo, thus have they done in the midst of Mine house.

And He brought me into the inner court of the Lord’S house, and behold, at the door of the temple of the Lord, between the porch and the altar, were about five and twenty men with their backs toward the temple of the Lord and their faces toward the east; and they worshiped the sun toward the east. Ezekiel 8:16

Others, the Church of God Communities would always have their “wavesheaf offering” and Pentecost on a SUNday, Whitsundays.

40 And furthermore, ye have sent for men to come from far, unto whom a messenger was sent; and lo, they came, for whom thou didst wash thyself, painted thy eyes, and decked thyself with ornaments, Gill: for whom thou didst wash thyself, paintedst thy eyes, and deckedst thyself with ornaments; just as harlots do to make themselves agreeable to their lovers;

who use washes and paint, as Jezebel did, and dress themselves in their best clothes, and adorn themselves in the best manner they can. Harlots had their particular attire, by which they were known, Proverbs 7:10

41 and sattest upon a stately bed, and a table prepared before it, whereupon thou hast set Mine incense and Mine oil.

42 And a voice of a multitude being at ease was with her; and with the men of the common sort were brought Sabeans from the wilderness, who put bracelets upon their hands and beautiful crowns upon their heads.

43 “Then said I unto her that was old in adulteries: ‘Will they now commit whoredoms with her, and she with them?’

44 Yet they went in unto her, as they go in unto a woman that playeth the harlot; so went they in unto Oholah and unto Oholibah, the lewd women.

45 And the righteous men, they shall judge them after the manner of adulteresses and after the manner of women that shed blood, because they are adulteresses and blood is in their hands.

46 “For thus saith the Lord God: I will bring up a company upon them, and will give them to be removed and despoiled.

47 And the company shall stone them with stones and dispatch them with their swords. They shall slay their sons and their daughters, and burn up their houses with fire. they shall slay their sons and their daughters; when they broke into the city, and took it; or when they found them making their escape, and hiding themselves in secret places;

and burn up their houses with fire; as they did; the temple, the king’s palace, the houses of noblemen, and all the houses in Jerusalem; see Jeremiah 52:13.

48 Thus will I cause lewdness to cease out of the land, that all women may be taught not to do according to your lewdness.

49 And they shall recompense your lewdness upon you, and ye shall bear the sins of your idols; and ye shall know that I am the Lord God.”

~~~

More on verse 25. Since Ezekiel’s message is for the endtime and meant for the house of Israel, which is the United States and its European allies and “thy remnant shall fall by the sword.” — if those remnant are put to the sword, then no more will be left, reaffirming there is no place of safety for those hopeful to have one.

But wait, this apparently contradicts Ezekiel 23:25, where “I will leave a few men of them from the sword . . . that they may declare all their abominations among the nations.

Or, after testifying all their abominations to the nations, then they are put down by the sword? A remnant of martyrs?

Your thoughts for this apparent contraction, please; thanks. Or indeed a remnant of martyrs is on its way?

Ezekiel 24

This chapter of destruction of the city and temple of Jerusalem is prophesied here; but as said before, it is meant for the house of Israel at the endtime. By the sign of flesh boiling in a pot are shown the miseries that would come; and by the sign of Ezekiel’s being forbidden to mourn for the sudden death of his wife is that the calamities coming on the captives would be so astonishing as to exceed all expressions of sorrow.

1 Again, in the ninth year, in the tenth month, on the tenth day of the month, the word of the Lord came unto me, saying,

“Son of man, write thee the name of the day, even of this same day: The king of Babylon set himself against Jerusalem this same day. — although this parable is set “against Jerusalem,” this message is meant for the house of Israel which is the United States and its European allies.

And utter a parable unto the rebellious house, and say unto them, ‘Thus saith the Lord God: Set on a pot, set it on, and also pour water into it.

Gather the pieces thereof into it, even every good piece — the thigh and the shoulder. Fill it with the choice bones.

Take the choice of the flock, and burn also the bones under it; and make it boil well, and let them boil the bones of it therein. — Coffman: analogies clearly visible in this parable: the cauldron is the city; the flesh in it is the people; the immense fire under it is the fire of war; the setting of the cauldron on the fire is the beginning of the siege;

the rust in the pot (introduced later) is the inherent wickedness of the people; the “choice bones (Ezekiel 24:4)” are the bones with meat attached to them; their being “choice” bones indicates that the nobility and the landed gentry will also be ruined by the war; the “bones under the caudron (Ezekiel 24:5)” are the large bones used, along with the logs for fuel;

the removal of the flesh from the cauldron indicates the destruction of the whole city, rich and poor alike, high and low, indiscriminately, whether by sword, by pestilence, by famine, or by deportation;

the emptying of the cauldron indicated the removal of Jerusalem’s population; the cauldron’s still being rusted indicated Jerusalem’s worthlessness, at that time, as regarded God’s eternal purpose, entailing, of course, the necessity for its complete destruction;

the severe burning of the cauldron in intense fire after it was emptied speaks of the burning and destruction of the city itself and the Temple of God.

“‘Therefore thus saith the Lord God: Woe to the bloody city, to the pot whose scum is therein and whose scum is not gone out of it! Bring it out piece by piece; let no lot fall upon it. scum is extraneous matter or impurities risen to or formed on the surface of a liquid often as a foul filmy covering.

— Gill: to the pot whose scum is therein, and whose scum is not gone out of it; when a pot boils, a scum arises, and appears upon the top of the water, which the cook usually takes off:

this denotes the filthiness and wickedness of the people, which would work up and be seen by the judgments of God upon them; yet should not be removed, but continue on them, unrepented of, and unpardoned. It signifies that they would remain hardened in their sins;

and that the judgments of God would have no effect upon them to bring them to repentance; and that God would have no mercy on them, or pardon their sins.

For her blood is in the midst of her; she set it upon the top of a rock; she poured it not upon the ground, to cover it with dust. she set it upon the top of a rock; where it could not soak in, as when spilled upon soft earth: this denotes her openness and impudence in shedding blood, as not being ashamed of it, or afraid of punishment for it,

but as rather glorying in it; perhaps there may be some allusion to the tops of hills and mountains, where idolatry was committed, attended with shedding human blood:

she poured it not upon the ground, to cover it with dust; she did not take any methods to hide her sin; having no sense of the heinousness of it, nor any consciousness of guilt, or any remorse or repentance; respect is had to a law which obliged to cover blood shed with dust, Leviticus 17:13;

— the Targum of the whole is, “because innocent blood which is shed in the midst of her; with pride and with a high arm she shed it; she shed it not through ignorance, that she might repent of it.”

That it might cause fury to come up to take vengeance, I have set her blood upon the top of a rock, that it should not be covered.

“‘Therefore thus saith the Lord God: Woe to the bloody city! I will even make the pile for fire great.

10 Heap on wood, kindle the fire, consume the flesh, and spice it well, and let the bones be burned.

11 Then set it empty upon the coals thereof, that the brass of it may be hot and may burn, and that the filthiness of it may be molten in it, that the scum of it may be consumed.

12 She hath wearied herself with lies, and her great scum went not forth out of her; her scum shall be in the fire.

13 In thy filthiness is lewdness. Because I have purged thee and thou wast not purged, thou shalt not be purged from thy filthiness any more, till I have caused My fury to rest upon thee.

14 I, the Lord, have spoken it: it shall come to pass, and I will do it. I will not go back, neither will I spare, neither will I repent. According to thy ways and according to thy doings shall they judge thee, saith the Lord God.’”

15 Also the word of the Lord came unto me, saying,

16 “Son of man, behold, I take away from thee the desire of thine eyes with a stroke; yet neither shalt thou mourn nor weep, neither shall thy tears run down. I take away from thee the desire of thine eyes with a stroke; meaning his wife; who very probably was of a beautiful countenance;

— this lovely object of his affection the Lord signifies he would take away from him by death unto himself; that is, suddenly and at once;

and so the Syriac and Arabic versions render it, “with a sudden stroke”; as sometimes persons are struck with death at once with an apoplexy or palsy;

the Targum renders it, with the pestilence; it was what the Jews call death by the hand of heaven, by the immediate hand of God; and, it may be, without any intervening disease; or, however, without any train of disorders which lead on to death.

17 Forbear to cry. Make no mourning for the dead. Bind the attire of thine head upon thee, and put on thy shoes upon thy feet, and cover not thy lips, and eat not the bread of men.”

18 So I spoke unto the people in the morning, and at evening my wife died; and I did in the morning as I was commanded. and at even my wife died; suddenly, as it was said she should; this shows who is meant by the desire of his eyes, and what by the taking it away;

— and I did in the morning as I was commanded; neither moaned, nor sighed, nor wept, nor shed a tear, nor used any of the common ceremonies of mourning, but dressed and ate as at other times, as he was ordered to do; this was the next morning after his wife died.

19 And the people said unto me, “Wilt thou not tell us what these things are to us, that thou doest so?”

20 Then I answered them, “The word of the Lord came unto me, saying,

21 Speak unto the house of Israel, ‘Thus saith the Lord God: Behold, I will profane My sanctuary, the excellency of your strength, the desire of your eyes, and that which your soul pitieth; and your sons and your daughters whom ye have left shall fall by the sword. — thus saith the Lord of hosts, behold, I will profane my sanctuary; the temple, built for him, and where he dwelt, and was worshipped; where duties performed and holy sacrifices offered up formerly;

this he says he would profane, that is, would bring the Chaldeans against Jerusalem, who should take and enter the temple, and so profane it, and make it common, yea, utterly destroy it;

but how would this parallel in the future? New York city? London? Paris?

22 And ye shall do as I have done: Ye shall not cover your lips, nor eat the bread of men.

23 And your attires shall be upon your heads and your shoes upon your feet. Ye shall not mourn nor weep, but ye shall pine away [meaning: to become thin and weak because of sadness or loss] for your iniquities and mourn one toward another.

24 Thus Ezekiel is unto you a sign: according to all that he hath done shall ye do. And when this cometh, ye shall know that I am the Lord God.’

25 “Also, thou son of man, shall it not be on the day when I take from them their strength, the joy of their glory, the desire of their eyes, and that whereupon they set their minds, their sons and their daughters,

26 that he that escapeth on that day shall come unto thee to cause thee to hear it with thine ears? — Rashi: on that day, it is impossible for the fugitive to come on the day of the destruction. Therefore this is the meaning: On that day that the fugitive will come to you to let you hear [of the destruction] with your own ears, on that day, your mouth will be opened;

to let you hear with your own ears: to announce the news that the city has been struck.

27 On that day shall thy mouth be opened to him who has escaped, and thou shalt speak and be no more dumb. And thou shalt be a sign unto them, and they shall know that I am the Lord.” — Peake: Ezekiel 3:22:  A Period of Silence — the Divine voice seems to decree for Ezekiel a period of temporary silence and inactivity. Perhaps Ezekiel 3:25 should read, “ I will lay bands on thee and bind thee”: at any rate, he is restrained in some way, whether, as some suppose, by some physical disability (e.g. catalepsy) or merely by the angry incredulity of his hearers, from proclaiming his message in public. He does not open his mouth, except in his own house to those who consult him privately (cf. Ezekiel 8:1), until his message is confirmed by the fall of Jerusalem (Ezekiel 33:21).

— Benson: In that day shall thy mouth be opened to him that is escaped; this implied, that the prophet was to prophesy no more about the affairs of Jerusalem and Judah till after the destruction of the city and temple; when the fulfilling of this part of his predictions, so contrary to the expectations of those who despised his prophecies, would give him more credit with them, and make them pay a higher regard to what other things he should prophesy of. According to this we find, that the spirit of prophecy, in regard to the affairs of Judea, did not come on him again till the news of the taking of Jerusalem was brought to him. See Ezekiel 3:21-27;

— Kretzmann: and I will make thy tongue cleave to the roof of thy mouth, before the very eyes of the rebellious people, that thou shalt be dumb and shalt not be to them a reprover [someone who finds fault or imputes blame], lest the words of his reproof might win the self-hardened sinners back; for they are a rebellious house, confirming themselves in their apostasy and obstinacy;

— v 27: But when I speak with thee, I will open thy mouth, in revealing the judgment of God upon his countrymen, and thou shalt say unto them, Thus saith the Lord God, He that heareth, let him hear, and he that forbeareth, let him forbear; for they are a rebellious house, and therefore would have only themselves to blame for the calamity which would surely strike them.

— every watchman in the midst of his congregation has a tremendous responsibility resting upon him, both in calling sinners to repentance and in warning believers against the ways of unrighteousness. One negligent in this duty is a murderer of fellow human beings.

Ezekiel (Ch 21-22)

•September 18, 2021 • Leave a Comment

Earlier, we have established that although Ezekiel has his face set toward Jerusalem, this prophecy is meant for the house of Israel at the endtime “for many years to come” (Ezekiel 12:27). Here, he is re-emphasizing the “Sword.” in fact, the word “Sword” occurs fourteen times in this chapter alone, being repeated over and over again, doubled and thrice for its significance. And remember, this prophecy is meant for the house of Israel which is primarily the United States of America, and secondarily its European allies. . .

Ezekiel 21

1 And the word of the Lord came unto me, saying,

“Son of man, set thy face toward Jerusalem, and drop thy word toward the holy places, and prophesy against the land of Israel; — “against the land of Israel”; this message for the house of Israel is meant for the United States and its European allies.

and say to the land of Israel, ‘Thus saith the Lord: Behold, I am against thee, and will draw forth My sword out of his sheath and will cut off from thee the righteous and the wicked. — and will draw forth my sword out of his sheath; a similar situation occurred to ancient Judah when the Chaldean army rushed out of Babylon into Judea and made the inhabitants captives. Poor thing, the righteous will also be “cut off” among the wicked; there is no place of safety that many among the endtime pretentious are hoping for.

Seeing then that I will cut off from thee the righteous and the wicked, therefore shall My sword go forth out of his sheath against all flesh from the south to the north, — his sheath against all flesh from the South to the North; oh, okay, this might give us a clue what “toward the South” and “kindle a fire in thee. . . from the South” are meant at the end of the preceding chapter.

— this Sword will come from the South! This is serious! It’s not just unwanted immigrants, these are warriors, conquering warriors set to slaughter!! For those in Europe, they might come from the whole of Africa; and for the United States, they might come from the whole South, all the Latinos of South America! And “against all flesh;”

— (and flaming flame in chapter 20:47) but in this chapter a subtle change: “My Sword go forth out of his sheath against all flesh from the South to the North.”

— all will die? Okay I might be taken away and over the top, but then again, why so much emphasis of the Sword in this chapter?

— Jonathan renders: Spain (Rashi quoting the Targum: Sepharad shall inherit the cities of the Southland as Spain); the Targums identified Sepharad with Spain, hence, Spanish Jews are called Sephardim;

— Wikipedia: Sepharad (/sɛfəræd/or səˈfɛərəd/ Hebrew: סְפָרַד Sp̄āraḏ; also Sefarad, Sephared, Sfard) is the Hebrew name for Spain. A place called Sepharad, probably referring to Sardis in Lydia (‘Sfard’ in Lydian), in the Book of Obadiah (Obadiah 1:20, 6th century BC) of the Hebrew Bible. The name was later applied to Spain.

that all flesh may know that I, the Lord, have drawn forth My sword out of his sheath. It shall not return any more.’ — see, more about the Sword! it shall not return any more; that is, into its sheath, until it has done all its work; meaning that the invading army should not return to their own land until they had executed the whole will of God upon the endtime house of Israel; this is the fire that should not be quenched.

— one Report by McKinsey says of the 60 millions Latinos in US that had migrated from the South; they often live in ‘deserts’ where adequate housing, groceries are hard to find. “Nearly 9 in 10 of the Latino residents in such communities lived in five states: California, Florida, New Jersey, New York and Texas.”

McKinsey: Latinos are projected to make up 22.4 percent of the US labor force by 2030 and more than 30 percent by 2060 (Latinos population to 111.2 million by ’60); is this analysis wrong? Am I mistaken? Do feel free to present your opinion; thanks.

Sigh therefore, thou son of man, with the breaking of thy loins [‘hearts’ in other versions], and with bitterness sigh before their eyes. — sigh, therefore, thou son of man, with the breaking of thy loins…. as if thy loins were broke, and go as if they were, and sigh as thou goest; or as a woman in travail, having her hands upon her loins as ready to break, and in the utmost distress; or heave, and groan, and sigh, till the girdle of the loins is broke, and by these motions and gesture show the miserable state of this people, and how much thou art affected with it.

And it shall be, when they say unto thee, ‘Why sighest thou?’ that thou shalt answer, ‘For the tidings, because it cometh; and every heart shall melt, and all hands shall be feeble, and every spirit shall faint, and all knees shall be weak as water.’ Behold, it cometh, and shall be brought to pass, saith the Lord God.” — ‘why sighest thou?’ . . . because it cometh”; the report of an invading army, approaching and besieging their land, the land of Israel, which Ezekiel had from the Lord; and the thing itself was just at hand, and would certainly be so bad; that was the issues that affected him, and caused so much sorrow and sighing.

Again the word of the Lord came unto me, saying,

“Son of man, prophesy and say, ‘Thus saith the Lord. Say: “‘A sword, a sword is sharpened and also furbished! — a sword, a sword, it is sharpened, and also furbished; it is sharpened that it may make a slaughter; it is furbished that it may be as lightning: the rod for the house of Israel. And it is given to be furbished, that it may be handled: the sword, it is sharpened, yea, it is furbished, to give it into the hand of the slayer.

10 It is sharpened to make a sore slaughter; it is furbished that it may glitter. Should we then make mirth? It contemneth the rod of My son, as every tree.

11 “‘And he hath given it to be furbished, that it may be handled; this sword is sharpened, and it is furbished to give it into the hand of the slayer.

12 Cry and howl, son of man! For it shall be upon My people; it shall be upon all the princes of Israel. Terrors by reason of the sword shall be upon My people; smite therefore upon thy thigh. — cry and wail, son of man; for it is upon my people, it is upon all the princes of Israel: they are delivered over to the sword with my people; smite therefore upon thy thigh;

smite therefore upon thy thigh; as one grieved in spirit, in great distress and anguish, as experienced by Jeremiah:

Surely after I was turned, I repented; and after I was instructed, I smote upon my thigh. I was ashamed, yea, even confounded, because I bore the reproach of my youth.’ Jeremiah 31:19.

13 Because it is a trial, and what if the sword contemn even the rod? It shall be no more, saith the Lord God.’ — and what if the sword contemn even the rod?; here God foretels, that if the house of Israel should despise, or not accept the correction or punishment brought upon them by the trial, the house of Israel would be entirely broken, and be no more. Serious stuff!

14 “Thou therefore, son of man, prophesy, and smite thine hands together; and let the sword be doubled the third time, the sword of the slain. It is the sword of the great men that are slain, which entereth into their secret chambers. — and smite thine hands together; the meaning of the clapping of the hands, smiting the hands together is an indication of violent grief; normally accompanied by the loud crying and wailing.

— “Let the sword be doubled the third time…”; this shows the tremendous size and power of the sword coming against the house of Israel. All hope of escape are gone.

— which entereth into their privy chambers; where they should endeavour to hide themselves from it, but in vain, none should escape; their privy chambers could not secrete nor secure them: or “which remains with them”; as that which is laid up, and reserved in a privy chamber.

15 I have set the point of the sword against all their gates, that their heart may faint and their ruins be multiplied. Ah! It is made bright; it is sharpened for the slaughter. Gill: I have set the point of the sword against all their gates…. the word rendered “point” is nowhere else used, and is differently translated: by some the “fear” of the sword; by others the “cry” of the sword, or of those that are slain with it, as the Targum paraphrases it, “those that slay with the sword.”

16 Go thee one way or other, either on the right hand or on the left, whithersoever thy face is set.

17 I will also smite Mine hands together, and I will cause My fury to rest. I, the Lord, have said it.” — I will also smite my hands together In token of my encouragement. I will animate and encourage the slayers to go on. God even said He needs to express His fury so He could find rest; the Targum says, “and even I will bring vengeance upon vengeance.”

18 The word of the Lord came unto me again, saying,

19 “Also, thou son of man, appoint thee two ways that the sword of the king of Babylon may come; both shall come forth out of one land. And choose thou a place; choose it at the head of the way to the city.

20 Appoint a way, that the sword may come to Rabbah of the Ammonites and to Judah in Jerusalem, the fortified.

21 For the king of Babylon stood at the parting of the way, at the head of the two ways, to use divination: he made his arrows bright, he consulted with images, he looked at the liver.

22 At his right hand was the divination for Jerusalem: to appoint captains, to open the mouth in the slaughter, to lift up the voice with shouting, to appoint battering rams against the gates, to cast a siege mound, and to build a fort.

23 And it shall be unto them as a false divination in their sight, to them that have sworn oaths; but he will call to remembrance the iniquity, that they may be taken.

24 “Therefore thus saith the Lord God: ‘Because ye have made your iniquity to be remembered, in that your transgressions are discovered, so that in all your doings your sins do appear — because, I say, that ye have come to remembrance, ye shall be taken with the hand.

25 And thou, profane, wicked prince of Israel, whose day is come when iniquity shall have an end, — the details given in the above few verses were about ancient Judah and its invasion, but Ezekiel’s message is for the endtime. Such details are written in coded language and only God knows what all these messages are to play out; so we may have to observe how world events eventuates in the next couple of years;

— which means these comments will need to be updated every now and then. Be patient, we’ll all get there.

26 thus saith the Lord God: “‘Remove the diadem and take off the crown; this shall not be the same. Exalt him that is low, and abase him that is high; thus saith the Lord God, remove the diadem, and take off the crown…. that is, from Zedekiah; and as these are the regalia and ensigns of royal dignity, taking them off signifies the deposition of him as a king;

— “exalt him that is low” is to exalt the Zarah line (from Pharez line). For more details, see “Judah’s Sceptre and Joseph’s Birthright” by J.H. Allen.

27 I will overturn, overturn, overturn it. And it shall be no more, until He come whose right it is; and I will give it to Him.’ — Jerusalem to Ireland, to Scotland and then finally to England; until he come whose right it is; the right of the crown and final king of Israel as scepter holder; also the Messiah, being descended from a race of kings of the house of Judah, and of the seed of David.

28 “And thou, son of man, prophesy and say, ‘Thus saith the Lord God concerning the Ammonites and concerning their reproach; even say thou: “‘The sword, the sword is drawn; for the slaughter it is furbished to consume because of the glittering” — this prophecy against Ammon has no promise of restoration. Why? We might speculate why the Ammonites were singled out here for this special oracle; but it might have pertained to the share they had in the murder of Gedaliah, by the hand of Ishmael and the Ammonites gave these killers refuge;

— second, in historic time, when Nebuchadnezzar took his route to Jerusalem, and destroyed the city, returned to Babylon, he went about without making any attempt upon the Ammonites; which so flushed the Ammonites that they insulted the Jews and laughed at their destruction, as if their God whom they served could not save them;

— and perhaps thirdly, the Ammonites are modern Jordan, sitting on land allocated to three of the tribes of Israel, and they maybe taking their ancestral land back, land that could even stretch to the Euphrates River.

29 while they see vanity unto thee, while they divine a lie unto thee, to bring thee upon the necks of them that are slain, of the wicked whose day is come when their iniquity shall have an end.

30 Shall I cause it to return into his sheath? I will judge thee in the place where thou wast created, in the land of thy nativity.

31 And I will pour out Mine indignation upon thee; I will blow against thee in the fire of My wrath, and deliver thee into the hand of brutish men, and skillful to destroy.

32 Thou shalt be for fuel to the fire; thy blood shall be in the midst of the land. Thou shalt be no more remembered; for I the Lord have spoken it.’” — thy blood shall be in the midst of the land; such large numbers shall be slain everywhere, that the land shall flow with the blood of them; who shall lie unburied, and rot, and putrefy upon the ground:

— and thou shalt be remembered no more. This prophecy against Ammon and the Ammonites has no promise of restoration; for the Lord have spoken it.

Ezekiel 22

In Chapter 10, God’s four judgments — SWORD, war. FAMINE, occasioned by drought. PESTILENCE, epidemic diseases which sweep off a great part of the inhabitants of a land. And in this chapter it is BLOOD! BLOOD is used 8 times.

1 Moreover the word of the Lord came unto me, saying,

“Now, thou son of man, wilt thou judge, wilt thou judge the bloody city? Yea, thou shalt show her all her abominations. the bloody city?… or, “city of blood” or “cities of blood” as in the United States with so much gun violence.

Then say thou, ‘Thus saith the Lord God: The city sheddeth blood in the midst of it, that her time may come, and maketh idols against herself to defile herself.

Thou art become guilty in thy blood that thou hast shed, and hast defiled thyself in thine idols which thou hast made; and thou hast caused thy days to draw near, and art come even unto thy years. Therefore have I made thee a reproach unto the nations and a mocking to all countries. — “I have made thee a reproach among the nations …” this is a prophecy of what will soon happen, as indicated in the future tense used in the next verse, “Those that are near, and those that are far from thee, shall mock thee.”

Those that are near and those that are far from thee shall mock thee, who art infamous and much vexed.

“‘Behold, the princes of Israel, every one was in thee to their power to shed blood. — behold, the princes of Israel…. those that belonged to the royal family, the rich and nobles of the land, members of Parliament of Congress of a nation.

In thee have they made light of father and mother. In the midst of thee have they dealt by oppression with the stranger. In thee have they vexed the fatherless and the widow. — in thee have they vexed the fatherless and the widow; that were weak and helpless, and had none to protect them, father and husband being dead; when, according to their first rank and station as princes, they ought to have been the defenders of them; but, instead of that, distressed, afflicted, and grieved them.

Thou hast despised Mine holy things and hast profaned My Sabbaths. thou hast despised mine holy thing…. the holy place, the temple, and the worship of it; holy persons, the priests that officiated there; holy sacrifices offered up by them; the holy word of God read and explained; and all holy ordinances there administered. These words are directed to Jerusalem, the holy city, and to the inhabitants of it, who ought to have been holy men;

and hast profaned my sabbaths; by doing their own work, and neglecting the service of God; and which was an inlet, as it usually is, to all manner of sin.

In thee are men that carry tales to shed blood, and in thee they eat upon the mountains. In the midst of thee they commit lewdness [indecency or obscenity]. in the midst of thee they commit lewdness; a general word for all manner of uncleanness, as adultery, fornication, incest, etc.

10 In thee have they uncovered their fathers’ nakedness. In thee have they humbled her that was set apart for pollution.

11 And one hath committed abomination with his neighbor’s wife, and another hath lewdly defiled his daughter-in-law, and another in thee hath humbled his sister, his father’s daughter.

12 In thee have they taken gifts to shed blood. Thou hast taken usury and increase, and thou hast greedily gained from thy neighbors by extortion, and hast forgotten Me, saith the Lord God. Gill: In thee have they taken gifts to shed blood….

— innocent blood, as the Targum says; judges upon the bench, whose office it is to take the part of the innocent, and clear him from unjust charges; and protect him from the violence of wicked and unreasonable men; that lay things to his charge, which, if true, would require blood;

and yet men in such offices took bribes to bring in the innocent guilty, and pass sentence of death on him; which is a most shocking iniquity indeed: to take bribes in pecuniary matters is very wicked; but to do it in cases which affect life is most dreadfully cruel: or if it is to be understood of such persons who take bribes to bear false witness against a man, to the taking away of his life, it is a very heinous and detestable sin; for, as for a set of jurymen bribed to bring in a wrong verdict, which would be equally a most enormous crime.

13 “‘Behold, therefore I have smitten Mine hand at thy dishonest gain which thou hast made and at thy blood which hath been in the midst of thee. behold, therefore, I have smitten mine hand at thy dishonest gain which thou hast made…. as one amazed at it; or as filled with indignation against it; or as grieved and distressed at it; or else as rejoicing at the punishment going to be inflicted on them for it;

— so the Septuagint renders it, “I will bring my hand upon them;” and the Targum,”behold, I will bring my vengeance upon thee for the sins of mammon.”

14 Can thine heart endure or can thine hands be strong in the days that I shall deal with thee? I, the Lord, have spoken it, and will do it.

15 And I will scatter thee among the nations and disperse thee in the countries, and will consume thy filthiness out of thee. — to be scattered and dispersed throughout various provinces of other nations, as chaff is by the winds.

16 And thou shalt take thine inheritance in thyself in the sight of the nations, and thou shalt know that I am the Lord.’”

17 And the word of the Lord came unto me, saying,

18 “Son of man, the house of Israel has to Me become dross [something regarded as worthless; rubbish]. All they are brass and tin and iron and lead in the midst of the furnace; they are even the dross of silver.

19 Therefore thus saith the Lord God: ‘Because ye have all become dross, behold, therefore I will gather you into the midst of Jerusalem.

20 As they gather silver and brass and iron and lead and tin into the midst of the furnace, to blow the fire upon it to melt it, so will I gather you in Mine anger and in My fury, and I will leave you there and melt you. several metals of the baser sort are here mentioned, by a gradation from the better to the worse; tin being not so good as brass, and iron of less value than either, and lead than any of them.

21 Yea, I will gather you and blow upon you in the fire of My wrath, and ye shall be melted in the midst thereof. and I will leave you there, and melt you; that is, I will leave you to the sword, famine, and pestilence, to be destroyed by them; or with fire at the burning of the city: or, “I will rest”; as the refiner does; having put his metal into the furnace, and blown the fire, sits still till all is melted.

22 As silver is melted in the midst of the furnace, so shall ye be melted in the midst thereof; and ye shall know that I, the Lord, have poured out My fury upon you.’”

23 And the word of the Lord came unto me, saying,

24 “Son of man, say unto her: ‘Thou art the land that is not cleansed nor rained upon in the day of indignation.’

25 There is a conspiracy of her prophets in the midst thereof, like a roaring lion ravening the prey. They have devoured souls; they have taken the treasure and precious things; they have made her many widows in the midst thereof.

26 Her priests have violated My law and have profaned Mine holy things. They have put no difference between the holy and profane, neither have they shown difference between the unclean and the clean, and have hid their eyes from My Sabbaths, and I am profaned among them.

27 Her princes in the midst thereof are like wolves ravening the prey, to shed blood and to destroy souls, to get dishonest gain.

28 And her prophets have daubed them with untempered mortar, seeing vanity and divining lies unto them, saying, ‘Thus saith the Lord God,’ when the Lord hath not spoken. — saying, thus saith the Lord God, when the Lord hath not spoken; herein mimicking the true prophets, who came in the name of the Lord, and usually prefaced their prophecies with a thus saith the Lord; and so did these false prophets, when the Lord said nothing to them, and gave them no commission to speak in his name, or say the things they did.

29 The people of the land have used oppression and exercised robbery, and have vexed the poor and needy; yea, they have oppressed the stranger wrongfully.

30 And I sought for a man among them that should make up the hedge and stand in the gap before Me for the land, that I should not destroy it; but I found none. but I found none; no reformer of them, no repairer of the breach, nor restorer of paths, to dwell in; no intercessor for them, as Abraham for Sodom, Moses for Israel; or any, like Aaron, that stood between the living and the dead to stay the plague.

31 Therefore have I poured out Mine indignation upon them; I have consumed them with the fire of My wrath. Their own way have I recompensed upon their heads, saith the Lord God.” — I have consumed them with the fire of my wrath; by the sword, famine, pestilence, and captivity.

Ezekiel (Ch 19-20)

•September 16, 2021 • Leave a Comment

Chapter 19 starts with a riddle of a lioness with her two whelps among other young lions. So what does each of them represent? The riddle seems to be a prophecy over the complexities of the house of Israel and the royal house of Judah spread out over the next two and a half thousands years. The scepter, which belongs to the royal house of Judah, are mentioned only twice in the book of Ezekiel, but both in this chapter. And earlier, we have established that this Ezekiel prophecy was for a time far into the future (Ezekiel 12:27). In fact it’s for the endtime, our time, and so here it is.

Coffman commented that this chapter is a dirge (a lament for the dead, especially one forming part of a funeral rite) written by Ezekiel as a prophetic funeral for the earthly end of the House of David. As Cooke stated it:

“Ezekiel could write fine poetry when he chose; and on this occasion the impulse came from a mixed emotion, his pride in the royal house of Judah, and his pity for the misfortunes of the young princes.”

Ezekiel 19

1“Moreover take thou up a lamentation for the princes of Israel, — so this chapter is a lamentation; notice it started at the beginning with a lamentation and at the end it says: “This is a lamentation and shall be a lamentation,” for the princes of Israel; but who are the princes of Israel?

and say: “‘What is thy mother? A lioness: she lay down among lions; she nourished her whelps among young lions. this indicates an original royal family that had spread her wings over many nations.

And she brought up one of her whelps; it became a young lion, and it learned to catch the prey; it devoured men.

The nations also heard of him; he was taken in their pit, and they brought him with chains unto the land of Egypt. — this young lion could well be Joseph, who was sold as a slave into Egypt, later his sons were to led the house of Israel, headed by Ephraim, the younger yet the ‘firstborn’ of Joseph.

Now when she saw that she had waited, and her hope was lost, then she took another of her whelps, and made him a young lion. — the house of Israel, headed by Ephraim, went into captivity, the lioness waited but her hope was lost as this young lion never came back. . . so her hope now lies with another whelp; the house of Judah.

And he went up and down among the lions; he became a young lion, and learned to catch the prey and devoured men. — the house of Judah grew and became a nation.

And he knew their desolate palaces, and he laid waste their cities; and the land was desolate and the fullness thereof by the noise of his roaring.

Then the nations set against him on every side from the provinces, and spread their net over him; he was taken in their pit. — first the Assyrians came to lay a siege against the house of Judah but they were repelled off. A while later the Chaldeans came and managed to conquer this young nation.

And they put him under guard in chains (put him in a cage as some versions say), and brought him to the king of Babylon. They brought him into prison, that his voice should no more be heard upon the mountains of Israel. — this young lion, “brought to the king of Babylon,” is clearly established to be house of Judah, the scepter holder, but its royal family had vanished;

— no more be heard upon the mountains of Israel; but yes, upon a hill of Israel: Ireland.

10 “‘Thy mother is like a vine in thy blood, planted by the waters; she was fruitful and full of branches by reason of many waters. — thy mother is like a vine in thy blood; having royal blood, this lioness is the royal family that had established herself over many nations.

11 And she had strong rods for the scepters of them that bore rule; and her stature was exalted among the thick branches, and she appeared in her height with the multitude of her branches. — a rod or scepter is an emblem of authority; with numerous offspring and prosperity this royal family would split and spread into numerous other royal families that ruled over many nations in western Europe.

12 But she was plucked up in fury; she was cast down to the ground, and the east wind dried up her fruit. Her strong rods were broken and withered; the fire consumed them. — many of the royal families were overcame “cast down” by revolutions: – France (1830), Portugal (1910), Russia (1917), Germany (1918), Hungary (1918), Italy (1946), Romania (1947), Greece (1974); – they withered and fire consumed them.

13 And now she is planted in the wilderness, in a dry and thirsty ground. — a few royal families remains, planted on dry and thirsty ground; powerless and without authority and in name only: Britain, Denmark, Belgium, Netherlands, Norway, Spain.

14 And fire has gone out from a rod of her branches, which hath devoured her fruit, so that she hath no strong rod to be a scepter to rule.’ This is a lamentation, and shall be for a lamentation.” — and fire is gone out of a rod of her; this speaks of the destruction of the royal family; she hath no strong rod; few of the royal blood of Judah or only weak ones will be left. And from that time onward, perhaps, no new royals would ever sat upon the throne of Israel;

— those that remains would end up in captivity too as fire would consume them. Dark days also lay ahead for their children as fire is ready to devour them as it devours her fruit. As the catastrophe shall be so complete, there will be a lot of mourning as lamentation will be compounded by further lamentation.

Ezekiel 20

This chapter is a continuation of lamentation for the princes and people of the house of Israel, on account of what had already befallen them, and what was yet to come. That means these are those that are left after one third died of famine and pestilence, another third of the sword, and these are those left over or those that survive in captivity.

1 And it came to pass in the seventh year, in the fifth month, the tenth day of the month, that certain of the elders of Israel came to inquire of the Lord, and sat before me. — these were either some of the elders that were carried captive, who came to inquire how long they should continue in this state; or what methods they should use to free themselves from it;

and sat before me; it is usually after some great calamities would elders would humble themselves and come to seek the Lord, by which time (verse 3 below) Ezekiel is forbidden to tell them that he would not be inquired of by them. During peace time these same people are usually contented to ignore God.

Then came the word of the Lord unto me, saying,

“Son of man, speak unto the elders of Israel and say unto them, ‘Thus saith the Lord God: Have ye come to inquire of Me? As I live, saith the Lord God, I will not be inquired of by you.’

Wilt thou judge them, son of man, wilt thou judge them? Cause them to know the abominations of their fathers; cause them to know the abominations of their fathers: God reminded them of the sins they committed, which were abominable in themselves and unto God, by which they would be led to see the abominable evils which they also had been guilty of, in which they had imitated their fathers, and what they had reason to expect in consequence of them.

and say unto them, ‘Thus saith the Lord God: On the day when I chose Israel, and lifted up Mine hand unto the seed of the house of Jacob, and made Myself known unto them in the land of Egypt, when I lifted up Mine hand unto them, saying, “I am the Lord your God.” — here begins the account of their fathers; of God’s unmerited goodness to them, and of their sins and transgressions against him, and how it fared with them.

on the day that I lifted up Mine hand unto them to bring them forth out of the land of Egypt into a land that I had espied for them, flowing with milk and honey, which is the glory of all lands, — which is the glory of all lands; that is, either which fertility, signified by milk and honey, is the glory of all lands, being so fruitful, is more glorious or desirable than any other country; it greatly surpassing all others in its situation, soil, and climate.

— the Targum says, “which is the praise of all provinces:” that is, was praised and commended by the inhabitants of all other provinces for the plenty in it; which must needs be very great, to support so large a number of inhabitants in it, and yet its compass but small.

then said I unto them: “Cast away every man of ye the abominations of his eyes, and defile not yourselves with the idols of Egypt: I am the Lord your God.”

But they rebelled against Me and would not hearken unto Me. They did not every man cast away the abominations of their eyes, neither did they forsake the idols of Egypt. “‘Then I said, “I will pour out My fury upon them, to accomplish My anger against them in the midst of the land of Egypt.”

But I wrought for My name’s sake, that it should not be polluted before the nations among whom they were, in whose sight I made Myself known unto them in bringing them forth out of the land of Egypt. — “I wrought for my name’s sake…”  this is a reference to the fact that God on several occasions did not judge Israel according to what they certainly deserved; but, that in order to prevent the nations from questioning God’s ability to protect his people, simply went on and blessed them in spite of their sins. Two examples of this are found in Exodus 32:12 and in Numbers 14:16.

10 Therefore I caused them to go forth out of the land of Egypt and brought them into the wilderness.

11 And I gave them My statutes and showed them My judgments, which if a man do, he shall even live in them. — God’s statutes and Judgments are dedicated to his servants to implement, starting with the Great Assembly, later the Sanhedrin. Today this Sanhedrin has been re-established here, inheriting and embedded with the following mandates:

Deuteronomy 16:18 “Judges and officers shalt thou make thee in all thy gates which the Lord thy God giveth thee, throughout thy tribes; and they shall judge the people with just judgment. 

19 Thou shalt not distort judgment; thou shalt not respect persons, neither take a bribe; for a bribe doth blind the eyes of the wise and pervert the words of the righteous.

Deuteronomy 17:11 According to the sentence of the law which they shall teach thee and according to the judgment which they shall tell thee, thou shalt do. Thou shalt not decline from the sentence which they shall show thee to the right hand nor to the left. 

12 And the man who will do presumptuously, and will not hearken unto the priest who standeth to minister there before the Lord thy God, or unto the judge, even that man shall die; and thou shalt put away the evil from Israel. 

13 And all the people shall hear, and fear, and do no more presumptuously.

And what happened in 70 AD in Jerusalem and Judea when God exercised His judgement?

History recorded only two sects that escaped this inferno:

(1) The Nazarenes as the early Christians were known in Acts 24:5. Many died as martyrs but according to Eusebius, some received divine warning and escaped to a northern town called Pella, west of the Jordan River.

(2) Pharisees of the House of Hillel escaped to Yavne. These were headed by a rabbi, Johanan ben Zakkai, the head of the Sanhedrin; he was smuggled out of besieged Jerusalem in a coffin. Later, his followers re-emerged as Rabbinic Jews who established the Hillel Calendar, which was revealed by Hillel II in about AD 359 concerning the rules of the Calendar.

12 Moreover also I gave them My Sabbaths to be a sign between Me and them, that they might know that I am the Lord who sanctify them.

13 But the house of Israel rebelled against Me in the wilderness. They walked not in My statutes and they despised My judgments, which if a man do, he shall even live in them; and My Sabbaths they greatly polluted. “‘Then I said I would pour out My fury upon them in the wilderness to consume them.

History recorded two prominent sects that died during this AD 70 inferno:

(a) The Sadducees and Boethusians, following the heretic Samaritan way of observing Passover, kept it on the night of the fourteenth; they perished in the inferno;

(b) The Essenes, after they had repudiated the calendar that was sanctioned by the Sanhedrin, then went about presumptuously making one of their own. They all perished by either the flaming Sword or the consuming Fire.

14 But I wrought for My name’s sake, that it should not be polluted before the nations, in whose sight I brought them out. — “I wrought for my name’s sake…”; this is repeated from verse 9, for emphasis.

15 Yet also I lifted up My hand unto them in the wilderness, that I would not bring them into the land which I had given them, flowing with milk and honey, which is the glory of all lands,

16 because they despised My judgments and walked not in My statutes, but polluted My Sabbaths; for their heart went after their idols.

17 Nevertheless Mine eye spared them from destroying them, neither did I make an end of them in the wilderness.

18 “‘But I said unto their children in the wilderness: “Walk ye not in the statutes of your fathers, neither observe their judgments, nor defile yourselves with their idols.

19 I am the Lord your God: Walk in My statutes, and keep My judgments, and do them;

20 and hallow My Sabbaths, and they shall be a sign between Me and you, that ye may know that I am the Lord your God.”

21 Notwithstanding, the children rebelled against Me. They walked not in My statutes, neither kept My judgments to do them, which if a man do, he shall even live in them; they polluted My Sabbaths. “‘Then I said I would pour out My fury upon them to accomplish My anger against them in the wilderness.

22 Nevertheless I withdrew Mine hand and wrought for My name’s sake, that it should not be polluted in the sight of the nations, in whose sight I brought them forth. — “I withdrew Mine hand and wrought for my name’s sake…”; again, this is repeated from verse 9 and 14 with some variations, for emphasis.

23 I lifted up Mine hand unto them also in the wilderness, that I would scatter them among the nations and disperse them through the countries,

24 because they had not executed My judgments, but had despised My statutes and had polluted My Sabbaths, and their eyes were after their fathers’ idols.

25 Therefore I gave them also statutes that were not good and judgments whereby they should not live;

26 and I polluted them in their own gifts, in that they caused to pass through the fire all who openeth the womb, that I might make them desolate, to the end that they might know that I am the Lord.’

27 “Therefore, son of man, speak unto the house of Israel and say unto them, ‘Thus saith the Lord God: Yet in this your fathers have blasphemed Me, in that they have committed a trespass against Me.

28 For when I had brought them into the land for which I lifted up Mine hand to give it to them, then they saw every high hill and all the thick trees, and they offered there their sacrifices, and there they presented the provocation of their offering. There also they made their sweet savor, and poured out there their drink offerings.

29 Then I said unto them: What is the high place whereunto ye go?’” (And the name thereof is called Bamah unto this day.)

30 “Therefore say unto the house of Israel, ‘Thus saith the Lord God: Are ye polluted after the manner of your fathers? And commit ye whoredom after their abominations?

31 For when ye offer your gifts, when ye make your sons pass through the fire, ye pollute yourselves with all your idols, even unto this day. And shall I be inquired of by you, O house of Israel? As I live, saith the Lord God, I will not be inquired of by you.

32 “‘And that which cometh into your mind shall not be at all: in that ye say, “We will be as the nations, as the families of the countries, to serve wood and stone.”

33 “‘As I live, saith the Lord God, surely with a mighty hand and with a stretched out arm and with fury poured out, will I rule over you.

34 And I will bring you out from the people, and will gather you out of the countries wherein ye are scattered, with a mighty hand and with a stretched out arm, and with fury poured out;

35 and I will bring you into the wilderness of the people, and there will I plead with you face to face. — “I will bring you into the wilderness of the peoples…”; this new wilderness was not a geographical wilderness like the wilderness of Egypt, but a wilderness, “of strange peoples, unusual social customs, etc,” 

— it was the wilderness of their captivity in an unknown civilization, the Assyrian; and the vast majority of Israel would not pass that test of being an Israelite, any more than their fathers had passed it in the former wilderness, Egypt;

— most of them, enamored with the wealth and splendor of modern “civilization” would never leave for any return to Palestine, even when free to do so. Such persons were described as, “Separated by the refining process, and not allowed to participate in the restoration.”

36 As I pleaded with your fathers in the wilderness of the land of Egypt, so will I plead with you, saith the Lord God.

37 And I will cause you to pass under the rod, and I will bring you into the bond of the covenant;

38 and I will purge out from among you the rebels and them that transgress against Me. I will bring them forth out of the country where they sojourn, and they shall not enter into the land of Israel; and ye shall know that I am the Lord.

39 “‘As for you, O house of Israel, thus saith the Lord God: Go ye, serve ye every one his idols, and hereafter also, if ye will not hearken unto Me; but pollute ye My holy name no more with your gifts, and with your idols. — “go ye, serve every one his idols…” this is the same kind of commandment that God gave to Judas Iscariot, when he said, “What thou doest, do quickly.” God never restrains anyone from evil who has already made up his mind to do more evil: “We lied, We cheated, We stole… It reminds you of the glory of the American experiment.” That would appear to be the condition of those elders who sat in front of Ezekiel.

40 For in Mine holy mountain, in the mountain of the height of Israel, saith the Lord God, there shall all the house of Israel, all of them in the land, serve Me. There will I accept them, and there will I require your offerings and the firstfruits of your oblations, with all your holy things. — “all hostilities and separation between Israel and Judah shall cease;” this is in great contrast we have today:

“Manasseh, Ephraim; and Ephraim, Manasseh; and they together shall be against Judah. For all this His anger is not turned away, but His hand is stretched out still” Isaiah 9:21 

The vast majority of today’s professing Christianity (99.99 percent) in the house of Ephraim and Manasseh make one fundamental error against his brother Judah in studying The Oracles of God.

41 I will accept you with your sweet savor when I bring you out from the people and gather you out of the countries wherein ye have been scattered; and I will be sanctified in you before the nations. — and I will be sanctified in you before the nations; the outside world will take notice of the power and eminence of God, in the conversion and restoration of house of Israel, and praise and glorify him on account of His doing; and when He will be visibly feared, served, and worshipped, in the midst of Israel.

42 And ye shall know that I am the Lord, when I shall bring you into the land of Israel, into the country for which I lifted up Mine hand to give it to your fathers.

43 And there shall ye remember your ways and all your doings wherein ye have been defiled; and ye shall loathe yourselves in your own sight for all your evils that ye have committed.

44 And ye shall know that I am the Lord, when I have wrought with you for My name’s sake, not according to your wicked ways, nor according to your corrupt doings, O ye house of Israel, saith the Lord God.’”

45 Moreover the word of the Lord came unto me, saying,

46 “Son of man, set thy face toward the south, and drop thy word toward the south, and prophesy against the forest of the southland. — prophesy against the forest of the southland; this prophecy “against” indicates something with a bad outcome, which could be literal or could be symbolic, or even both. But remember again that this prophecy meant is for the house of Israel and is “of the times that are far off (Ezekiel 12:27); far into the future, this time, our time.

47 And say to the forest of the south: ‘Hear the word of the Lord. Thus saith the Lord God: Behold, I will kindle a fire in thee, and it shall devour every green tree in thee and every dry tree. The flaming flame shall not be quenched, and all faces from the south to the north shall be burned therein. — this “kindle a fire” could be literal: the southern United States and southern Europe could be “kindled with fire” and much of the farmland could be in drought and be burnt up and eventually led to famine;

— but it could also be symbolic, where the south of United States (Mexico) and the south of Europe (North Africa) could be burnt with famine and civil unrest that led to huge unwanted migration to the north.

— and it shall devour every green tree, and every dry tree; all sorts of persons should be consumed by one or other of the above calamities, high and low, rich and poor, good and bad; and if good men should suffer, comparable to green trees, which fire will not so easily burn, not being fit fuel for it; then much more bad men, who were by far the most numerous, comparable to dry trees, and so fit fuel for the flames, and easily consumed thereby;

— and this flaming flame will spread from the south to the north: “and all faces from the south to the north shall be burned.”

48 And all flesh shall see that I, the Lord, have kindled it; it shall not be quenched.’” — by this “all flesh shall see that I” the God of heaven will be manifested to all the rest of the nations.

49 Then said I, “Ah, Lord God! They say of me, ‘Doth he not speak parables?’” — parables, riddles and enigmas; sobering thoughts, isn’t it? If there are alternative ideas, please feel free to share, thanks.

Ezekiel (Ch 17-18) 

•September 14, 2021 • Leave a Comment

Chapter 17 starts with a riddle of two eagles and a vine and some mysteries along the historical footpaths in the complexities of the house of Judah and the house of Israel. The best book to have expounded this riddle is “Judah’s Sceptre and Joseph’s Birthright” by J.H. Allen (1847-1930).

In summary, this riddle is a mysterious prophecy as a form of a riddle to both Judah and Israel, which shows how the planting and rebuilding of David’s throne was survive beyond the captivity.

“And the word of the Lord came unto me, saying, Son of man, put forth a riddle, and speak a parable unto the house of Israel; and say, Thus says the Lord God; A great eagle… came unto Lebanon, and took the highest branch of the cedar: he cropped off the top of his young twigs, and carried it into a land of traffic; he set it in a city of merchants. He took also of the seed of the land, and planted it in a fruitful field; he placed it by great waters, and set it as a willow tree. And it grew, and became a spreading vine of low stature… and shot forth sprigs” (Ezekiel 17:1-6).

An Amazing Commission—and a Breach Healed!

The great eagle at the beginning of the riddle was the king of Babylon, who took Zedekiah captive. Verse 11 describes the destruction of Zedekiah’s Pharez lineage. The execution of his sons is the cropping off of the cedar’s young twigs. The “vine of low stature… [shooting] forth sprigs” reflects Judah’s freedom to movement while in captivity in Babylon. The second great eagle (vs. 7) refers to Jeremiah who took the princess from Babylon to Egypt, and later, beyond the seas to the British Isles.

This part of the prophecy pertained to the first eagle of Ezekiel’s riddle—the rooting up and tearing down of the existing throne in Judah. But within this same prophecy, the planting and building up is also addressed, which is the work of the second eagle performed by prophet Jeremiah.

Verses 22-23 go on to describe what was Jeremiah’s commission to re-establish David’s throne in another location. God says that He will take of the highest branch—the seed of King Zedekiah—and set it or plant it. The “tender young twig” of verse 22 could be none other than one of the king’s daughters that Jeremiah took with him to plant in the British Isles. Thus, the “high mountain and eminent” depicts the nations of Israel as God knew they were destined to become, once the birthright promise was realized.

God states that it will eventually be known that it was He who brought down the high tree and exalted the low tree (vs. 24). In light of this, notice a parallel Scripture in Isaiah: “And the remnant that is escaped of the house of Judah shall again take root downward, and bear fruit upward” (37:31). Jeremiah presented this young Hebrew princess—Tea Tephi—to the Zarah line ruling in the British Isles! Her marriage and children would continue the scepter and the dynasty promised David—and heal the breach.

Ezekiel 17

1 And the word of the Lord came unto me, saying,

“Son of man, put forth a riddle, and speak a parable unto the house of Israel,

and say, ‘Thus saith the Lord God: A great eagle with great wings, longwinged, full of feathers which had diverse colors, came unto Lebanon and took the highest branch of the cedar. — a great eagle; which is Nebuchadnezzar king of Babylon, as it is explained, Ezekiel 17:12; who is compared to an eagle for his power and authority, that being the king of birds, and for his swiftness and voracity in conquering and subduing kingdoms; see Jeremiah 48:40.

He cropped off the top of it young twigs and carried it into a land of traffic; he set it in a city of merchants. — young twigs mentioned, but tender ones.

He took also of the seed of the land and planted it in a fruitful field. He placed it by great waters and set it as a willow tree. — the seed of the land; Zedekiah, brother of Jehoiachin, and all their children.

And it [the seed] grew and became a spreading vine of low stature, whose branches turned toward him and the roots thereof were under him. So it became a vine, and brought forth branches and shot forth sprigs. — this indicates that children were born unto them that were in captivity, but that they were to keep a low profile.

“‘There was also another great eagle with great wings and many feathers; and behold, this vine did bend her roots toward him and shot forth her branches toward him, that he might water it by the furrows of her planting. — there was also another great eagle, with great wings and many feathers: — many (John Gill, Adam Clarke, though JH Allen is indecisive or ambiguous) identify this second eagle as the Pharaoh of Egypt, but it seems more like whoever took Jeremiah and the king’s daughters to the British Isles fit this character of a great eagle with great wings. It remains a mystery but whoever took Jeremiah and the king’s daughters in its ship or ships, would be the second eagle that flew over the great seas to transplant the tender twigs there.

It was planted in a good soil by great waters, that it might bring forth branches and that it might bear fruit, that it might be a goodly vine.’

Say thou, ‘Thus saith the Lord God: Shall it prosper? Shall he not pull up the roots thereof and cut off the fruit thereof, that it wither? It shall wither in all the leaves of her spring, even without great power or many people to pluck it up by the roots thereof.

10 Yea, behold, being planted, shall it prosper? Shall it not utterly wither when the east wind toucheth it? It shall wither in the furrows where it grew.’”

11 Moreover the word of the Lord came unto me, saying,

12 “Say now to the rebellious house: ‘Know ye not what these things mean?’ Tell them: ‘Behold, the king of Babylon is come to Jerusalem, and hath taken the king thereof and the princes thereof, and led them with him to Babylon; — and hath taken the king thereof, and the princes (but princess left out here) thereof, and led them with him to Babylon; the king of Judea, and the princes of it; Jeconiah and his nobles, who had been carried captive into Babylon by Nebuchadnezzar; for Ezekiel was among these captives.

13 and hath taken of the king’s seed and made a covenant with him, and hath taken an oath from him. He hath also taken the mighty of the land,

14 that the kingdom might be base, that it might not lift itself up, but that by keeping of his covenant it might stand.

15 But he rebelled against him in sending his ambassadors into Egypt, that they might give him horses and many people. Shall he prosper? Shall he escape that doeth such things? Or shall he break the covenant and be delivered? but he rebelled against him…. Zedekiah rebelled against the king of Babylon, broke the covenant he entered into, and violated his oath.

16 As I live, saith the Lord God, surely in the place where the king dwelleth that made him king, whose oath he despised and whose covenant he broke, even with him in the midst of Babylon he shall die. — surely in the place where the king dwelleth that made him king; in Babylon, where Nebuchadnezzar dwelt, that made Zedekiah king of Judah; which is mentioned, to point out the ingratitude of Zedekiah toward the king of Babylon, but instead, send envoys to Egypt, asking for horses and an army to help him (verse 15).

17 Neither shall Pharaoh with his mighty army and great company help him in the war, by casting up siege mounds and building forts to cut off many persons.

18 Seeing he despised the oath by breaking the covenant, when, lo, he had given his hand and hath done all these things, he shall not escape.

19 Therefore thus saith the Lord God: As I live, surely Mine oath that he hath despised and My covenant that he hath broken, even it will I recompense upon his own head.

20 And I will spread My net upon him, and he shall be taken in My snare, and I will bring him to Babylon and will plead with him there for his trespass that he hath trespassed against Me.

21 And all his fugitives with all his troops shall fall by the sword, and they that remain shall be scattered toward all winds; and ye shall know that I, the Lord, have spoken it.

22 “‘Thus saith the Lord God: I will also take of the highest branch of the high cedar, and will set it; I will crop off from the top of his young twigs a tender one, and will plant it upon a high mountain and eminent. — I (through the second eagle) will crop off from the top of his young twigs a tender one (the feminine gender); and by the “top” and “young twigs” of the highest branch of the cedar, or of the chief tribe in Israel, are meant the royal house and family of David, and the chief of the tribe of Judah; and by the “tender one” is designed the tender gender, the daughters;

— and the Targum says, “I will bring one of the kingdom of the house of David, which is like to a high cedar, and I will raise him up an infant from his children’s children.” But Jeremiah verifies these children were the King’s daughters:

Then Ishmael carried away captive all the residue of the people who were in Mizpah, even the king’s daughters and all the people that remained in Mizpah, whom Nebuzaradan the captain of the guard had committed to Gedaliah the son of Ahikam; and Ishmael the son of Nethaniah carried them away captive, and departed to go over to the Ammonites. Jeremiah 41:10

23 In the mountain of the height of Israel will I plant it; and it shall bring forth boughs and bear fruit and be a goodly cedar, and under it shall dwell all fowl of every wing; in the shadow of the branches thereof shall they dwell. in the mountain of the height of Israel will I plant it…. in the highest part of the land of Israel, which during that time those at “the height of Israel” could well be in the British Isles (Israel in the isles of the sea, Isaiah 24:15), led by Ephraim. (Ephraim followeth after the east wind, Hosea 12:1)

24 And all the trees of the field shall know that I, the Lord, have brought down the high tree, have exalted the low tree, have dried up the green tree, and have made the dry tree to flourish. I, the Lord, have spoken and have done it.’”

Ezekiel 18

Earlier, we have established that this prophecy that Ezekiel delivered was for many years to come (Ezekiel 12:27), and the message is primarily and principally for the United States of America, and secondarily for its European allies. Here the prophecy on the house of Israel continues. . .

1 The word of the Lord came unto me again, saying,

“What mean ye, that ye use this proverb concerning the land of Israel, saying: ‘The fathers have eaten sour grapes, and the children’s teeth are set on edge’? saying, the fathers have eaten sour grapes, and the children’s teeth are set on edge? that is, as the Targum explains it, “the fathers have sinned, and the children are smitten.”

As I live, saith the Lord God, ye shall not have occasion any more to use this proverb in Israel.

Behold, all souls are Mine. As the soul of the father, so also the soul of the son is Mine: the soul that sinneth, it shall die. the soul that sinneth, it shall die; the soul that continues in sin, without repentance towards God, shall be separated from the presence of God, and endure his wrath to all eternity.

But if a man be just and do that which is lawful and right,

and hath not eaten upon the mountains, neither hath lifted up his eyes to the idols of the house of Israel, neither hath defiled his neighbor’s wife, neither hath come near to a menstruous woman, neither hath defiled his neighbour’s wife; been guilty of adultery, by lying with another man’s wife; or by marrying one divorced, not having committed fornication; which divorces were common among the people, and marrying such so divorced.

and hath not oppressed any, but hath restored to the debtor his pledge, hath despoiled none by violence, hath given his bread to the hungry, and hath covered the naked with a garment;

he that hath not given forth upon usury, neither hath taken any increase, that hath withdrawn his hand from iniquity, hath executed true judgment between man and man, hath executed true judgment between man and man; whether in office as a judge, who sits on the bench for that purpose; or as an arbitrator chosen to decide matters in controversy between one man and another, and that does everything just and right between man and man.

hath walked in My statutes and hath kept My judgments to deal truly — he is just: he shall surely live, saith the Lord God. God’s statutes and Judgments are dedicated to his servants to implement, starting with the Great Assembly, later the Sanhedrin. Today this Sanhedrin has been re-established here, inheriting and embedded with the following mandates:

Deuteronomy 16:18 “Judges and officers shalt thou make thee in all thy gates which the Lord thy God giveth thee, throughout thy tribes; and they shall judge the people with just judgment. 

19 Thou shalt not distort judgment; thou shalt not respect persons, neither take a bribe; for a bribe doth blind the eyes of the wise and pervert the words of the righteous.

Deuteronomy 17:11 According to the sentence of the law which they shall teach thee and according to the judgment which they shall tell thee, thou shalt do. Thou shalt not decline from the sentence which they shall show thee to the right hand nor to the left. 

12 And the man who will do presumptuously, and will not hearken unto the priest who standeth to minister there before the Lord thy God, or unto the judge, even that man shall die; and thou shalt put away the evil from Israel. 

13 And all the people shall hear, and fear, and do no more presumptuously.

And what happened in AD 70 in Jerusalem and Judea when God exercised His judgement?

(a) The Sadducees and Boethusians, following the heretic Samaritan way of observing Passover, kept it on the night of the fourteenth; they perished in the inferno;

(b) The Essenes, after they had repudiated the calendar that was sanctioned by the Sanhedrin, then went about presumptuously making one of their own. They all perished by either the flaming Sword or the consuming Fire.

I create darkness; I create evil; I, the LORD, do all these things (Isaiah 45:7).

10 “If he beget a son who is a robber, a shedder of blood, and who doeth the like to any one of these things,

11 and who doeth not any of those duties, but even hath eaten upon the mountains and defiled his neighbor’s wife,

12 hath oppressed the poor and needy, hath despoiled by violence, hath not restored the pledge and hath lifted up his eyes to the idols, hath committed abomination,

13 hath given forth upon usury and hath taken increase — shall he then live? He shall not live. He hath done all these abominations: he shall surely die. His blood shall be upon him.

14 “Now, lo, if he beget a son who seeth all his father’s sins which he hath done, and considereth and doeth not the like,

15 who hath not eaten upon the mountains, neither hath lifted up his eyes to the idols of the house of Israel, hath not defiled his neighbor’s wife,

16 neither hath oppressed any, hath not withheld the pledge, neither hath despoiled by violence, but hath given his bread to the hungry and hath covered the naked with a garment;

17 who hath taken off his hand from the poor, who hath not received usury nor increase, hath executed My judgments, hath walked in My statutes — he shall not die for the iniquity of his father: he shall surely live.

18 As for his father, because he cruelly oppressed, despoiled his brother by violence, and did that which is not good among his people, lo, even he shall die in his iniquity.

19 “Yet say ye, ‘Why? Doth not the son bear the iniquity of the father?’ When the son hath done that which is lawful and right, and hath kept all My statutes and hath done them, he shall surely live.

20 The soul that sinneth, it shall die. The son shall not bear the iniquity of the father, neither shall the father bear the iniquity of the son: the righteousness of the righteous shall be upon him, and the wickedness of the wicked shall be upon him. the son shall not bear the iniquity of the father, neither shall the father bear the iniquity of the son; that is, as the Targum paraphrases it, “the son shall not be punished for the sins of the father, nor shall the father be punished for the sins of the son.”

— but sometimes, one goes through great sufferings though no fault of his or her own, to develop righteous character, like Job and many others did; these will be rewarded enormously at the end.

21 But if the wicked will turn from all his sins that he hath committed and keep all My statutes and do that which is lawful and right, he shall surely live: he shall not die.

22 All his transgressions that he hath committed, they shall not be mentioned unto him. In his righteousness that he hath done he shall live.

23 “Have I any pleasure at all that the wicked should die, saith the Lord God, and not that he should return from his ways and live?

24 But when the righteous turneth away from his righteousness, and committeth iniquity, and doeth according to all the abominations that the wicked man doeth, shall he live? All his righteousness that he hath done shall not be mentioned: in his trespass that he hath trespassed and in his sin that he hath sinned, in them shall he die. — but if the righteous man turn from his righteousness, and doeth wickedness, and acteth according to all the abominations which the ungodly man hath done, should he live? All the righteousness that he hath done shall not be remembered: for his unfaithfulness that he hath committed, and for his sin that he hath sinned, for these he shall die.

25 “Yet ye say, ‘The way of the Lord is not equal.’ Hear now, O house of Israel: Is not My way equal? Are not your ways unequal?

26 When a righteous man turneth away from his righteousness, and committeth iniquity and dieth in it, for his iniquity that he hath done shall he die.

27 Again, when the wicked man turneth away from his wickedness that he hath committed, and doeth that which is lawful and right, he shall save his soul alive. he shall save his soul alive; from famine, pestilence, the sword, or captivity; he shall be preserved, and not be involved in calamities and distress.

28 Because he considereth and turneth away from all his transgressions that he hath committed, he shall surely live: he shall not die. — the Nazarenes and the Hillel branch of Pharisees survived . . . (more below)

29 Yet saith the house of Israel, ‘The way of the Lord is not equal.’ O house of Israel, are not My ways equal? Are not your ways unequal?

30 “Therefore I will judge you, O house of Israel, every one according to his ways, saith the Lord God. Repent, and turn yourselves from all your transgressions, so iniquity shall not be your ruin.

31 Cast away from you all your transgressions whereby ye have transgressed, and make yourselves a new heart and a new spirit. For why will ye die, O house of Israel?

32 For I have no pleasure in the death of him that dieth, saith the Lord God. Therefore turn yourselves, and live ye.

~~~

But which sects managed to escape from the Romans during the AD 66 to 70 siege of Jerusalem? History recorded only two sects that escaped this inferno:

(1) The Christians, known as Nazarenes in Acts 24:5. Many died as martyrs but according to Eusebius, some received divine warning and escaped to a northern town called Pella, west of the Jordan River.

(2) Pharisees of the House of Hillel escaped to Yavne. These were headed by a rabbi, Johanan ben Zakkai, the head of the Sanhedrin; he was smuggled out of besieged Jerusalem in a coffin. Later, his followers re-emerged as Rabbinic Jews who established the Hillel Calendar, which was revealed by Hillel II in about AD 359 concerning the rules of the Calendar.

Ezekiel (Ch 15-16)

•September 12, 2021 • Leave a Comment

Earlier, we have established that this prophecy that Ezekiel delivered was not to be fulfilled during his time, but that its timing was a great distance into the future (Ezekiel 12:27), into our time and the message is primarily and principally for the United States of America, and secondarily its European allies.

Ezekiel 15

1 And the word of the Lord came unto me, saying,

“Son of man, what is the vine tree more than any tree, or than a branch which is among the trees of the forest? — Clarke: what is the vine tree more than any tree; it’s certain that the vine is esteemed only on account of its fruit.

Shall wood be taken thereof to do any work? Or will men take a peg from it to hang any vessel thereon? shall wood be taken thereof to do any work?…. the carpenter and joiner, the house or ship builder, are employed in; as to build houses of, make beams, rafters, floors, build ships with, make masts of, or any vessel or utensil for the use of man.

Behold, it is cast into the fire for fuel; the fire devoureth both the ends of it, and the middle of it is burned. Is it meet for any work? — behold, it is cast into the fire for fuel, that is; a vine tree when cut down, or a branch when cut off, it is good for nothing else; and that is the use it is generally put to; and this, it is suggested, would be the end of the house of Israel; who were become by their sins like a wild vine, and were fit fuel for the fire of divine wrath.

the fire devoureth both ends of it; the branch cast into it, and so is quickly consumed. In Isaiah 9:12; “the Syrians before, and the Philistines behind, and they devour Israel with open mouth.”

Behold, when it was whole, it was meet for no work. How much less shall it be meet yet for any work when the fire hath devoured it and it is burned?

Therefore thus saith the Lord God: As the vine tree among the trees of the forest which I have given to the fire for fuel, so will I give the inhabitants of Jerusalem. so this was fulfilled to Jerusalem in 70 AD, where “I have given to the fire for fuel;” to be burnt, as other trees of the forest are, and along with them; again in 132-135 AD; and could reoccur during the endtime for the house of Israel.

And I will set My face against them: they shall go out from one fire, and another fire shall devour them. And ye shall know that I am the Lord, when I set My face against them. — the house of Israel will be surrounded at all sides, fires everywhere, no place to run to;

from one calamity to another; those that escaped the famine and pestilence in the city fell by the sword; and those that escaped famine, sword, and pestilence, were carried into captivity, and there passed from one hardship and affliction to another.

— the Targum says, “I will execute my vengeance on them, because of the words of the law, which were given out of the midst of fire; they have transgressed, and people who are strong as fire shall consume them.”

— “Out of the cauldron, into the flame.”

And I will make the land desolate, because they have committed a trespass, saith the Lord God.”

Ezekiel 16

1 Again the word of the Lord came unto me, saying,

“Son of man, cause Jerusalem to know her abominations

and say, ‘Thus saith the Lord God unto Jerusalem: Thy birth and thy nativity are of the land of Canaan; thy father was an Amorite and thy mother a Hittite. thy father was an Amorite, and thy mother an Hittite; Abraham and Sarah, who were, properly speaking, the one the father, the other the mother, of the house of Israel, were Chaldeans; and neither Amorites nor Hittites; yet, because they dwelt among them; are so called; and especially since before their conversion they were idolaters, as those were;

besides, the Jews who descended from Judah, and from whom they have their name, very probably sprung from ancestors who might be Amorites and Hittites: since Judah married the daughter of a Canaanite, and such an one seems to be Tamar, he took for his son Er, and by whom he himself had two sons, Pharez and Zarah.

And as for thy nativity, on the day thou wast born thy navel was not cut, neither wast thou washed in water to soothe thee. Thou wast not salted at all, nor swaddled at all. Gill: thy navel was not cut; alluding to what is done to a newborn infant, when the midwife immediately takes care to cut the navel string, by which the child adheres to its mother, and takes in its breath and nourishment in the womb;

— the Targum refers it, “neither wast thou washed in water to supple thee: which also is done, to an infant as soon as born, to cleanse it from the menstruous blood, to make the flesh sleek, and smooth, and amiable; which is done in hot water:

— thou wast not salted at all; which was done, either by sprinkling salt upon it, or using salt and water h, as a detersive of uncleanness, to prevent putrefaction, to dry up the humours, and harden the flesh, and consolidate the parts.

No eye pitied thee to do any of these unto thee, to have compassion upon thee; but thou wast cast out in the open field, to the loathing of thy person on the day that thou wast born. — but thou wast cast out in the open field; alluding to infants exposed by their unnatural parents, or unkind nurses, and left in an open field, or any desert place, to perish for want, unless some kind providence appears for them:

— this open field may design the land of Egypt, where Jacob and his posterity were, being driven out of Canaan by a famine; and where, after the death of Joseph, they were exposed to the hardships and cruelties of the Egyptians;

— and so the Targum paraphrases it, “and he (Pharaoh) decreed a full decree to cast your male children into the river, to destroy you when you were in Egypt.”

“‘And when I passed by thee and saw thee polluted in thine own blood, I said unto thee when thou wast in thy blood, “Live”; yea, I said unto thee when thou wast in thy blood, “Live.” — the Israelites were trodden under foot by the Egyptians, when they made them to serve with rigour, in mortar, and in brick, and in all manner of service in the field;

— and so the Targum paraphrases it, “for it was manifest before me that you were afflicted in your bondage;” as they sighed and cried because of their bondage, the Lord looked upon them with an eye of pity and compassion, and delivered them.

— these are reminder of the house of Israel happening again, this time for 190 years instead of the 210 years in Egypt.

I have caused thee to multiply as the bud of the field, and thou hast increased and waxed great, and thou art come to excellent ornaments. Thy breasts are fashioned and thine hair is grown, whereas thou wast naked and bare.

“‘Now when I passed by thee and looked upon thee, behold, thy time was the time of love; and I spread My skirt over thee and covered thy nakedness. Yea, I swore unto thee and entered into a covenant with thee, saith the Lord God, and thou becamest Mine.

Then washed I thee with water; yea, I thoroughly washed away thy blood from thee, and I anointed thee with oil.

10 I clothed thee also with embroidered work and shod thee with badgers’ skin, and I girded thee about with fine linen, and I covered thee with silk.

Wikipedia: The production of silk originated in China in the Neolithic period, although it would eventually reach other places of the world (Yangshao culture, 4th millennium BC). Silk production remained confined to China until the Silk Road opened at some point during the latter part of the 1st millennium BC, though China maintained its virtual monopoly over silk production for another thousand years.

11 I decked thee also with ornaments, and I put bracelets upon thy hands and a chain on thy neck.

12 And I put a jewel on thy forehead, and earrings in thine ears, and a beautiful crown upon thine head.

13 Thus wast thou decked with gold and silver, and thy raiment was of fine linen and silk and embroidered work. Thou didst eat fine flour and honey and oil; and thou wast exceeding beautiful, and thou didst prosper into a kingdom. — and thou wast exceeding beautiful, and thou didst prosper into a kingdom;

— the Targum says,”and ye became rich, and were greatly strengthened, and prospered, and ruled over all kingdoms.”

14 And thy renown went forth among the nations for thy beauty; for it was perfect through My comeliness, which I had put upon thee, saith the Lord God.

15 “‘But thou didst trust in thine own beauty, and played the harlot because of thy renown, and poured out thy fornications on every one that passed by: his it was. But thou didst trust in thine own beauty…. As the early American pilgrims did upon the new land bestowed on them; in their outward prosperity and grandeur; in their riches, wealth, and wisdom; and in the extent of their dominions, as manifest destiny dictates;

and in such men as America’s Founding Fathers; including George Washington, John Adams, Thomas Jefferson, James Madison, Alexander Hamilton, James Monroe and Benjamin Franklin; together with several other key players of their time, structured the democratic government of the United States and left a legacy that has shaped the world. are apt to put their trust and confidence, and to be elated with, and grow proud and haughty, as a woman because of her beauty.

7 Things You Didn't Know About Faith of the Founding Fathers
America’s Founding Fathers – George Washington, John Adams, Thomas Jefferson, James Madison, Alexander Hamilton, James Monroe and Benjamin Franklin

and playedst the harlot because of thy renown; now playing the the role of a harlot among the nations round about them, for their wisdom, riches, and power; which was a snare unto them, as a woman’s beauty is to her; and they were admired and courted, and complimented by their neighbours, and so drawn into idolatrous practices, as women into fornication and adultery by the admirers of them: idolatry, which is here meant, is frequently signified by playing the harlot, or by fornication and adultery: or “thou playedst the harlot in thy name” alluding to the custom of harlots, notorious infamous ones, who used to set their names over the apartments, to direct men unto them; and so it may denote how famous and notorious the Israelites were for their idolatries, and how impudent in them.

Rashi interprets this of the calf of the wilderness, and other idolatries which the tribe of Dan committed there; but it rather respects the idolatries committed from the times of Solomon to the captivity, which were many, and often repeated; and though sometimes a stop was put to them by pious princes, yet broke out again: so trusting in a man’s own righteousness, or in any outward thing, is idolatry; and also false worship and superstitious observances.

16 And of thy garments thou didst take, and decked thy high places with divers colors and played the harlot thereupon. The like things shall not come, neither shall it be so.

17 Thou hast also taken thy fair jewels of My gold and of My silver, which I had given thee, and madest for thyself images of men and didst commit whoredom with them,  a beautiful woman, now taking the image of a man, as described by John Gill:

Gill: and madest to thyself images of men; images in the shape of men; some were in the shape of women, others in the shape of men; here only male images are mentioned, because the idolatrous Israelites are represented by an adulterous woman committing adultery, with men; and these were made by themselves, of their jewels of gold and silver; or of their golden and silver vessels, which they had to eat and drink out of; these, they melted down and made idols of them in the form of men;

— just as the molten calf was made of the earrings of the women, Exodus 32:3; to which some refer this passage: and as it was a piece of egregious folly in themselves to part with their jewels and plate for such purposes, and of great ingratitude to God, their benefactor, so of the grossest stupidity and ignorance to worship images so made; which was equally as stupid, or more so, than if a woman should embrace the image of a man, instead of a man himself, as it follows.

— and didst commit whoredom with them: the images: that is, idolatry, which is spiritual adultery.

18 and tookest thy embroidered garments and covered them; and thou hast set Mine oil and Mine incense before them.

19 My meat also which I gave thee — fine flour and oil and honey, wherewith I fed thee — thou hast even set it before them for a sweet savor; and thus it was, saith the Lord God; much of these descriptions above are well intended for the early years of United States of America.

20 Moreover thou hast taken thy sons and thy daughters, whom thou hast borne unto Me, and these hast thou sacrificed unto them to be devoured. Is this thy whoredoms a small matter,

21 that thou hast slain My children and delivered them to cause them to pass through the fire for them?

22 And in all thine abominations and thy whoredoms thou hast not remembered the days of thy youth, when thou wast naked and bare and wast polluted in thy blood.

23 “‘And it came to pass after all thy wickedness (Woe, woe unto thee! saith the Lord God),

24 that thou hast also built unto thee a brothel house, and hast made thee a high place in every street.

25 Thou hast built thy high place at every head of the way, and hast made thy beauty to be abhorred, and hast opened thy feet to every one that passed by, and multiplied thy whoredoms.

26 Thou hast also committed fornication with the Egyptians thy neighbors, great of flesh, and hast increased thy whoredoms to provoke Me to anger.

27 Behold, therefore I have stretched out My hand over thee, and have diminished thine ordinary food, and delivered thee unto the will of them that hate thee, the daughters of the Philistines, who are ashamed of thy lewd way.

28 Thou hast played the whore also with the Assyrians, because thou wast unsatiable; yea, thou hast played the harlot with them and yet couldest not be satisfied.

29 Thou hast moreover multiplied thy fornication in the land of Canaan unto Chaldea, and yet thou wast not satisfied herewith.

30 “‘How weak is thine heart, saith the Lord God, seeing thou doest all these things, the work of an imperious whorish woman,

31 in that thou buildest thine eminent place at the head of every way and makest thine high place in every street, and hast not been as a harlot in that thou scornest hire,

32 but as a wife that committeth adultery, that taketh strangers instead of her husband! that taketh strangers instead of her husband; that takes other men into her bed instead of her husband, not for the sake of gain, but lust; and this was the case of modern Ephraim, who are a wicked people, an idolatrous generation; who took strange gods to worship instead of the true God, who had been a husband to them.

33 Gifts are given to all whores, but thou givest thy gifts to all thy lovers, and hirest them, that they may come unto thee on every side for thy whoredom. they give gifts to all whores…. gifts are usually given to whores, by those who commit whoredom with them; it is for the sake of these they prostitute their bodies, nor will they do this without gain.

34 And it is the contrary in thee from other women in thy whoredoms, whereas none followeth thee to commit whoredoms; and in that thou givest a reward and no reward is given unto thee, therefore thou art contrary.

35 “‘Therefore, O harlot, hear the word of the Lord!

36 Thus saith the Lord God: Because thy filthiness was poured out and thy nakedness uncovered through thy whoredoms with thy lovers, and with all the idols of thy abominations, and by the blood of thy children which thou didst give unto them,

37 behold, therefore I will gather all thy lovers with whom thou hast taken pleasure, and all them that thou hast loved, with all them that thou hast hated. I will even gather them round about against thee and will uncover thy nakedness unto them, that they may see all thy nakedness. — when the going gets tough, the tough gets going and American allies (Germany, Turkey, S Korea, the Philippines and Japan?) will take their own interests first, team up with other enemies of the United States (Iran, N Korea, Russia and China?) and will turn against America.

— nar, it is not these countries’ doings, but it is God’s will that will cause these allies to be against the United States, and it is again God’s will through His Spirits that will trap the United States in a snare (And I will spread My net upon him, and he shall be taken in My [not China’s nor Russia’s] snare, Ezekiel 17:20; and he will be like a pig caught in a cage squealing away to no avail) then uncover her nakedness, American nakedness.

— then and only then perhaps that the world will finally uncover all the experiments Professor Ralph Baric and other associates have ventured at Fort Detrick and the University of North Carolina at Chapel Hill. It is God Himself that will lay a net to trap the United States; He is the Overseeing GrandMaster; not China, not Russia, these are only pawns on a chessboard.

38 And I will judge thee, as women that break wedlock and shed blood are judged; and I will give thee blood in fury and jealousy. — and I will judge thee as women that break wedlock…. the marriage covenant, defile the marriage bed, and were adulteresses, who by the law of Moses were to be punished with death.

39 And I will also give thee into their hand, and they shall throw down thine eminent place and shall break down thy high places. They shall strip thee also of thy clothes and shall take thy fair jewels, and leave thee naked and bare. — they shall strip thee also of thy clothes – thy fairjewels — alluding to a lot common enough to prostitutes, their maintainers in the end stripping them of all they had given them. Lots of stolen arts “the vessels of thy glory” the vessels of the sanctuary of gold and silver of other countries, and their own household furniture, with all their riches (from the Opium War booties, etc) and substance from other countries will be laid naked and have to be returned.

40 They shall also bring up a company against thee, and they shall stone thee with stones and thrust thee through with their swords. and thrust thee through with their swords; such as attempted to escape out of the city, or fell into the hands of the enemy when it was taken, were slain with the sword.

41 And they shall burn thine houses with fire, and execute judgments upon thee in the sight of many women; and I will cause thee to cease from playing the harlot, and thou also shalt give no hire any more.

42 So will I make My fury toward thee to rest, and My jealousy shall depart from thee, and I will be quiet and will be no more angry. and I will be quiet, and will be no more angry: the effects of his anger cease, his judgments averted, and he at peace with them, and they with him.

43 Because thou hast not remembered the days of thy youth, but hast made Me fret in all these things, behold, therefore I also will recompense thy way upon thine head, saith the Lord God; and thou shalt not commit this lewdness above all thine abominations.

44 “‘Behold, every one that useth proverbs shall use this proverb against thee, saying, “As is the mother, so is her daughter.” — saying, as is the mother, so is her daughter; an ancient and common proverb, used to express a likeness and agreement between persons their nature and disposition, in their behaviour, conduct, and conversation.

— so the Targum says: “as are the works of the mother, so those of the daughter.”

45 Thou art thy mother’s daughter, who loatheth her husband and her children, and thou art the sister of thy sisters, who loathed their husbands and their children. Your mother was a Hittite and your father an Amorite. the Targum says, “was not your mother Sarah among the Hittites? and she did not do according to their works; and though your father Abraham was among the Amorites, yet he walked not in their counsels.”

46 And thine elder sister is Samaria, she and her daughters, who dwell at thy left hand; and thy younger sister, who dwelleth at thy right hand, is Sodom and her daughters. — Samaria, she and her daughters. The initial inhabitants maybe be Israelites, but they adopted idol worship starting with Jeroboam, worshipping of their calves at Dan and Bethel. The fanciful Samaritans came later, but they are SUN-worshippers.

— today more than 98.5 percent of Christians are honoring the SUN by observing SUNday. They have “their backs toward the temple of the Lord and their faces toward the east; and they worshiped the SUN toward the east,” Ezekiel 8:16. At even on the Fourteenth, onset to begin their passover, the Samaritans face the west as the SUN is setting. How awesome the sight is, exclaims Fred Coulter, for such a surreal ceremony to take place.

— others, following the SUN-worshipping Samaritans, the Church of God Communities are showing their contempt by having their “wavesheaf offering” and Pentecost on a SUNday. Always on SUNdays. And these are supposedly in God’s sanctuary, but God says He is a jealous God, so these pretentious Christians could be spewed out of His mouth! No? Regardless, there are those being described in Revelation 3:17 — wretched, miserable, poor, blind and naked. “As many as I love, I rebuke and chasten: or else I will spew thee out of My mouth (v16,19).”

— Sodom and her daughters; witness the proliferation of LGBTQIA (lesbian, gay, bisexual, transgender, queer (questioning), intersex, asexual (agender)). Thou “madest for thyself images of men,” Ezekiel 16:17). Women been changed into men, and men into women, all images of what they did in Sodom.

Woe unto them that call evil good, and good evil; that count darkness as light, and light as darkness; that put bitter for sweet, and sweet for bitter! Isaiah 5:20

47 Yet hast thou not walked after their ways, nor done according to their abominations, but, as if that were a very little thing, thou wast corrupted more than they in all thy ways.

48 As I live, saith the Lord God, Sodom thy sister hath not done, she nor her daughters, as thou hast done, thou and thy daughters. — as I live, saith the Lord God…. this is an oath, which the Lord God swore; who, because he could swear by no greater, he swore by himself, by his life; and this he did to confirm what he had and was about to say, that the sins of modern house of Israel were greater than those of Samaria and Sodom; which might not be easily believed, but it was as true as he was the living God.

49 Behold, this was the iniquity of thy sister Sodom: pride, fullness of bread, and abundance of idleness was in her and in her daughters, neither did she strengthen the hand of the poor and needy;

50 and they were haughty and committed abomination before Me. Therefore I took them away as I saw good.

51 Neither hath Samaria committed half of thy sins; but thou hast multiplied thine abominations more than they, and hast justified thy sisters in all thine abominations which thou hast done.

52 Thou also, who hast judged thy sisters, bear thine own shame for thy sins that thou hast committed more abominable than they: they are more righteous than thou. Yea, be thou confounded also and bear thy shame, in that thou hast justified thy sisters.

53 “‘When I shall bring back their captives, the captives of Sodom and her daughters and the captives of Samaria and her daughters, then will I bring back the captivity of thy captives in the midst of them,

54 that thou mayest bear thine own shame and mayest be confounded in all that thou hast done, in that thou art a comfort unto them.

55 When thy sisters, Sodom and her daughters, shall return to their former estate and Samaria and her daughters shall return to their former estate, then thou and thy daughters shall return to your former estate.

56 For thy sister Sodom was not mentioned by thy mouth in the day of thy pride,

57 before thy wickedness was uncovered, as at the time of thy reproach of the daughters of Syria and all who are round about her, the daughters of the Philistines, who despise thee round about.

58 Thou hast borne thy lewdness and thine abominations, saith the Lord.

59 “‘For thus saith the Lord God: I will even deal with thee as thou hast done, who hast despised the oath in breaking the covenant.

60 Nevertheless I will remember My covenant with thee in the days of thy youth, and I will establish unto thee an everlasting covenant.

61 Then thou shalt remember thy ways and be ashamed when thou shalt receive thy sisters, thine elder and thy younger; and I will give them unto thee for daughters, but not by thy covenant. then thou shalt remember thy ways, and be ashamed…. when the new spirit of truth is manifested and applied, it brings persons to a sense of their sins, and to an ingenuous acknowledgment of them, with shame and blushing; they remember their evil ways in which they have walked, and blush at the thoughts of what they have been guilty of; and how they have sinned against a God of love, grace, and mercy; and what vile ungrateful creatures they have been.

62 And I will establish My covenant with thee; and thou shalt know that I am the Lord,

63 that thou mayest remember and be confounded and never open thy mouth any more because of thy shame, when I am pacified toward thee for all that thou hast done, saith the Lord God.’”

In conjunction with this chapter, a great youtube to watch here (Brian Berletic vs Daniel Dumbrill)

“I HAVE SEEN A HORRIBLE THING IN THE HOUSE OF ISRAEL” HOSEA 6:10

Ezekiel (Ch 13-14)

•September 11, 2021 • Leave a Comment

We have established that this prophecy that Ezekiel delivered was not to be fulfilled during his time, but that there were many years to come; its timing was a great distance into the future (Ezekiel 12:27), into our time and the message is primarily and principally for the United States of America, and secondarily its European allies.

Ezekiel 13

1 And the word of the Lord came unto me, saying,

“Son of man, prophesy against the prophets of Israel who prophesy, and say thou unto them that prophesy out of their own hearts: ‘Hear ye the word of the Lord! — Son of man, prophesy against the prophets of Israel…. who called themselves so, and were accounted such by others; though they were not true, but the Targum calls them false prophets;

— that prophesy; that is, smooth things to the people; promising a speedy return from the captivity; or that Jerusalem should not be taken by the Chaldeans, and the inhabitants of it, and of the land, be carried captive.

Thus saith the Lord God: Woe unto the foolish prophets, who follow their own spirit and have seen nothing! — false prophecies came into their own spirits and was agreeable to their fancies and carnal imaginations, pretending to the spirit of prophecy.

The prophet that hath a dream, let him tell a dream; and he that hath My word, let him speak My word faithfully. What is the chaff to the wheat?” saith the Lord. Jeremiah 23:28

— any dream is the chaff – it is of no value; it is as wood, hay, and stubble. Only God’s Word is the wheat – in parallel with gold, silver, and precious stones.

O Israel, thy prophets are like the foxes in the deserts. these false prophets, as the Targum says; they are comparable to foxes, for their craftiness and cunning, and lying in wait to deceive, as these seduced the Lord’s people.

Ye have not gone up into the gaps [or breaches], neither made up the hedge [or a “fence”, a fortification] for the house of Israel to stand in the battle on the day of the Lord. — ye have not gone up into the gaps [or breaches as the Targum says]. The allusion is to breaches made in the walls of a city when besieged; at which time those within gather together in great numbers to meet the enemy, and prevent his entrance by the breaches.

— these words are either spoken to the princes of Israel, the civil magistrates; or to the prophets, who seeing the sins of the people, like a mighty torrent, opening a breach for the wrath and judgments of God to pour in upon them, should have put up their prayers, and made intercession to God for them; neither of which they did, and therefore are blamed here.

They have seen vanity and lying divination, saying, “The Lord saith,” but the Lord hath not sent them; and they have made others to hope that they would confirm the word. they have seen vanity, and lying divination…. the visions the false prophets pretended to see were nothing but the fruit of their own fancies and imaginations, and had nothing real in them; and what they divined or foretold should be were all lies, and never came to pass, and never would.

Have ye not seen a vain vision and have ye not spoken a lying divination, wherein ye say, “The Lord saith it,” albeit I have not spoken?

“‘Therefore thus saith the Lord God: Because ye have spoken vanity and seen lies, therefore, behold, I am against you, saith the Lord God.

And Mine hand shall be upon the prophets who see vanity and who divine lies; they shall not be in the assembly of My people, neither shall they be written in the writing of the house of Israel, neither shall they enter into the land of Israel; and ye shall know that I am the Lord God. Gill: they shall not be in the assembly of my people, shall have no place in the church of God, nor fellowship with the saints; they shall not join with them in religious worship here;

but either shall be left by the righteous judgment of God to separate themselves from them, or shall be excluded their communion; and much less shall they stand in the congregation of the righteous hereafter: or, “they shall not be in the secret”, or “council of my people.”

The secret of the Lord is with them that fear Him, and He will show them His covenant. Psalm 25:14

10 “‘Because, even because they have seduced My people, saying, “Peace,” and there was no peace, and one built up a wall, and lo, others daubed it with untempered mortar,

11 say unto those who daub it with untempered mortar that it shall fall. There shall be an overflowing shower, and ye, O great hailstones, shall fall, and a stormy wind shall rend it. — this is another way of saying building a house upon the sands, loose sands.

—the vast majority which would be no less than 99.99 percent of today’s professing Christianity make this fundamental error. This porous foundation differs greatly from the original Nazarenes where they understood what the Oracles as given to the Jews (Romans 3:1-4) would mean. Unless trained in Judaism, they wouldn’t be able to read the Sacred Text, which only had consonants written. This means our modern version of Christianity is primarily built on sands, loose sands. More here.

12 Lo, when the wall has fallen, shall it not be said unto you, “Where is the daubing wherewith ye have daubed it?”

13 Therefore thus saith the Lord God: I will even rend it with a stormy wind in My fury; and there shall be an overflowing shower in Mine anger and great hailstones in My fury to consume it.

14 So will I break down the wall that ye have daubed with untempered mortar and bring it down to the ground, so that the foundation thereof shall be uncovered, and it shall fall and ye shall be consumed in the midst thereof; and ye shall know that I am the Lord. — so says the Targum, “and I will destroy the city in which ye have prophesied false prophecies; and I will cause it to fall to the ground, and its foundations shall be discovered.” Much is repeated and expressed in similar words, both for the sake of confirmation and explanation of what is before said.

15 Thus will I accomplish My wrath upon the wall and upon them that have daubed it with untempered mortar, and will say unto you: “The wall is no more, neither they that daubed it,

16 to wit, the prophets of Israel who prophesy concerning Jerusalem, and who see visions of peace for her and there is no peace, saith the Lord God.”’

One already passed, more along the way . . .

17 “Likewise, thou son of man, set thy face against the daughters of thy people who prophesy out of their own heart; and prophesy thou against them

18 and say, ‘Thus saith the Lord God: Woe to the women who sew pillows to all armholes and make kerchiefs upon the head of those of every stature to hunt souls! Will ye hunt the souls of My people, and will ye save the souls alive who come unto you?

19 And will ye pollute Me among My people for handfuls of barley and for pieces of bread, to slay the souls who should not die and to save the souls alive that should not live, by your lying to My people who hear your lies? and will ye pollute me among my people…. defile the name of the Lord, by abusing it, to cover their wicked designs and practices, pretending they were seat by him, when they were not; that what they said came from him, though he spoke not by them; and that it was his will they declared, when it was their own, and what came out of their own hearts and heads:

— so the Targum says, “will ye pollute my will among my people”; to profane his name among the Gentiles was a great sin, but to pollute it among his own people was greater; attempting to draw them aside from his fear and worship, and that for gain, for small gain too.

20 “‘Therefore thus saith the Lord God: Behold, I am against your pillows, wherewith ye there hunt the souls to make them fly; and I will tear them from your arms and will let the souls go, even the souls whom ye hunt to make them fly.

21 Your kerchiefs also will I tear and deliver My people out of your hand, and they shall be no more in your hand to be hunted; and ye shall know that I am the Lord.

22 Because with lies ye have made the heart of the righteous sad, whom I have not made sad, and strengthened the hands of the wicked, that he should not return from his wicked way by promising him life, — Ephraim is a chronic liar; compulsive lying constantly and continuously; chief of whom is Mike Pompeo freely admitting lying within the CIA : We lied, We cheated, We stole

A parallel scripture is:

Ephraim compasseth me about with lies, and the house of Israel with deceit; but Judah yet ruleth with God, and is faithful with the saints. Hosea 11:12

23 therefore ye shall see no more vanity nor divine divinations; for I will deliver My people out of your hand, and ye shall know that I am the Lord.’”

Ezekiel 14

This chapter emphasizes Israel, house of Israel rather than Judah or house of Judah. Earlier we have established that Ezekiel’s messages were actually meant for those living far into the future, in our time, to the modern house of Israel, the chief of whom is Ephraim, the United States of America. So this prophecy continues . . .

1 Then came certain of the elders of Israel unto me and sat before me. — the elders of Israel unto me…. if these were the elders of Israel, than they should be the “elders of Judah”; hence paradoxically, these are elders of Israel, indicating this scene is prophetic in significance, for the endtime, for those of the house of Israel.

And the word of the Lord came unto me, saying,

“Son of man, these men have set up their idols in their heart and put the stumbling block of their iniquity before their face. Should I be inquired of at all by them?

Therefore speak unto them and say unto them, ‘Thus saith the Lord God: Every man of the house of Israel that setteth up his idols in his heart and putteth the stumbling block of his iniquity before his face, and cometh to the prophet, I the Lord will answer him that cometh according to the multitude of his idols,

that I may take the house of Israel in their own heart, because they are all estranged from Me through their idols.’ — the house of Israel; to have a form and shell of godliness, but to deny its substance, is the essence of hypocrisy.

“Therefore say unto the house of Israel, ‘Thus saith the Lord God: Repent, and turn yourselves from your idols, and turn away your faces from all your abominations. — numerous reference that the warnings are to the house of Israel, here, and closeby verses.

For every one of the house of Israel, or of the stranger that sojourneth in Israel, who separateth himself from Me and setteth up his idols in his heart, and putteth the stumbling block of his iniquity before his face, and cometh to a prophet to inquire of him concerning Me, I the Lord will answer him by Myself. — such men, be he an Israelite or a Gentile, come to a prophet to inquire of God, but it seems too late . . .

And I will set My face against that man and will make him a sign and a proverb, and I will cut him off from the midst of My people; and ye shall know that I am the Lord. and I will set my face against that man…. and look him out of countenance, notwithstanding all his daring impudence and presumption in coming to a prophet of the Lord, and inquiring of him by him, yet guilty of gross idolatry;

the Targum renders it, “my fury”, or “wrath”; and indeed that is what is meant; when God sets his face against a man, he pours out his wrath, or inflicts punishment on him;

— even if he’s set his mind “to inquire of him (Ezekiel) concerning Me,” (verse 7 above); there is a time that’s too late.

And if the prophet be deceived when he hath spoken a thing, I the Lord have deceived [enticed] that prophet, and I will stretch out My hand upon him and will destroy him from the midst of My people Israel. — Rashi: have enticed: I opened a doorway for him to do whatever he wishes. And from here we can learn that if one wishes to defile himself, they open a door for him.

10 And they shall bear the punishment of their iniquity. The punishment of the prophet shall be even as the punishment of him that seeketh unto him, — the punishment of the prophet shall be even as the punishment of him that seekest unto him; they being both alike culpable, each pursuing the desires of their own evil hearts; the one seeking for smooth things to be spoken to him; the other speaking them, in order to gratify him.

11 that the house of Israel may go no more astray from Me, neither be polluted any more with all their transgressions, but that they may be My people and I may be their God, saith the Lord God.’” — conversion during captivity, not before.

12 The word of the Lord came again to me, saying,

13 “Son of man, when the land sinneth against Me by trespassing grievously, then will I stretch out Mine hand upon it, and will break the staff of the bread thereof, and will send famine upon it, and will cut off man and beast from it.

14 Though these three men, Noah, Daniel, and Job were in it, they should deliver but their own souls by their righteousness, saith the Lord God. — though Noah, Daniel, and Job; the intercession even of the holiest of men shall not avert God’s judgments. 

15 If I cause noisome beasts to pass through the land, and they spoil it so that it be desolate, that no man may pass through because of the beasts,

16 though these three men were in it, as I live, saith the Lord God, they shall deliver neither sons nor daughters. They only shall be delivered, but the land shall be desolate. they shall deliver neither sons nor daughters; meaning not adult children, but only little ones, infant sons and daughters; such as had not been guilty.

17 Or if I bring a sword upon that land and say, ‘Sword, go through the land,’ so that I cut off man and beast from it,

18 though these three men were in it, as I live, saith the Lord God, they shall deliver neither sons nor daughters, but they only shall be delivered themselves.

19 Or if I send a pestilence into that land and pour out My fury upon it in blood to cut off from it man and beast, and pour out my fury upon it in blood; or, “by blood”; by corrupting the blood, which is done when a man is seized with the pestilence;

— the Targum renders it, “with slaughter”; by slaying a great number of persons by that disease, as a token of fury and wrath, because of their transgressions. It may be rendered, “because of blood”; and so express the cause and reason of the judgment, the shedding of innocent blood.

20 though Noah, Daniel, and Job were in it, as I live, saith the Lord God, they shall deliver neither son nor daughter. They shall but deliver their own souls by their righteousness.

21 “For thus saith the Lord God: How much more when I send My four sore judgments upon Jerusalem — the sword and the famine and the noisome beast and the pestilence — to cut off from it man and beast? — my four sore judgments — SWORD, war. FAMINE, occasioned by drought. PESTILENCE, epidemic diseases which sweep off a great part of the inhabitants of a land. The NOISOME BEAST, the multiplication of wild beasts in consequence of the general destruction of the inhabitants.

22 Yet, behold, therein shall be left a remnant that shall be brought forth, both sons and daughters. Behold, they shall come forth unto you, and ye shall see their way and their doings; and ye shall be comforted concerning the evil that I have brought upon Jerusalem, even concerning all that I have brought upon it.

23 And they shall comfort you, when ye see their ways and their doings; and ye shall know that I have not done without cause all that I have done in it, saith the Lord God.” — and ye shall know that I have not done without cause all that I have done in it, saith the Lord God; that there was just reason for it; that he was sufficiently provoked to do it; and that it was necessary it should be done, for his own honour, and the good of others.

Ezekiel (Ch 11-12)

•September 10, 2021 • Leave a Comment

As Ezekiel continues his visions of God in Jerusalem, his prophecy is for the children of Israel at the endtime.

Ezekiel 11

1 Moreover the Spirit lifted me up and brought me unto the east gate of the Lord’S house, which looketh eastward; and behold, at the door of the gate five and twenty men, among whom I saw Jaazaniah the son of Azzur, and Pelatiah the son of Benaiah, princes of the people. — and behold at the door of the gate five and twenty men as Rashi thought they were the same as in Ezekiel 8:16 “their backs to the Temple of the Lord” and “their faces toward the east; and they worshiped the sun;”

— now they’re between the porch and the altar; and more details about them, performing services and worshipping there; including the priests at the door of the eastern gate, sitting as a court of judicature, and were civil magistrates;

some say Jerusalem was divided into twenty four parishes, districts, or wards, and everyone had its own head, ruler, and governor; and that there was one who was the president over them all, like the mayor and its rich and influential: “princes”of a city; today we have the likes of Bill Gates, George Soros, Mark Zuckerberg and Rupert Murdoch.

— Gill: princes of the people; men who were entrusted with power and authority to exercise the laws of the nation; and who should have been reformers of the people, and ought to have given them good advice, and set them good examples; whereas they were the reverse.

Then said He unto me: “Son of man, these are the men who devise mischief and give wicked counsel in this city,

— Gill: these are the men that devise mischief, who formed schemes for the holding out of the siege, and for the security of the city, and of themselves in it, which was all folly and vanity:

— and give wicked counsel in this city; either in ecclesiastical affairs, to forsake the worship of God, and cleave to the idols of the nations; or in civil things.

who say, ‘It is not near; let us build houses: this city is the cauldron, and we are the flesh.’ — it is not near — that is, the threatened invasion; this mean the Chiefs of the city are advising the people to ignore Ezekiel’s warnings. These infidels are laughing and even mocking at Ezekiel, saying: “We will run all risks, we will abide in the city. Though it be the cauldron, and we the flesh, yet we will share its fate: if it perish, we will perish with it.” 

— ‘It is not near; or it’s as in Ezekiel 12:27, “of the times that are far off,” where their elders dismissed that Ezekiel’s vision were meant for many years yet to come: “of the times that are far off.”

Therefore prophesy against them, prophesy, O son of man.”

And the Spirit of the Lord fell upon me, and said unto me, “Speak! Thus saith the Lord: Thus have ye said, O house of Israel; for I know the things that come into your mind, every one of them.

Ye have multiplied your slain in this city, and ye have filled the streets thereof with the slain. — “multiplied your slain“ capital crimes increasing, blood upon blood, murder upon murder, shedding of innocent blood, gun violence everywhere in the United States today.

Therefore thus saith the Lord God: Your slain whom ye have laid in the midst of it, they are the flesh, and this city is the cauldron; but I will bring you forth out of the midst of it. — but I will bring you forth out of the midst of it: where they promised themselves safety; ye shall not be permitted to do so, but God will ensure they shall be carried away as captives.

Ye have feared the sword; and I will bring a sword upon you, saith the Lord God. — “ye have multiplied your slain in this city, and ye have filled the streets thereof with the slain;” these crimes, to God, are serious stuff! Hence numerous repeats of a returning “sword” and reminders; repeats “I will bring a sword” and reminders. “Whatever crimes you inflict on others, these will be inflicted back on you.”

And I will bring you out of the midst thereof, and deliver you into the hands of strangers and will execute judgments among you. — indeed the Sword appeared in 70 AD; this time by the hands of the Romans, but it was actually God executing His judgement on:

(a) the Essenses (who had their own calendar); and;

— (b) the Sadducees (who observed a Passover and Pentecost similar to the Samaritan’s) where both defiled the tenets from the Sanhedrin and were wiped out by the Sword!

10 Ye shall fall by the sword; I will judge you in the border of Israel; and ye shall know that I am the Lord.

11 This city shall not be your cauldron, neither shall ye be the flesh in the midst thereof; but I will judge you in the border of Israel.

12 And ye shall know that I am the Lord; for ye have not walked in My statutes, neither executed My judgments, but have done according to the manner of the nations who are round about you.”

13 And it came to pass when I prophesied, that Pelatiah the son of Benaiah died. Then fell I down upon my face, and cried with a loud voice and said, “Ah, Lord God! Wilt Thou make a full end of the remnant of Israel?” — conditions would be so bad that those few who survive would ask, “Would God make a full end to the remnant of Israel?”

The answer is “no.” Nebuchadnezzar left a few Jews back in their land, but they had a pay taxes and tributes to their new Babylonian masters.

II King 25 (Assassination of Gedaliah in 423 BCE: one of the four fast; 3 Tishrei)

22 And as for the people who remained in the land of Judah, whom Nebuchadnezzar king of Babylon had left, even over them he made Gedaliah the son of Ahikam, the son of Shaphan, ruler.

23 And when all the captains of the armies, they and their men, heard that the king of Babylon had made Gedaliah governor, there came to Gedaliah at Mizpah even Ishmael the son of Nethaniah, and Johanan the son of Careah, and Seraiah the son of Tanhumeth the Netophathite, and Jaazaniah the son of a Maachathite, they and their men.

24 And Gedaliah swore to them and to their men, and said unto them, “Fear not to be the servants of the Chaldeans. Dwell in the land and serve the king of Babylon, and it shall be well with you.”

25 But it came to pass in the seventh month that Ishmael the son of Nethaniah, the son of Elishama, of the seed royal, came and ten men with him, and smote Gedaliah so that he died, and the Jews and the Chaldeans who were with him at Mizpah.

26 And all the people, both small and great, and the captains of the armies, arose and came to Egypt; for they were afraid of the Chaldeans.

14 Again the word of the Lord came unto me, saying,

15 “Son of man, thy brethren, even thy brethren, the men of thy kindred, and all the house of Israel wholly, are they unto whom the inhabitants of Jerusalem have said, ‘Get you far from the Lord; unto us is this land given as a possession.’ — all the house of Israel wholly . . . ‘unto us is this land given as a possession.’ Does this mean that the “whole house of Israel” are coming back to claim the land of Israel that were originally given? If so it would include the whole of West Bank, more on Golan Heights and a large chunk of Jordan onward to the land of Iraq.

Perhaps this organization, BNEY YOSEF NORTH AMERICA https://bneyyosefna.com would take a lead.

16 Therefore say, ‘Thus saith the Lord God: Although I have cast them far off among the nations, and although I have scattered them among the countries, yet will I be to them as a little sanctuary in the countries where they shall come.’ — it may be rendered, “the sanctuary of a few”; especially that were truly God-fearing. The Targum says, “I have given them synagogues, second to my sanctuary, and they are as few in the provinces where they are carried captive.”

17 Therefore say, ‘Thus saith the Lord God: I will even gather you from the people and assemble you out of the countries where ye have been scattered, and I will give you the land of Israel.’

18 And they shall come thither, and they shall take away all the detestable things thereof and all the abominations thereof from thence. there would be a lot of cleaning to do, their idols and all things detestable since the birth of their nations. All these abominations should be wholly rooted out; historically this had its accomplishment under Zerubbabel, Ezra, Haggai, and so there should be another revival.

— but who, if any, would clean the detestable filths and abominations of the latter-day house of Israel?

<<< there seems a great gap in time in between from their detestable filthy and abominable stage above to one where the house of Israel would be ready to accept God’s new spirits, statues and judgments below; from Ezekiel 2 to Ezekiel 37 >>>

19 And I will give them one heart, and I will put a new spirit within you; and I will take the stony heart out of their flesh, and will give them a heart of flesh,

20 that they may walk in My statutes and keep Mine ordinances, and do them. And they shall be My people, and I will be their God.

21 But as for them whose heart walketh after the heart of their detestable things and their abominations, I will recompense their way upon their own heads, saith the Lord God.”

22 Then the cherubims lifted up their wings, and the wheels beside them, and the glory of the God of Israel was over them.

23 And the glory of the Lord went up from the midst of the city and stood upon the mountain which is on the east side of the city. — the glory of the Lord went up from the midst of the city — this vision demonstrates that God did not abandon this people all at once; he departed by little and little.

24 Afterwards the Spirit took me up, and brought me in a vision by the Spirit of God into Chaldea to those of the captivity. So the vision that I had seen went up from me. — from Jerusalem, Ezekiel was brought back to the land of the Chaldea, back with fellow captives by the River Chebar. But all this was done in vision; under the influence of the Spirit of God, as if he was carried to Jerusalem, and there saw and heard all he did, and then was brought back again to Chaldea.

25 Then I spoke unto those of the captivity all the things that the Lord had shown me.

~~~

This vision of Shekinah departing (verse 23 above) demonstrates that God did not abandon this people all at once; he departed by little and little. First, he left the temple. Second, he stopped a little at the gate of the city. Third, he departed entirely from the city and went to the Mount of Olives, which lay on the east side of the city. Having tarried there for some time to see if they would repent and turn to him.

Fourth, he departed earth to heaven. The vision being now concluded, Ezekiel is taken away by the Spirit back to Chaldea, and there announces to fellow captive Israelites what God had showed him in the preceding visions, and the good that he had spoken concerning them; but they did not seem to agree with him, which the prophet reprimands severely.

Ezekiel 12

Ezekiel 12 explains why a few are going to be left to survive, that they may declare all their abominations among the nations. And that the vision that Ezekiel seeth is for many days to come, “and he prophesieth of the times that are far off.”

1 The word of the Lord also came unto me, saying,

“Son of man, thou dwellest in the midst of a rebellious house, who have eyes to see and see not; they have ears to hear and hear not, for they are a rebellious house. — this is true even for those dwelling in the Sanctuary, in the house of God; they have ears but couldn’t hear, eyes to see but couldn’t see; they don’t even know what the Oracles of God are; not to say about a willingness and the spirits to keep them.

Therefore, thou son of man, prepare thee supplies for departure, and remove by day in their sight; and thou shalt remove from thy place to another place in their sight. It may be they will consider, though they are a rebellious house.

Then shalt thou bring forth thy goods by day in their sight, as supplies for removing; and thou shalt go forth at evening in their sight, as they that go forth into captivity.

Dig thou through the wall in their sight, and carry out through it.

In their sight shalt thou bear it upon thy shoulders and carry it forth in the dark [עֲלָטָה H5939 thick darkness]. Thou shalt cover thy face, that thou see not the ground; for I have set thee for a sign unto the house of Israel.”

And I did so as I was commanded: I brought forth my goods by day, as supplies for captivity, and in the evening I dug through the wall with mine hand. I brought them forth in the dark [darkness], and I bore them upon my shoulder in their sight.

And in the morning came the word of the Lord unto me, saying,

“Son of man, hath not the house of Israel, the rebellious house, said unto thee, ‘What doest thou?’

10 Say thou unto them, ‘Thus saith the Lord God: This burden concerneth the prince in Jerusalem and all the house of Israel that are among them.’

11 Say, ‘I am your sign: as I have done, so shall it be done unto them. They shall remove and go into captivity.’ — this captivity of the house of Israel would most probably last 190 years and for the house of Judah 40 years (see study on Ezekiel chapter 4).

12 And the prince who is among them shall bear upon his shoulder in the dark [darkness], and shall go forth; they shall dig through the wall to carry out through it. He shall cover his face, that he see not the ground with his eyes.

13 My net also will I spread upon him, and he shall be taken in My snare; and I will bring him to Babylon to the land of the Chaldeans; yet shall he not see it, though he shall die there.

14 And I will scatter toward every wind all who are about him to help him, and all his troops; and I will draw out the sword after them.

15 And they shall know that I am the Lord, when I shall scatter them among the nations and disperse them in the countries.

16 But I will leave a few men of them from the sword, from the famine and from the pestilence, that they may declare all their abominations among the nations whither they come; and they shall know that I am the Lord.” — “that they may declare all their abominations among the nations;” this explains why a few are left to survive;

if they have hidden in some secret hideouts, they won’t be able to “declare all their abominations among the nations” whither they come; who, observing their calamities, and distresses, could deserve and a need to know, and hear those who are well-versed to explain their sins, abominations and judgement to the nations.

17 Moreover the word of the Lord came to me, saying,

18 “Son of man, eat thy bread with quaking, and drink thy water with trembling and with sorrow;

— those remnants who survive would explain to the nations that they have been guilty of great enormities, so that their punishment was a visible and standing declaration and warning to the nations of the abominable sins they, of the house of Israel, had been guilty of; and not to repeat them in their own nations.

19 and say unto the people of the land, ‘Thus saith the Lord God of the inhabitants of Jerusalem and of the land of Israel: They shall eat their bread with sorrow, and drink their water with dismay, that her land may be desolate of all that is therein, because of the violence of all them that dwell therein. — her land will be desolated: men, cities, towns, houses, vineyards, fields, fruits, and cattle are all in ruin. Those who could see, only sorrow and dismay.

20 And the cities that are inhabited shall be laid waste, and the land shall be desolate; and ye shall know that I am the Lord.’”

21 And the word of the Lord came unto me, saying,

22 “Son of man, what is that proverb that ye have in the land of Israel, saying, ‘The days are prolonged, and every vision faileth’? — this is another way for the hardhearted (also stiffnecked) in the “land of Israel” to dismiss Ezekiel’s warning, “every visions faileth”!

23 Tell them therefore, ‘Thus saith the Lord God: I will make this proverb to cease, and they shall no more use it as a proverb in Israel.’ But say unto them, ‘The days are at hand, and the effect of every vision.

24 For there shall be no more any vain vision nor flattering divination within the house of Israel.

25 For I am the Lord: I will speak, and the word that I shall speak shall come to pass; it shall be no more put off. For in your days, O rebellious house, will I say the word and will perform it, saith the Lord God.’”

26 Again the word of the Lord came to me, saying,

27 “Son of man, behold, they of the house of Israel say, ‘The vision that he seeth is for many days to come, and he prophesieth of the times that are far off.’ — see, this warning vision that Ezekiel saw concerning Israel’s ruin and the prophecy which he delivered, the house of Israel say, were not for their time to be fulfilled; dismissing that that they were only meant for many years yet to come: “of the times that are far off.”

28 Therefore say unto them, ‘Thus saith the Lord God: There shall none of My words be put off any more, but the word which I have spoken shall be done, saith the Lord God.’” but the word which I have spoken shall be done, saith the Lord God: one jot and tittle of it shall not pass away till all be fulfilled; sooner may heaven and earth pass away than that shall; it is for ever settled in heaven, and shall be fulfilled on earth; he that has said it is of one mind, and none can turn him; and is able to do whatsoever he pleases.

~~~

Please allow me to elaborate (on verse 27 above): God must had told Ezekiel that the visions were for a time far into the future, and Ezekiel, in turn, repeated God’s message to the house of Israel, which seems unrecorded. Being hardhearted, the house of Israel, or their elders, turned around, brushing off those warnings by saying the visions were only meant for those living in the far future, which is recorded as in verse 27; hence they could continue to practice their abominable things which they were doing.

But more calamities were to fall for the house of Judah a few years later when Nebuchadnezzar took more captives; and a few hundred years later, in 70 AD and 132 AD, this time by the Romans; hence God’s warning messages were meant for the house of Judah since those days; timeless, and another meant “of the times that are far off.” That is, it was a warning meant for the endtime, our time, and this prophecy is primarily and principally for the United States of America and secondarily its European allies.

Ezekiel (Ch 9-10)

•September 8, 2021 • 2 Comments

As Ezekiel continues his visions of God in Jerusalem, his prophecy is for the children of Israel at the endtime.

In chapter 9 it has the core subject about killing those who preside over God’s Sanctuary, and in the endtime, the saints. Yet these saints are to be slain: “Slay utterly old and young . . . and begin at my Sanctuary,” Ezekiel 9:6.

But a small remnants are spared; why spared these and not the others?

Ezekiel: Prophecy as Performance Art | My Jewish Learning
Ezekiel’s Vision of God for the Endtime rebellious House of Israel

Ezekiel 9

1 He cried also in mine ears with a loud voice, saying, “Cause them that have charge over the city to draw near, even every man with his destroying weapon in his hand.” — he cried also in mine ears with a loud voice…. that is, the Shekinah, whom the prophet saw in the temple, and who directed him from place to place, now wanted to show him all the abominations committed there;

— saying, cause them that have the charge over the city to draw near; or, “those appointed over the city,” as the Targum says; that is, the city of Jerusalem; by whom are meant the ministering angels, who had been the guardians of it, but now were to be employed another way;

— even every man with his destroying weapon in his hand; weapons of war, as bows and arrows, sword and spear.

And behold, six men came from the way of the higher gate, which lieth toward the north, and every man a slaughter weapon in his hand; and one man among them was clothed with linen, with a writer’s inkhorn by his side. And they went in and stood beside the brazen altar. — in the good old days, these “six men” or six destroyers could be the generals of Nebuchadnezzar Jeremiah 39:3; but in modern times, they could be Chechens, Syrians, Iraqis, Palestinians, Libyans and Afghans.

— in the Talmud: “wrath, anger, fury, destruction, breach, and consumption.”

And the glory of the God of Israel had gone up from the cherub, whereupon he was, to the threshold of the house. And He called to the man clothed with linen, who had the writer’s inkhorn by his side; — and the glory of the God of Israel was gone up from the cherub, whereupon he was…. that is, the glorious God; or the Shekinah, removed from thence, as a token of his being about to depart from the temple, and with its protection removed, the temple was destroy in a short time.

— the Targum says, “the glory of the God of Israel departed in the cherub on which he dwelt, in the house of the holy of holies;” the cherubim removed with him, as were his chariot in which he rode.

2321.) Ezekiel 10 | DWELLING in the Word
Shekinah, the Glory of God left the Temple and Jerusalem was soon destroyed

and the Lord said unto him, “Go through the midst of the city, through the midst of Jerusalem, and set a mark upon the foreheads of the men who sigh and who cry because of all the abominations that are done in the midst thereof.” and you shall mark a sign: you shall mark a sign on the foreheads of the righteous men in order to show the destroyers those men whom they should not strike.

Gill: It is a Rabbinical thought, mentioned by Kimchi that Gabriel had orders to write the letter ת (tav; the last letter of the alphabet) in ink upon the foreheads of the righteous, which signified תחיה, “thou shall live”. And for the wicked the same letter ת were written in blood upon the foreheads, but it signified תמות, “thou shall die”.

the letter ת in the original paleo Hebrew looks like an x sign.

And to the others He said in mine hearing, “Go ye after him through the city and smite. Let not your eye spare, neither have ye pity.

Slay utterly old and young, both maids and little children and women; but come not near any man upon whom is the mark; and begin at My sanctuary.” Then they began with the elder men who were before the house. — Gill: and begin at my sanctuary; the temple, the house of God, and the priests and Levites that dwelt there;

the Septuagint version is, “begin at my saints”; those who professed themselves to be saints of the Lord, and were separated and devoted to his service; and so the Rabbins say, do not read ממקדשי, “at my sanctuary”; but ממקודשי, “at those that sanctify me”, or “my sanctified ones”; which they interpret of those that keep the whole law, from “aleph” to “tau”.

And He said unto them, “Defile the house, and fill the courts with the slain. Go ye forth.” And they went forth and slew in the city.

And it came to pass, while they were slaying them and I was left, that I fell upon my face and cried, and said, “Ah Lord God! Wilt Thou destroy all the residue of Israel in Thy pouring out of Thy fury upon Jerusalem?” — when Ezekiel was delivering his message both the house of Israel and Judah were already in captivity. He was among the captives at the river Chebar, so Ezekiel’s messages were actually meant for those living far into the future, in our time, to the modern house of Israel, the chief of whom is Ephraim, the United States of America — in thy pouring out of thy fury by famine, pestilence, and sword.

Then said He unto me, “The iniquity of the house of Israel and Judah is exceeding great, and the land is full of blood and the city full of perverseness; for they say, ‘The Lord hath forsaken the earth, and the Lord seeth not.’

A Nation Full of Blood Crimes!

10 And as for Me also, Mine eye shall not spare, neither will I have pity, but I will recompense their ways upon their heads.”

11 And behold, the man clothed with linen, who had the inkhorn by his side, reported the matter, saying, “I have done as Thou hast commanded me.”

~~~

More on Ezekiel 9:6 Slay utterly old and young . . . and begin at my sanctuary:

Today many pretentious Christians, especially among the CoG Communities, believe they will go into a place of safety? But this is just a fantasy. It’s far more likely that lightnings and thunderstorms would begin with these professing Christians.

Deuteronomy 16:18 “You shall appoint judges and officers in all your towns that the Lord your God is giving you, according to your tribes, and they shall judge the people with righteous judgment.

Deuteronomy 17:11 According to the sentence of the law which they shall teach thee, and according to the judgment which they shall tell thee, thou shalt do: thou shalt not decline from the sentence which they shall shew thee, to the right hand, nor to the left. 12 And the man who will do presumptuously, and will not hearken unto the priest who standeth to minister there before the Lord thy God, or unto the judge, even that man shall die.

Moses knew he would die soon and his understanding had been conveyed to the judges, the Levites and priests where the true interpretation of the law were taught. So in the book of Deuteronomy Moses spoke and explained unto all Israel “according unto all that the Lord had given him” as to how to keep them, the blessing they would have if they obey, or cursing if they disobey, in a language they could understand. Men may have good intentions, but may do things seen as presumptuously? What is presumptuous or presumptuously? 

Below are its synonyms: 

arrogant, bumptious, cavalier, chesty, haughty, high-and-mighty, high-handed, high-hat, huffish, huffy, imperious, important, lofty, lordly, masterful, overweening, peremptory, pompous, presuming, pretentious, self-asserting, self-assertive, sniffy, supercilious, superior, uppish, uppity

The Jews were prophesied they would mourn One whom they had rejected: “And they shall look to Me whom they have pierced; then they shall mourn for him, as one mourns for an only son” (Zechariah 12:10). But these Christians have nothing to mourn? Currently these endtime virgins are described as lukewarm and in need of nothing, but would they not mourn when they realise that they had been blind, wretched and naked, seeing finally that Christ had suffered far more through His torn flesh and shed blood than they had ever realised? No?

Today more than 98.5 percent of Christians are honoring the SUN by observing SUNday. They have “their backs toward the temple of the Lord and their faces toward the east; and they worshiped the SUN toward the east,” Ezekiel 8:16.

Others, following the SUN-worshipping Samaritans, the Church of God Communities are showing their contempt for God by having their “wavesheaf offering” and Pentecost on a SUNday. Always on SUNdays. And these are supposedly in God’s sanctuary, but God says He is a jealous God, so these pretentious Christians could be spewed out of His mouth! No? Regardless, there are those being described in Revelation 3:17 wretched, miserable, poor, blind and naked. “As many as I love, I rebuke and chasten: or else I will spew thee out of My mouth (v16,19).”

Despite the above, there’ll be a remnant that are spared: “Go through the midst of the city, through the midst of Jerusalem, and set a mark upon the foreheads of the men who sigh and who cry because of all the abominations that are done in the midst thereof,” Ezekiel 9:4. These remnants “who sigh and who cry” will be marked with a letter ת in ink on the forehead;

but the question is, do we qualify to be in this category?

Ezekiel 10

Chapter 10 is a vision, very much like that in the first chapter, with some difference, and with a different view, the design of it being to represent the wrath of God against Jerusalem, and his departure from the city and temple. A throne much like that in Ezekiel 1:26 is described.

1 Then I looked, and behold, in the firmament that was above the head of the cherubims there appeared over them, as it were, a sapphire stone with the appearance of the likeness of a throne.

And He spoke unto the man clothed with linen, and said, “Go in between the wheels, even under the cherub, and fill thine hand with coals of fire from between the cherubims, and scatter them over the city.” And he went in in my sight. — and He spake unto the man clothed with linen…. that is, the God of Israel gave orders to the man clothed in linen, who appears in another character, and represents the Chaldean or Roman army; these “coals of fire” were an emblem of the wrath of God against Jerusalem.

Now the cherubims stood on the right side of the house when the man went in; and the cloud filled the inner court. — now the cherubim stood on the right side of the house…. according to the Targum, it was the south side of the house; opposite the north; that’s where the gross idolatries were committed.

Then the glory of the Lord went up from the cherub and stood over the threshold of the house; and the house was filled with the cloud, and the court was full of the brightness of the Lord’S glory. this is a token and intimation of the Lord’s leaving of the temple; and a little before the destruction of Jerusalem by the Romans.

And the sound of the cherubims’ wings was heard even to the outer court, as the voice of the Almighty God when He speaketh. and the sound of the cherubim’s wings was heard even to the outer court…. or outward court. The sound of the Kingdom, and salvation by Christ; the sound of this in the swift ministry of the apostles, signified by the “cherubim’s wings”, went into all the earth, and throughout the whole Gentile world.

And it came to pass that when He had commanded the man clothed with linen, saying, “Take fire from between the wheels, from between the cherubims,” then he went in and stood beside the wheels.

And one cherub stretched forth his hand from between the cherubims unto the fire that was between the cherubims, and took thereof and put it into the hands of him that was clothed with linen, who took it and went out. who took it, and went out; took the fire, and went out of the temple, and scattered it upon the city of Jerusalem; so representing the Chaldean, or rather the Roman army, burning it with fire.

but Ezekiel is a prophetic book, so the most important Question remains for us to ponder during the endtime: who would burn down the house of Israel?

And there appeared in the cherubims the form of a man’s hand under their wings. — one of them put forth his hand, which was seen by the prophet, but this was only the “form” of one; which is not to be taken literally, but as seen in the vision of prophecy; and being under their wings denotes secrecy and privacy.

And when I looked, behold, the four wheels by the cherubims, one wheel by one cherub and another wheel by another cherub; and the appearance of the wheels was as the color of a beryl stone.

10 And as for their appearance, all four had one likeness, as if a wheel had been in the midst of a wheel.

11 When they went, they went upon their four sides. They turned not as they went, but to the place whither the head looked they followed it; they turned not as they went.

12 And their whole body, and their backs, and their hands, and their wings, and the wheels, were full of eyes round about — even the wheels that the four had.

13 As for the wheels, it was cried unto them in my hearing, “O wheel.”

14 And every one had four faces: the first face was the face of a cherub, and the second face was the face of a man, and the third the face of a lion, and the fourth the face of an eagle. — the first face was the face of a cherub; this in place of the ox’s face, indicating, perhaps, that the face of an ox and a cherub has the same significance.

But the Ox is also the symbol of the United States; the UK has the Unicorn (more below).

15 And the cherubims were lifted up. This is the living creature that I saw by the River of Chebar.

16 And when the cherubims went, the wheels went alongside them; and when the cherubims lifted up their wings to mount up from the earth, the same wheels also turned not from beside them.

17 When they stood, these stood, and when they were lifted up, these lifted up themselves also; for the spirit of the living creature was in them. when they stood, these stood…. when the one were inactive, lifeless, and without motion, making no progress in knowledge, experience, and practice, the other were so likewise.

18 Then the glory of the Lord departed from off the threshold of the house and stood over the cherubims. — the departure of the glory of God from the threshold to the east gate of the Lord’s house, with the motion of the cherubim and wheels along with him. 

19 And the cherubims lifted up their wings and mounted up from the earth in my sight. When they went out, the wheels also were beside them, and every one stood at the door of the east gate of the Lord’S house; and the glory of the God of Israel was over above them.

20 This is the living creature that I saw under the God of Israel by the River of Chebar; and I knew that they were the cherubims.

21 Every one had four faces apiece, and every one four wings, and the likeness of the hands of a man was under their wings. and everyone four wings: the Septuagint reads eight wings; and the Syriac version “six”; so many in all indeed they had.

22 And the likeness of their faces was the same as the faces which I saw by the River of Chebar, their appearances and themselves. They went every one straight forward. they went everyone straight forward; their motion as well as their form were alike; they kept one even course, looking right on, and their eyes right before them.

~~~

More on the Ox and the Unicorn:

His glory is like the firstling of his ox (bullock), and his horns are like the horns of unicorns. With them he shall push the people together to the ends of the earth; and they are the ten thousands of Ephraim, and they are the thousands of Manasseh,” Deuteronomy 33:17.

In the above verse, the Ox (verse 14 above) and Ephraim are named first, the firstborn of his (Joseph’s) “bullock is his glory”: the reference being to Ephraim; followed by Unicorn and Manasseh.

Although Manasseh was the firstborn, Joseph the father crossed his hands and placed Ephraim as firstborn, hence Ephraim, often known as the thirteenth tribe, represents not just the house of Joseph, but more often the house of the 10-tribes Northern Kingdom.

[U.S. Coat of Arms]
The Coat of Arms of the United States; thirteen Stars and thirteen Arrows – the thirteenth tribe
Royal Coat of Arms of the United Kingdom.svg
A Unicorn in the Royal Coat of Arms of the United Kingdom

In Rabbinic teachings: the myriads (ten thousands) slain by Joshua, of the tribe of Ephraim: These are the myriads descended from Ephraim;

and the thousands of Manasseh: these are the thousands slain by Gideon, who was of the tribe of Manasseh. These are the thousands descended from Manasseh.

In his blessings Jacob ascribes to Ephraim ten thousands, and to Manasseh only thousands; thus foreshowing, that Ephraim the younger was to be the more numerous of the two, as Jacob had before prophesied of them.

Ezekiel (Ch 7-8)

•September 7, 2021 • Leave a Comment

As Ezekiel continues his visions from God, his prophecy is for the children of Israel at the endtime.

Ezekiel 7

Moreover the word of the Lord came unto me, saying, — the Targum, whose origin in the Aramaic language could be traced to Ezra; expresses it as “The word of prophecy from the Lord.”

“Also, thou son of man, thus saith the Lord God unto the land of Israel: “An end! The end is come upon the four corners of the land. — the Targum says, “the punishment of the end, or the punishment determined to come upon the four winds of the earth;” this Targum version recognizes that the Israelites are all over the face of the earth, spread over the four winds!

in Ezekiel 6:3 the message was to the “mountains of Israel,”referring to the United States, UK and France. . . . “and to the hills, to the rivers and to the valleys;” — the hills: Ireland, Switzerland and the Scandinavian countries: Denmark, Norway, and Sweden, Finland, and Iceland; and the valleys, the low countries: Belgium, the Netherlands, and Luxembourg.

— to the rivers; where during the nineteenth century, the British Royal Navy were known to “Rule the Waves;” and the United States having been plowing up and down the five oceans with her Seven Fleets since the British left the scene;

and now “are all over the face of the earth, spread over the four winds” as the Targum says; which would include Australia, New Zealand, Canada (and perhaps South Africa?) and numerous small islands around the world.

and in this context, “the land of Israel” and “over the face of the earth” would most probably include the modern state of Israel in Palestine.

Now is the end come upon thee, and I will send Mine anger upon thee, and will judge thee according to thy ways, and will recompense upon thee all thine abominations.

And Mine eye shall not spare thee, neither will I have pity; but I will recompense thy ways upon thee, and thine abominations shall be in the midst of thee; and ye shall know that I am the Lord. the punishments would be so great that “ye shall know who the LORD is,” to whom vengeance belongs; who takes notice of all their sinful actions, and punishes for them.

“Thus saith the Lord God: An evil, an only evil, behold, is come! the Targum says, “evil after evil, lo, it cometh.”

An end is come, the end is come! It watcheth for thee; behold, it is come. the repeating is for emphasis as these words, so often repeated, show the eagerness and concern of the prophet’s mind; the speed and haste destruction was making, or is to come; and the great hardheartedness and stupidity of the people, which requires constant repetitions.

The morning is come unto thee, O thou that dwellest in the land; the time is come, the day of trouble is near, and not the sounding again of the mountains. — the Targum, “and there is no fleeing or escaping to the tops of the mountains.”

Now will I shortly pour out My fury upon thee, and accomplish Mine anger upon thee; and I will judge thee according to thy ways, and will recompense thee for all thine abominations.

And Mine eye shall not spare, neither will I have pity. I will recompense thee according to thy ways and thine abominations that are in the midst of thee; and ye shall know that I am the Lord that smiteth.

10 “Behold the day, behold, it is come! The morning is gone forth, the rod hath blossomed, pride hath budded. the Targum says, “a ruler hath budded, a wicked one hath appeared.”

11 Violence is risen up into a rod of wickedness; none of them shall remain, nor of their multitude, nor of any of theirs; neither shall there be wailing for them.

12 The time is come, the day draweth near. Let not the buyer rejoice nor the seller mourn, for wrath is upon all the multitude thereof. — upon the whole body of all modern Israelites, high and low, rich and poor, bond and free, buyer and seller; those that are in good circumstances, and those that are in bad ones; so that hereby they were all upon a level, in the same case and condition.

13 For the seller shall not return to that which is sold, although they were yet alive; for the vision is touching the whole multitude thereof, which shall not return; neither shall any strengthen himself in the iniquity of his life.

14 “They have blown the trumpet, even to make all ready; but none goeth to the battle, for My wrath is upon all the multitude thereof. they have blown the trumpet, as an alarm of war, and see what will be the effect of it, but they shall be dispirited, and none come forth for a fight; this parallels another verse: “The children of Ephraim, being armed and carrying bows, turned back in the day of battle” Psalm 78:9.

15 The sword is without, and the pestilence and the famine within. He that is in the field shall die with the sword, and he that is in the city, famine and pestilence shall devour him. — the sword is without; war is throughout the country and pestilence and famine within the city; it shall destroy the whole. He who endeavours to flee from the one shall fall by the other, except a small remnant.

16 But they that escape of them shall escape, and shall be on the mountains like doves of the valleys, all of them mourning, every one for his iniquity. — a few shall escape the pestilence, famine, and sword, and flee to the mountains, where they will live a very miserable and uncomfortable life; so that this is no contradiction to the wrath of God being upon the whole multitude.

17 All hands shall be feeble, and all knees shall be weak as water. — all hands shall be feeble…. no strength in them, like jelly, to lay hold on weapons of war to defend themselves, or fight the enemy; no heart nor courage in them, to go forth and meet him; and even afraid to lift up their voice in mourning, lest they should be heard, being pursued, and be taken.

18 They shall also gird themselves with sackcloth, and horror shall cover them; and shame shall be upon all faces, and baldness upon all their heads.

19 They shall cast their silver in the streets, and their gold shall be removed; their silver and their gold shall not be able to deliver them in the day of the wrath of the Lord. They shall not satisfy their souls, neither fill their bowels, because it is the stumbling block of their iniquity. — gold and silver as being of no use to preserve them from famine and pestilence, but instead an hindrance in their flight from the enemy. This may also be interpreted as their idols of gold and silver, which shall be as items of contempt, to be cast away. Greed and the love for riches are their iniquity, covetousness, and idolatry, at which they stumbled, and fell into sin, and so into punishment for them.

20 “As for the beauty of his ornament, he set it in majesty; but they made the images of their abominations and of their detestable things therein; therefore have I set it far from them.

21 And I will give it into the hands of the strangers for a prey and to the wicked of the earth for a spoil, and they shall pollute it.

22 My face will I turn also from them, and they shall pollute My secret place; for the robbers shall enter into it and defile it. — because of their sins, God allows the Chaldeans, the Greeks, and the Romans not only to destroy Jerusalem; but to enter God’s temple, even the holy of hollies: to deface it, plunder it, and burn it to the ground.

23 “Make a chain, for the land is full of bloody crimes, and the city is full of violence. — or, “judgment of bloods,” capital crimes, such as are deserving of death, particularly murder, or shedding of innocent blood, gun violence especially in the United States today.

24 Therefore I will bring the worst of the nations, and they shall possess their houses. I will also make the pomp of the strong to cease, and their holy places shall be defiled. — many refugees, Afghans, Syrians, Iraqis, Palestinians, Mexicans are now in American cities. Would some of them or their children turn into extremists like the Chechens did an attack in Boston with further plan to travel to Times Square in New York to unleash more mayhem and bombs?

25 Destruction cometh; and they shall seek peace, and there shall be none.

26 Mischief shall come upon mischief, and rumor shall be upon rumor. Then shall they seek a vision of the prophet, but the law shall perish from the priest and counsel from the ancients. — vision shall perish from the prophet, the law from the priest, and counselors from the ancients. Being rejected and be threatened, they wouldn’t be able to continue giving wise counsel; for the law shall perish from them. Other “wise men” and celebrated statesmen could devise foolish schemes; and in trying to avert disasters, they hasten their national ruin.

27 The king shall mourn, and the prince shall be clothed with desolation, and the hands of the people of the land shall be troubled. I will do unto them according to their way, and according to their deserts will I judge them; and they shall know that I am the Lord.” — the Targum says: “in their judgments will I judge them:” the same measure they have meted out to others shall be measured unto them. All these judgments are to make them know the only Lord God of this universe is fair, omnipotent, omniscient and omnipresent.

Ezekiel 8

In this chapter the prophet is carried in vision to Jerusalem and begins a new scene of prophecy extending to the twelfth chapter containing only one vision. This, according to Archbishop Usher, was the sixth year of Ezekiel’s captivity.

And it came to pass in the sixth year, in the sixth month, on the fifth day of the month, as I sat in mine house and the elders of Judah sat before me, that the hand of the Lord God fell there upon me. that the hand of the Lord fell upon me; which the Targum interprets is the spirit of prophecy, which came with power upon him: it denotes the energy and efficacy of the Spirit of God upon him, and revealing to him the things that would soon take place;

— the “elders of Judah” were the elders of Judah that were carried captives along with Jehoiachin; but more probably these were those that came from Jerusalem inquiring about the fate of the holy city.

Then I beheld, and lo, a likeness as the appearance of fire: from the appearance of His loins even downward, fire, and from His loins even upward, as the appearance of brightness, as the color of amber. the Septuagint renders it, “behold the likeness of a man”; reading איש, “a man”, for אש, “fire.” The Targum renders both the one and the other part of the description thus, “and I saw. . . a likeness the look of fire, the look of glory, which the eye cannot see, nor is it possible to look upon it; and beneath the look of fire, and the look of glory, which the eye cannot behold, nor is it possible to contemplate it; and above, as the look of brightness.”

Hence there are many variations interchanging between fire and man among all the English versions of the Bible. Here is one great example, the Message Bible:

In the sixth year, in the sixth month and the fifth day, while I was sitting at home meeting with the leaders of Judah, it happened that the hand of my Master, God, gripped me. When I looked, I was astonished. What I saw looked like a man—from the waist down like fire and from the waist up like highly burnished bronze. He reached out what looked like a hand and grabbed me by the hair. The Spirit swept me high in the air and carried me in visions of God to Jerusalem, to the entrance of the north gate of the Temple’s inside court where the image of the sex goddess that makes God so angry had been set up. Right before me was the Glory of the God of Israel, exactly like the vision I had seen out on the plain.

And He put forth the form of a hand, and took me by a lock of mine head; and the Spirit lifted me up between the earth and the heaven, and brought me in the visions of God to Jerusalem, to the door of the inner gate that looketh toward the north, where was the seat of the image of jealousy, which provoketh to jealousy. — and brought me in the visions of God to Jerusalem; so it was represented to Ezekiel in a true vision, which was of God, that he was carried from Chaldea to Jerusalem; not that he really was, for he was still in Chaldea when that vision was over.

And behold, the glory of the God of Israel was there, according to the vision that I saw in the plain. — is this the Shekinah? Yes, behold, the glory of the God of Israel was there…. in the temple, between the cherubim, where the glory of the divine Majesty dwelt. The Shekinah is a visible manifestation of God on earth, whose presence is portrayed through a natural occurrence of clouds and fire. Shekinah Glory means “He caused to dwell,” referring to the divine presence of God. So this was the same Shekinah that accompanied the children of Israel in the wilderness during the Exodus.

Then said He unto me, “Son of man, lift up thine eyes now the way toward the north.” So I lifted up mine eyes the way toward the north, and beheld northward at the gate of the altar this image of jealousy in the entry. — Isaiah 14:13 “For thou hast said in thine heart, I will sit also upon the mount of the congregation, in the side of the north,” indicates God’s throne is toward the north. And God is jealous of the numerous idols the house of Israel were ironically practicing in “Jerusalem” and “in His Sanctuary.”

He said furthermore unto me, “Son of man, seest thou what they do, even the great abominations that the house of Israel committeth here, that I should depart far off from My sanctuary? But turn thee yet again, and thou shalt see greater abominations.” — even a greater abominations than the house of Israel committeth in His Sanctuary?

And He brought me to the door of the court; and when I looked, behold, a hole in the wall.

Then said He unto me, “Son of man, dig now in the wall”; and when I had dug in the wall, behold, a door.

And He said unto me, “Go in, and behold the wicked abominations that they do here.” — and behold the wicked abominations they do here; the idolatries there committed, wicked in themselves, and abominable to God.

10 So I went in and saw; and behold, every form of creeping things and abominable beasts and all the idols of the house of Israel portrayed upon the wall round about.

11 And there stood before them seventy men of the ancients of the house of Israel, and in the midst of them stood Jaazaniah the son of Shaphan, with every man his censer in his hand; and a thick cloud of incense went up. — seventy men of the ancients of the house of Israel; the whole Sanhedrin, or the great court of judicature in Jerusalem, which were originally appointed in Moses’ time to be judges and officers over the people, and govern, judge and direct them according the tenets established in Exodus 18:21–22 and Deuteronomy 17:9–12;

and today, the Sanhedrin is functioning in Jerusalem.

12 Then said He unto me, “Son of man, hast thou seen what the elders of the house of Israel do in the dark, every man in the chambers of his images? For they say, ‘The Lord seeth us not. The Lord hath forsaken the earth.’” — every man in the chambers of his imagery? the Septuagint renders it, “in his hidden” or “secret chamber”; that is, in those chambers which belonged to the priests and Levites, on the walls they had their secret rites or mysteries performed, in imitation of the heathens; who had mysteries of their religion privately observed; to which none were admitted; as those of Osiris among the Egyptians; of Ceres with the Grecians; and of Bona Dea among the Romans.

13 He said also unto me, “Turn thee yet again, and thou shalt see greater abominations that they do.”

14 Then He brought me to the door of the gate of the Lord’S house which was toward the north; and behold, there sat women weeping for Tammuz.

15 Then said He unto me, “Hast thou seen this, O son of man? Turn thee yet again, and thou shalt see greater abominations than these.”

16 And He brought me into the inner court of the Lord’S house, and behold, at the door of the temple of the Lord, between the porch and the altar, were about five and twenty men with their backs toward the temple of the Lord and their faces toward the east; and they worshiped the sun toward the east. — the heads of the twenty-four courses of the priesthood, led by the high priest, making up the “twenty five men” were not only worshipping the sun: they were doing so in the very temple of God, with their backs turned upon the presence of God!

the worship of heavenly bodies was against God’s will which Moses had warned the people (Deuteronomy 4:19, 17:3, whose penalty is to be stoned to death, Deuteronomy 17:5 ’till they die). These 25 men corrupted themselves by worshipping the sun; and so the Targum renders it, “and, lo, they corrupted themselves, worshipping facing the east the sun; their backs toward the temple of the Lord” — turned their backs to the most holy place; which is an aggravation of their impiety; casting the utmost contempt for God:

Moses’ warnings in Deuteronomy 17

3 And [if you] hath gone and served other gods and worshiped them, either the sun or moon or any of the host of heaven, which I have not commanded, and it be told thee, and thou hast heard of it and inquired diligently, and behold, it be true and the thing certain that such abomination is wrought in Israel, 5 then shalt thou bring forth that man or that woman who has committed that wicked thing unto thy gates, even that man or that woman, and shalt stone them with stones till they die. Deuteronomy 17:3-5

— also, Days of the Week Names: “Sunday” is the Sun’s day and “Monday” is the Moon’s day. “Tuesday” is Tiw’s day; Tiw is an Anglo-Saxon god of war. “Wednesday” comes from Woden, the Anglo-Saxon king of the gods; in Saxon the name is Wodnesdaeg. “Thursday” is Thursdaeg, Thor’s day; Thor is a Norse god of thunder, lightning and storms. “Friday” is Frigedaeg, Frigga’s day; Frigg is a Norse goddess of home, marriage and fertility. “Saturday” is Saeterndaeg, Saturn’s day; Saturn is an ancient Roman god of fun and feasting;

— Months of the Year Names: January (derived from the Latin Januarius) is to honor their Roman gods Janus; and March, named for Mars, is the Roman mighty god of war; February is derived from the Februa festival or its eponymous februa (“purifications, expiatory offerings”); April relates to what the Romans called the month Aprilis; from a word meaning “to open” and further back from Aphrodite, the Greek name for the goddess of love. May – named for Maia, is the Roman goddess of spring and growth;

— June is a name attributed to Juno, the female mighty wife of Jupiter in Roman mythology. She is also called the “Queen of Heaven” and “Queen of Mighty Ones.” July is to honor Julius Caesar; the Roman Senate named it “Julius” in honor of Roman emperor Julius Caesar. August honor Julius Caesar’s successor, the emperor Augustus; and the months September, October, November, and December are archaic adjectives derived from the ordinal numbers 7 to 10;

— today, more than 98.5 percent of Christians are honoring the SUN by observing SUNday worship. They have “their backs toward the temple of the Lord and their faces toward the east; and they worshiped the SUN toward the east; whose penalty is to be stoned to death – ’till they die.

also, following the SUN-worshipping Samaritans, most Church of God Communities are showing their contempt for God by having their “wavesheaf offering” and Pentecost on a SUNday; always on a SUNday. And these are supposedly in God’s Sanctuary, but God says He is a jealous God, so these pretentious Christians could be spewed out of His mouth! A death penalty – ’till they die!

17 Then He said unto me, “Hast thou seen this, O son of man? Is it a light thing to the house of Judah that they commit the abominations which they commit here? For they have filled the land with violence and have returned to provoke Me to anger; and lo, they put the branch to their nose.

18 Therefore will I also deal in fury. Mine eye shall not spare, neither will I have pity; and though they cry in Mine ears with a loud voice, yet will I not hear them.” — yet will I not hear them; as they turned their backs on him, God will turn a deaf ear to them, and not regard their cries; the Targum says, “they shall pray before me, with a great voice, and I will not receive their prayer.”

Ezekiel (Ch 5-6)

•September 6, 2021 • Leave a Comment

Chapter 5 is using Jerusalem as an example of the judgments which God were about to execute on its inhabitants with famine, pestilence, sword, and dispersion, and what were the reasons of God’s judgments on that great city; and the nature, rise, and end of them. 

And this warning is to “all the house of Israel” (verse 4); all thirteen tribes.

Ezekiel 5

1 “And thou, son of man, take thee a sharp knife, take thee a barber’s razor and cause it to pass over thine head and upon thy beard. Then take thee balances to weigh and divide the hair. — the Septuagint reads this in conjunction with the former, thus, “take thee a knife”, or “sword, sharper than a barber’s razor” — tn the Brenton translation: “a sword sharper than a barber’s razor.”

John Gill: and cause it to pass upon thine head, and upon thy beard; the “head” was a symbol of the city of Jerusalem, the metropolis of Judea; the “beard”, of the cities, towns, and villages about it; and the “hair” of both, of the common people; compared to hair for their numbers, for their levity and unsteadiness, and for their being the beauty and ornament of the places where they lived; and the shaving of them denotes their disgrace and destruction, and mourning on account thereof.

Thou shalt burn with fire a third part in the midst of the city, when the days of the siege are fulfilled; and thou shalt take a third part and smite about it with a knife, and a third part thou shalt scatter in the wind; and I will draw out a sword after them.

The first third “fire” would also include pestilence and famine: “Our skin was black like an oven because of the terrible famine.” Lementation 5:10; see also Ezekiel 5:12 below.

The Septuagint: 2A fourth part thou shalt burn in the fire in the midst of the city, at the fulfillment of the days of the siege: and thou shalt take a fourth part, and burn it up in the midst of it: and a fourth part thou shalt cut with a sword round about it: and a fourth part thou shalt scatter to the wind; and I will draw out a sword after them. 

The rubble of the World Trade Centre in New York smoulders following a terrorist attack on September 11, 2001 in New York. China was quick to express solidarity and willingness to work with the US to defeat terrorism. Photo: AFP
One already passed, more along the way . . .

Thou shalt also take thereof a few in number, and bind them in thy skirts. and bind them in thy skirts; in the pockets of them; signifying both a very small number of them, and their preservation. Rabbi Rashi interprets these that were carried captive to Babylon, and lived there, and were preserved, and returned again.

Then take of them again, and cast them into the midst of the fire, and burn them in the fire; for thereof shall a fire come forth into all the house of Israel. — and this warning is to “all the house of Israel;” the northern house of Israel (for 190 years?) and the southern house of Judah (for 40 years?) — and cast them into the midst of the fire, and burn them in the fire: this was fulfilled in Gedaliah and the Jews that were with him, over whom the king of Babylon had made him governor, who were slain by Ishmael.

“Thus saith the Lord God: This is Jerusalem. I have set it in the midst of the nations and countries that are round about her. Gill: a type or sign of it; it may refer to both the former and latter type. It is the city of Jerusalem that is designed by the city portrayed upon the tile; and the same is signified by the head of the prophet that was to be shaved; that being not only the chief city of Judea, but of the whole world.

And she hath changed My judgments into wickedness more than the nations, and My statutes more than the countries that are round about her; for they have refused My judgments and My statutes. They have not walked in them.

Gill: and she hath changed my judgments into wickedness more than the nations…. So they changed their glory for that which did not profit; and the glory of the incorruptible God into an image made like to corruptible man; and the truth of God into a lie, Jeremiah 2:11; or, “for wickedness”; for judgments and laws that were not good, and which to observe was wickedness.

— the word “changed” signifies to “rebel against” or to “transgress”: and the may be, she, that is, Jerusalem, has “rebelled” against my judgments, and “transgressed” them in a wicked manner, even to a greater degree than the nations of the world. The Targum and Rashi interpret it changed as we do: — witness LGBTQIA (lesbian, gay, bisexual, transgender, queer (questioning), intersex, asexual (agender));

woe unto them that call evil good, and good evil; that count darkness as light, and light as darkness; that put bitter for sweet, and sweet for bitter! Isaiah 5:20;

— and my statutes more than the countries that are around her. “Judgments” and “statutes”, are the same laws and ordinances of worship, being just and righteous, and firm and unalterable; unless it should rather be thought that “judgments” belong to the moral law, being given forth by the Lord as a judge, and founded upon judgment and righteousness; and “statutes” to the ceremonial law, being of positive institution and appointment, and to last so long as it was the pleasure of the lawgiver: — witness God’s judgement on Jerusalem in 70 AD;

for they have refused my judgments and my statutes; they refused to comply with them, and to yield an obedience to them, and that with loathing, disdain, and contempt, as the word s signifies — no one seems to understanding the significance of the siege and inferno of Jerusalem from 66 AD to 70 AD;

they have not walked in them; they did not make them the role of their walk and conversation; they showed no regard to them; they went out of the way of them, into crooked paths, with the workers of iniquity.

Therefore thus saith the Lord God: Because ye multiplied more than the nations that are round about you, and have not walked in My statutes, neither have kept My judgments, neither have done according to the judgments of the nations that are round about you,

“I have seen a horrible thing in the house of Israel; there is the whoredom of Ephraim, Israel is defiled” Hosea 6:10

therefore thus saith the Lord God: Behold I, even I, am against thee, and will execute judgments in the midst of thee in the sight of the nations. — this is serious stuff; the world will see if Fort Detrick and/or the University of North Carolina at Chapel Hill the Source of Covid-19? And before the sight of the nations? The history of Fort Detrick; how they received the Unit 731 transplant and how they nurtured those secrets from then on? Also, perhaps, the full extent of “We lied, we cheated, we stole… we had entire training courses” will be exposed for the world to see?

And I will do in thee that which I have not done, and the like of which I will not do any more, because of all thine abominations. — “because of all thine abominations;” God shows the reason why He deals with the full house of Israel in greater severity than with the surrounding heathen nations. Not comparable to any other nation, not even to Sodom and Gomorrah, when they were destroyed by fire from heaven; not in Egypt, when he inflicted his plagues on Pharaoh and his people. More than the Nazi concentration camp? More than the Armenian genocide in 1916? More than the Japanese Unit 731 germ experiment in Harbin?

10 Therefore the fathers shall eat the sons in the midst of thee, and the sons shall eat their fathers; and I will execute judgments in thee, and the whole remnant of thee will I scatter into all the winds.

Gill: therefore the fathers shall eat the sons in the midst of thee…. which was long ago threatened by the Lord, and prophesied of by Moses, Leviticus 26:27; and was fulfilled at several times in the people of Israel, as at the siege of Samaria, 2 Kings 6:28; at the siege of Jerusalem by Nebuchadnezzar, Lamentations 4:10;

— and at the siege of the same city by Titus Vespasian, as Josephus relates; for though these instances only show that mothers ate their children, yet no doubt the fathers took part with them; and if mothers, who are naturally more tender, could do this, it is much more reasonable to suppose that fathers did the same.

11 “Therefore as I live, saith the Lord God, surely because thou hast defiled My sanctuary with all thy detestable things and with all thine abominations, therefore will I also diminish thee; neither shall Mine eye spare, neither will I have any pity.

12 A third part of thee shall die with the pestilence, and with famine shall they be consumed in the midst of thee; and a third part shall fall by the sword round about thee; and I will scatter a third part into all the winds, and I will draw out a sword after them.

A third part of them shall die with the pestilence and with famine shall they be consumed in the midst of thee;

and a third part shall fall by the sword round about thee; signified by the third part of the hair, smitten with a knife;

and I will scatter a third part into all the winds; the greatest part of which were carried into captivity.

13 Thus shall Mine anger be accomplished, and I will cause My fury to rest upon them, and I will be comforted; and they shall know that I, the Lord, have spoken it in My zeal when I have accomplished My fury upon them. and they shall know that I the Lord have spoken it in My zeal; that is, they shall find by experience that what the Lord had spoken by His prophets, and had threatened to bring upon them, was said in earnest, and arose from a jealousy for His own glory; this will be a clear case, and out of question.

14 “Moreover I will make thee a waste and a reproach among the nations that are round about thee, in the sight of all that pass by.

15 So it shall be a reproach and a taunt, an instruction and an astonishment unto the nations that are round about thee, when I shall execute judgments upon thee in anger and in fury and in furious rebukes. I, the Lord, have spoken it. I the Lord have spoken it; the Targum says, “I the Lord have decreed in my word.”

16 When I shall send upon them the evil arrows of famine which shall be for their destruction, and which I will send to destroy you, and I will increase the famine upon you, and will break your staff of bread,

17 so will I send upon you famine and evil beasts, and they shall bereave thee; and pestilence and blood shall pass through thee, and I will bring the sword upon thee. I, the Lord, have spoken it.” I the Lord have spoken it: who was able to perform it, and did, both at the destruction of Jerusalem by Nebuchadnezzar and by Titus in 70 AD; and perhaps a series of bigger ones in the future?

Ezekiel 6

1 And the word of the Lord came unto me, saying,

“Son of man, set thy face toward the mountains of Israel, and prophesy against them Son of man, set thy face towards the mountains of Israel…. or cities of Israel, the future inhabitants of them; not the ancient ten tribes, for they had been carried captive long before this time, even in the times of Hezekiah; but far more likely, into the far future unless it can be thought that this prophecy is designed to show the reason of their captivity, which isn’t. 

and say: ‘Ye mountains of Israel, hear the word of the Lord God. Thus saith the Lord God to the mountains and to the hills, to the rivers and to the valleys: Behold I, even I, will bring a sword upon you, and I will destroy your high places. — this message to the “mountains of Israel;” these mountains refer to the United States, UK and France. . . . “and to the hills, to the rivers and to the valleys;” the hills: Ireland, Switzerland and the Scandinavian countries: Denmark, Norway, and Sweden, Finland, and Iceland; and the valleys, the low countries: Belgium, the Netherlands, and Luxembourg;

— and to the rivers; where during the nineteenth century, the British Royal Navy were known to “Rule the Waves;” and the United States having been plowing up and down the five oceans with her Seven Fleets since the British left the scene.

And your altars shall be desolate, and your images shall be broken; and I will cast down your slain men before your idols.

And I will lay the dead carcasses of the children of Israel before their idols; and I will scatter your bones round about your altars.

In all your dwelling places the cities shall be laid waste, and the high places shall be desolate, that your altars may be laid waste and made desolate, and your idols may be broken and cease, and your images may be cut down, and your works may be abolished. in all your dwelling places your cities shall be laid waste…. which denotes that the desolation should be general, wherever they had cities and places to dwell in; the idolatry being universal, as is said in Jeremiah 2:28; But where are thy gods that thou hast made thee? Let them arise if they can save thee in the time of thy trouble; for according to the number of thy cities are thy gods, O Judah. Of course, this is for modern Israel, not Judah.

Flash forward: “I will lay thy cities waste, and thou shalt be desolate, and thou shalt know that I am the LORD” Ezekiel 35:4.

And the slain shall fall in the midst of you, and ye shall know that I am the Lord.

“‘Yet will I leave a remnant, that ye may have some that shall escape the sword among the nations when ye shall be scattered through the countries. — situations are getting very serious, and ultimately Ezekiel asks:  “Ah, Lord God! Wilt Thou make a full end of the remnant of Israel?” Ezekiel 11:13.

And they that escape from among you shall remember Me among the nations whither they shall be carried captives, because I am broken with their whorish heart which hath departed from Me, and with their eyes which go a whoring after their idols. And they shall loathe themselves for the evils which they have committed in all their abominations. — they that escape of you shall remember Me (God); those that escape the sword, the pestilence, and the famine, and shall be led into captivity, shall plainly see that it is God who has done this, and shall humble themselves on account of their abominations, leave their idolatry, and worship God alone;

— and this they have experienced from the Babylonian captivity many times again and again down to the present day.

10 And they shall know that I am the Lord, and that I have not said in vain that I would do this evil unto them.

11 “‘Thus saith the Lord God: Smite with thine hand and stamp with thy foot, and say: “Alas for all the evil abominations of the house of Israel!” For they shall fall by the sword, by the famine, and by the pestilence. for they shall fall by the sword, by the famine, and by the pestilence; which are threatened in Ezekiel 5:12; and the persons on whom they should be separately executed are mentioned in Ezekiel 6:12. Again the term “the house of Israel” is used here.

12 He that is far off shall die of the pestilence, and he that is near shall fall by the sword, and he that remaineth and is besieged shall die by the famine; thus will I accomplish My fury upon them. central theme of falling by the sword, by the famine, and by the pestilence are repeated for emphasis. And sometimes in different order indicates they are all mixed together.

13 Then shall ye know that I am the Lord, when their slain men shall be among their idols round about their altars, upon every high hill, on all the tops of the mountains, and under every green tree, and under every thick oak, the place where they offered sweet savor to all their idols. — modern day idolatry is alive and well. Anything that we love, treasure, prioritize, identify with, or look to for need fulfillment outside of God, can be acting as an idol in our heart and life: Wealth, Prosperity, Career Success, Image, Safety & Security.

14 So will I stretch out My hand upon them and make the land desolate, yea, more desolate than the wilderness toward Diblath, in all their habitations; and they shall know that I am the Lord.’”

— by now we have established that 70 AD is one of God’s judgement on Judah and Jerusalem, but it’s a microcosm for the wider Israelites at the endtime. So which were God’s judgement in 70 AD? And which sects managed to escape fire and death? History recorded only two sects that escaped the inferno of 70 AD.

(1) The Christians, known as Nazarenes in Acts 24:5. They escaped to a northern town called Pella, west of the Jordan River.

(2) Some Pharisees, those of the House of Hillel. They were headed by a Pharisaic rabbi, Johanan ben Zakkai, the head of the Sanhedrin, who was smuggled out of besieged Jerusalem in a coffin. They escaped to Yavne and, later, his followers re-emerged as Rabbinic Jews, who established the Hillel Calendar, which was revealed by Hillel II in about 359 AD concerning the rules of the calendar.

All other sects died and “disappeared” in the 70 AD inferno: (a) All Sadducees, Herodians, Boethusians; (b) Essenes, together with (c) the House of Shammai Pharisees and (d) the Zealots. They all disappeared by receiving their fire. Were these sects facing their judgement as warned by Ezekiel?

If the 70 AD inferno was only a microcosm, a foretaste, how could those who deviate from the God ordained Calendar, who have similar deceptive beliefs as the original Essenes, escape Ezekiel’s and John’s warning during the Last Days? Wouldn’t there be another Sodom and Gomorrah? And wouldn’t they also share its fate? It’s an unpleasant ending, but that’s what the Scriptures indicate.

When in 70 AD, Jerusalem went through a fire inferno and all Sadducees disappeared from history.  “Disappeared from history” seems like a whitewashed phrase. They were in fact burnt off like the inhabitants of Sodom and Gomorrah. Shall a trumpet be blown in the city, and the people not be afraid? Shall there be evil in a city, and the Lord hath not done it? Amos 3:6. Their predictions of death were proven true, that the Sadducees were sharing the same fate with king Zedekiah, described as “the wicked ones … whose reign over Israel will be brought down … his wives, his children, and his infant will go into captivity.”

Like the Samaritans, the Sadducees rejected not only the Oral Torah and the Rabbinic understanding of the Torah, but instead accepted the Samaritan interpretation of their Passover and Pentecost celebration. By doing so they rejected the Prophets (like Ezekiel) and their Writings. God included His holy city of Jerusalem in this judgment in 70 AD as a microcosm for us to be forewarned, so take heed.

Ezekiel (Ch 3-4)

•September 4, 2021 • Leave a Comment

Chapter 3 starts with further account of the prophet’s calling and mission; of his preparation and work; of the people to whom he was sent; of what happened to him; of the nature of his office, and what followed upon the renewal of his calling.

And remember, Ezekiel’s prophetic message wasn’t for the house of Judah but to the house of Israel; hence we must try to read the prophetic meaning behind all those historical setting. Its timing was a great distance into the future (Ezekiel 12:27), into our time and the message is primarily and principally for the United States of America, and secondarily its European allies.

Ezekiel 3

1 Moreover He said unto me, “Son of man, eat what thou findest: eat this scroll, and go, speak unto the house of Israel.”

John Gill: eat this roll; not literally, but figuratively, as John is bid to eat the little book, digest it – let it be thy nourishment; and let it be thy meat and drink to do the will of thy Father who is in heaven. Revelation 10:9; that is, read it, meditate upon the things contained therein; and digest them, that he might be able to impart them, and make them known to others: it is explained in Ezekiel 3:10; by hearing and receiving the words of the prophecy; and so the Targum, “receive what is written in this roll.”

So I opened my mouth, and He caused me to eat that scroll.

And He said unto me, “Son of man, cause thy belly to eat, and fill thy bowels with this scroll that I give thee.” Then did I eat it, and it was in my mouth as honey for sweetness. — it was joyous for Ezekiel to receive the Divine message, to be thus let into the secrets of the Divine counsel. It’s liked the Parable of the King inviting one special friend for the Eight Day to end the Feast; for just one special guest.

Gill: And he said unto me, son of man, cause thy belly to eat…. or “devour” and consume; that is, concoct and digest; do not cast it out of thy mouth, as soon as thou hast tasted of it; but let it go down into the stomach, and there digest it; and from thence into the belly, that so, upon the whole, virtue may be received, and nourishment come by it:

— and fill thy bowels with this roll that I give thee; eat to satiety;

— so the Targum says, “son of man, thou shalt satiate thy soul, and fill thy belly, if thou receivest what is written in this roll, which I give thee:”

— this was sufficient to qualify the prophet for prophesying, and furnish him with materials enough; and these fit and proper for the discharge of his office; and so such who study the word of God with application become scribes well instructed in the kingdom of heaven; and being filled themselves, are able to bring forth a message to the comfort and satisfaction of others.

And He said unto me, “Son of man, go, get thee unto the house of Israel, and speak with My words unto them. and he said unto me, son of man, go…. after he had eaten the roll; for then was he qualified to prophesy:

For thou art not sent to a people of strange speech and of a hard language, but to the house of Israel but to the house of Israel; who were a people of the same speech and language with the prophet; all spoke and understood the Hebrew language; nor were the things he delivered such as they were altogether strangers to being the same, for substance, which Moses, and the other prophets, had ever taught.

not to many people of strange speech and of a hard language, whose words thou canst not understand. Surely, had I sent thee to them, they would have hearkened unto thee. surely, had I sent thee to them “a people of strange speech and of a hard language,” they would have hearkened unto thee; which shows an aggravation of the obstinacy and disobedience of the people of Israel; that had the Gentile nations been favoured with the same means of instruction they were they would have been obedient. That is, Gentiles “they would have hearkened unto thee” would have repented and would have done better!!!

But the house of Israel will not hearken unto thee, for they will not hearken unto Me; for all the house of Israel are impudent and hardhearted. “They are not willing”; they have no desire, no inclination, to hear and hearken; but the reverse: stiffnecked as in Exodus 32:9; and indeed the reason why they did not hearken to him was not because they rejected him (Ezekiel) and his words, but because they rejected the Lord and his reproofs (admonitions).

Behold, I have made thy face strong against their faces, and thy forehead strong against their foreheads. Ezekiel should behave with an undaunted spirit, and with great intrepidity, amidst all opposition made to him.

As an adamant, harder than flint, have I made thy forehead. Fear them not, neither be dismayed at their looks, though they be a rebellious house.”

10 Moreover He said unto me, “Son of man, all My words that I shall speak unto thee receive in thine heart, and hear with thine ears.

11 And go, get thee to those of the captivity, unto the children of thy people, and speak unto them and tell them, ‘Thus saith the Lord God,’ whether they will hear or whether they will forbear.” “Go, get thee unto thy people…” note that God did not say here, “unto my people,” but “unto thy people.” The apostasy of Israel was so complete that God no longer recognized them as his people, thus fulfilling the prophecy of Hosea, “I hated them: because of the wickedness of their doings I will drive them out of my house; I will love them no more” (Hosea 9:15).

12 Then the Spirit took me up, and I heard behind me a voice of a great rushing, saying, “Blessed be the glory of the Lord from His place.” a voice of a great rushing; this was the same noise made by the wings of the living creatures that formed the chariot of God. See Ezekiel chapters 1 and 10. 

13 I heard also the noise of the wings of the living creatures that touched one another, and the noise of the wheels opposite them, and a noise of a great rushing.

14 So the Spirit lifted me up and took me away, and I went in bitterness, in the heat of my spirit; but the hand of the Lord was strong upon me. then the spirit took me up…. not the wind, nor an angel, but the Spirit of God; who took up Ezekiel from the ground, from the place where he was, among the captives by the river Chebar, and had seen the glorious vision described in the first chapter; and had had his call and mission, as expressed in the second chapter; and was carried by him to another company of captives, who were at another place by the same river, as appears by comparing Ezekiel 1:1, with Ezekiel 3:15.

15 Then I came to those of the captivity at Telabib, who dwelt by the River of Chebar; and I sat where they sat, and remained there astonished among them seven days. seven days: at the change of place and company; at the sad condition his people were in; and, above all, at the dreadful things he had to deliver to them. The Targum renders it, “silent”; through grief and trouble a great time for reflection.

16 And it came to pass at the end of seven days that the word of the Lord came unto me, saying,

17 “Son of man, I have made thee a watchman unto the house of Israel; therefore hear the word out of My mouth, and give them warning from Me.  

Son of man, I have made thee a watchman unto the house of Israel… both in a civil sense, a watchman of a town or city, or of the whole country, and in an ecclesiastical sense. So the Targum renders it by מליף, “a teacher”; whose business it was to instruct the people in divine things, to warn them of their evil ways, and of the danger they exposed them to; such were the prophets of old; and lies in watching over the souls of men, as shepherds over their flocks, that they go into right pastures, and not astray, and so preserves them from beasts of prey; and as watchmen of cities, to give the time of night, and, notice of approaching danger; to the discharge of which office are necessary quick sight, diligence in looking out, sobriety and vigilance, courage, constancy, and faithfulness: and they are “sons of men” that are put into this office.

18 When I say unto the wicked, ‘Thou shalt surely die,’ and thou givest him not warning, nor speakest to warn the wicked from his wicked way to save his life, the same wicked man shall die in his iniquity; but his blood will I require at thine hand. — thou shalt surely die; that is, If he turn not from his wickedness, and thou givest him not warning, as above, he shalt die in his iniquity, which he should not have committed; but his blood will I require at thy hand; I will visit thy soul for the loss of his.

19 Yet if thou warn the wicked, and he turn not from his wickedness nor from his wicked way, he shall die in his iniquity; but thou hast delivered thy soul.

20 Again, when a righteous man doth turn from his righteousness and commit iniquity, and I lay a stumbling block before him, he shall die. Because thou hast not given him warning, he shall die in his sin, and his righteousness which he hath done shall not be remembered; but his blood will I require at thine hand.

Rabbi Rashi: I shall place a stumbling block before him: When he does his deeds in secret and displays himself as a righteous man, I place an overt sin before him in order to reveal his deeds, and when I bring evil upon him, they will not question Me.

21 Nevertheless if thou warn the righteous man that the righteous sin not, and he doth not sin, he shall surely live because he is warned; also thou hast delivered thy soul.”

<< there seems to be some missing events to fill the gap. Ezekiel must have delivered his warning message, least he would die as a watcher, but he didn’t die, signifying he must have delivered the warning but that the people didn’t like the message. On his return, he was made dumb by God who asked him to stay at home until the fulfillment of his warning: the destruction of Jerusalem: Ezekiel 24:26-27. This is historical but the real message is for the endtime and is to the house of Israel >>

22 And the hand of the Lord was there upon me; and He said unto me, “Arise, go forth into the plain, and I will there talk with thee.”

23 Then I arose and went forth into the plain, and behold, the glory of the Lord stood there, as the glory which I saw by the River of Chebar; and I fell on my face.

24 Then the Spirit entered into me and set me upon my feet, and spoke with me and said unto me, “Go, shut thyself within thine house. instead of sending him to a public assembly, God orders him to confine himself to his own lodgings: Go, shut thyself within thy house.

25 But thou, O son of man, behold, they shall put bands upon thee and shall bind thee with them, and thou shalt not go out among them.

26 And I will make thy tongue cleave to the roof of thy mouth, that thou shalt be dumb and shalt not be to them a reprover [someone who finds fault or imputes blame], for they are a rebellious house. — that thou shall be dumb…. which is to be understood not just literally, as if he was really struck dumb, as Zechariah was; and that such silence should be charged upon him by the Lord, that he should be as if his tongue cleaved to the roof of his mouth, as if he was a dumb man: and so the Septuagint version renders it, “I will bind thy tongue.”

27 But when I speak with thee, I will open thy mouth, and thou shalt say unto them, ‘Thus saith the Lord God.’ He that heareth, let him hear; and he that forbeareth, let him forbear; for they are a rebellious house. — I will make thy tongue cleave to the roof of thy mouth; I will not give thee any message to deliver to them. They are so rebellious, it is useless to give them further warning. But then again, God set the time, when to be silent and when to speak when the time is right.

Ezekiel 4

1 “Thou also, son of man, take thee a tile and lay it before thee, and portray upon it the city, even Jerusalem;

and lay siege against it, and build a fort against it, and cast a mound against it. Set the camp also against it, and set battering rams against it round about. — if Jerusalem had already fallen then this mentioning of Jerusalem could be a futurist event, perhaps in the year 70 AD, and the event of this siege could be a microcosm for the endtime, for a wider audience, for the house of Israel in the next verse, and its timing was a great distance into the future (Ezekiel 12:27).

Moreover take thou unto thee an iron plate, and set it for a wall of iron between thee and the city; and set thy face against it, and it shall be besieged, and thou shalt lay siege against it. This shall be a sign to the house of Israel.

“Also lie thou upon thy left side, and lay the iniquity of the house of Israel upon it: according to the number of the days that thou shalt lie upon it, thou shalt bear their iniquity. — the Septuagint has another phase: “according to the number of the hundred and fifty days,” which is not in the Masoretic text.

For I have laid upon thee the years of their iniquity, according to the number of the days, three hundred and ninety days; so shalt thou bear the iniquity of the house of Israel.

Nobody attempts to place what this 390 years mean, except:

Rashi: three hundred and ninety days: We learned in Seder Olam (ch. 26): This teaches us that Israel sinned for three hundred and ninety years from the time they entered the Land until the ten tribes were exiled therefrom. 

— well, if Rashi’s premise is true, that the 390 years were since the house of Israel entered the Promised Land from the other side of the Jordan to the time of their exile, then using the same principle, Judah’s 40 years of iniquity would have started the same time but ended around the time Joshua ended his reign when he died an an age of 110, or shortly after? It just doesn’t add up and doesn’t make sense!

— oh, and by the way, the Septuagint version of this verse says its 190 years instead of 390 years in verse four; so is this easier to understand? Not quite! Perhaps and perhaps only, the downfall of the house of Israel would start first and last for 150 years before the house of Judah joins them for the last 40 years for the final total 190 years as spelt out in the Septuagint? What do you think?

And when thou hast accomplished them, lie again on thy right side, and thou shalt bear the iniquity of the house of Judah forty days: I have appointed thee each day for a year.

Rashi: the iniquity of the house of Judah forty days: This teaches us that the house of Judah sinned, from the time that the ten tribes were exiled until Jerusalem was destroyed, forty years;

again, the figures and reasoning doesn’t sound right; why start only after the northern 10 tribes had gone into captivity; and the time gap was about 135 to 150 years, not 40?

— reading from verse 4 to verse 6 in the Septuagint, it seems the 190 days are made up of 150 days for Israel and 40 days for Judah.

Septuagint version: And thou shalt lie upon thy left side, and lay the iniquities of the house of Israel upon it, according to the number of the hundred and fifty days which thou shalt lie upon it: and thou shalt bear their iniquities. 5 For I have appointed thee their iniquities for a number of days, for a hundred and ninety days: so thou shalt bear the iniquities of the house of Israel. 6 And thou shalt accomplish this, and shalt lie on thy right side, and shalt bear the iniquities of the house of Juda forty days: I have appointed thee a day for a year.

Therefore thou shalt set thy face toward the siege of Jerusalem; and thine arm shall be uncovered, and thou shalt prophesy against it. — therefore thou shalt set thy face toward the siege at Jerusalem…. all the while he was lying either on the left side or the right, his face was to be directed to the siege of Jerusalem, indicating perhaps it is prophetic “thou shalt prophesy” pointing to the year 70 AD.

And behold, I will lay bands upon thee, and thou shalt not turn thee from one side to another until thou hast ended the days of thy siege.

“Take thou also unto thee wheat and barley and beans, and lentils and millet and fitches, and put them in one vessel, and make thee bread thereof according to the number of the days that thou shalt lie upon thy side; three hundred and ninety days shalt thou eat thereof.

Gill: Take thou also unto thee wheat, and barley, and beans, and lentiles, and millet, and fitches…. the first of these was commonly used to make bread of; in case of want and poverty, barley was used; but, for the rest, they were for cattle, and never used for the food of men but in a time of great scarcity; wherefore this was designed to denote the famine that should attend the siege of Jerusalem.

Gill: no mention is made of the forty days, perhaps they are understood, a part being put for the whole; or they were included in the three hundred and ninety days. The Septuagint and Arabic versions read only a hundred and ninety days.

10 And thy meat which thou shalt eat shall be by weight, twenty shekels a day. From time to time shalt thou eat it.

11 Thou shalt drink also water by measure, a sixth part of a hin. From time to time shalt thou drink. this is famine, same as the great scarcity during the siege of Jerusalem from 66 to 70 AD.

12 And thou shalt eat it as barley cakes, and thou shalt bake it with dung that cometh out of man in their sight.” — in the severity of famines, the captives, to languish in hunger and distress, though not compelled to make bricks from straw but only asked to bake their food with shits! Yak! Is this a better deal than the time being in Egypt?

13 And the Lord said, “Even thus shall the children of Israel eat their defiled bread among the nations, whither I will drive them.” — the above “thus shall” indicates it is futuristic from God’s and Ezekiel’s perspectives as the house of Israel were already in captivity some 150 years ago, so the mystery of 390/190/150/40 years remains what this could possibly mean. Any other possibilities?

14 Then said I, “Ah, Lord God! Behold, my soul hath not been polluted; for from my youth up even till now have I not eaten of that which dieth of itself or is torn in pieces; neither came there abominable flesh into my mouth.” then said I, ah, Lord God!… the interjection “ah” is expressive of sighing and groaning.

Gill: neither came there abominable flesh into my mouth; corrupt or, putrefied, or whatsoever was unclean by law, as swine’s flesh, or any other. The argument is, that since he had never eaten of anything forbidden by the law of God, he could by no means think of eating that which was abhorrent to nature; as bread baked with men’s dung was.

15 Then He said unto me, “Lo, I have given thee cow’s dung for man’s dung, and thou shalt prepare thy bread therewith.” — cow’s dung, obviously an improvement over man’s excretion, which Ezekiel seemed to have bargained for, like Abraham did in his days.

16 Moreover He said unto me, “Son of man, behold, I will break the staff of bread in Jerusalem; and they shall eat bread by weight and with care, and they shall drink water by measure and with astonishment,

17 that they may lack bread and water, and be stunned one with another, and be consumed away for their iniquity.

Below is the Septuagint (and Arabic versions too; John Gill says so) and putting all together, a possible explanation to the mystery of the 390/190/150/40 years:

4 And thou shalt lie upon thy left side, and lay the iniquities of the house of Israel upon it, according to the number of the hundred and fifty days which thou shalt lie upon it: and thou shalt bear their iniquities.  start with the ten tribes house of Israel and last for 150 years

5 For I have appointed thee their iniquities for a number of days, for a hundred and ninety days: so thou shalt bear the iniquities of the house of Israel. start with the 10 tribes but end with the full house of Israel; all 12 tribes: end of the 190 years

6 And thou shalt accomplish this, and shalt lie on thy right side, and shalt bear the iniquities of the house of Juda forty days: I have appointed thee a day for a year. Ezekiel 4:4-6 Septuagint. after the start of the 10 tribes house of Israel and last for 150 years, the house of Judah; 3 tribes join in for 40 years

9 Take thou also to thee wheat, and barley, and beans, and lentils, and millet, and bread-corn; and thou shalt cast them into one earthen vessel, and shalt make them into loaves for thyself; and thou shalt eat them a hundred and ninety days, according to the number of the days which thou sleepest on thy side. Ezekiel 4:9 Septuagint. from the start with 10 tribes and end with full house of Israel: 190 years; why the difference? Perhaps Judah had undergo numerous pogroms and cleanings whereas Ephraim has none since the day when went captivity and into apparent oblivion

We’re now in the Hebrew year 5782 and we’ll need another 217 years to usher the Divine Plan into the 7th Millennium as we believe. Of course, this is on the assumption that God’s oracles have been accurately kept since the day Adam was created as the Oracles custodians claim.

If we add 217 years to the Gregorian calendar year 2021 we’ll come to 2238 when the 7th Millennium starts. Working backward 190 years will bring us to the Gregorian year 2048. So could the year 2048 be the start of the house of Israel’s “iniquity?” — “thus shall the children of Israel eat their defiled bread among the Gentiles, whither I will drive them;” in captivity to start the 190 years?

No, not really: the 190 years should end with the appearance of “My servant David,” in the “valley full of dry bones” scenario (Ezekiel 37) where the full house of Israel would dwell securely rather than in captivity. Indications are that this period is a hundred year period involving “Gog and all his multitude” to the beginning of the Millennium (Ezekiel 40).

If so, the start of the 190 years would be pushed back another hundred years, which would be the Gregorian year 2048; which seems having a higher possibility than the figures (of 390/40 years) offered by the Masoretic Text.

On reflection the children of Israel were in Egypt for about 210 years, so cheers; this captivity of 190 years is 20 years shorter. These analyses may run away with imaginations, but the incorporation of prophecies always has elements of uncertainties and so these predictions could be prone to errors.

Okay, one Question that comes to mind is, “Why the iniquity for Israel is much longer than Judah?” Perhaps the answer could be broken into two parts: (1) the house of Judah, the Jews, have undergone pogroms numerous times over the last two and a millenium whereas the house of Israel have remained largely unscatched since their only captivity was by the Assyrians;

And a related second reason: (2) the house of Judah has already been restored to the Land of Promise; whereas the house of Israel are still largely intact and in exile. It would take decades for conditions to build up for the whole house of Israel to want to return back to their homeland to team up with the house of Judah for the fulfilment of the prophecy of the joining of the two sticks in Ezekiel 37.

And finally, these analyses are not written in stone and so any thoughts to the contrary are most welcome. Are there any other possibilities or factors that have been left out but could or should be considered? Thanks for reading.

Ezekiel (Ch 1-2)

•September 2, 2021 • Leave a Comment

This book Ezekiel is placed after Jeremiah; since Ezekiel was among the captives in Chaldea when his visions occurred; whereas Jeremiah began to prophesy long before that captivity. The name of this prophet signifies, as it is commonly interpreted, “the strength of God”, or “strengthened by God.”

And since Ezekiel was regarded as a major prophets, the events recorded have significant meanings, that although those events were historical, they have implications for our time.

And Ezekiel’s message wasn’t for the house of Judah but to the house of Israel, whose captivity occurred some 135 years before Judah’s captivity. Hence we must try to read the prophetic meaning behind all those historical setting.

Yet nobody seems to understand the various symbols and riddles in this book of Ezekiel to put all the puzzles into a cohesive and coherent picture. The Jews couldn’t understand what or how the house of Israel could have any relevance since the days they went into exile; Christians taught themselves that they have already replaced the Israelites and God’s graceful promises of eternity are now theirs!

The secret is out when God revealed it to Ezekiel: “Son of man, behold, they of the house of Israel say, ‘The vision that he seeth is for many days to come, and he prophesieth of the times that are far off’ (Ezekiel 12:27). Or as the RSV has it: “The vision that he sees is for many days hence, and he prophesies of times far off.” That’s right, its timing was a great distance into the future into our time and the message is primarily and principally for the United States of America, and secondarily its European allies.

Ezekiel 1

1 Now it came to pass in the thirtieth year, in the fourth month, on the fifth day of the month, as I was among the captives by the River of Chebar, that the heavens were opened and I saw visions of God.

— the Targum, whose origin in the Aramaic language could be traced to Ezra, paraphrases the words thus, “and it was in the thirtieth year after Hilkiah the high priest found the book of the law, in the house of the sanctuary, in the court under the porch, in the middle of the night, after the moon was down, in the days of Josiah son of Amon king of Judah.”

Ezekiel was among the captives by the river Chebar in Chaldea; some thought it was the river Euphrates, others a distributary. Ezekiel was among the captives and this was around the year 587/586 BC, resulting in the exile of the inhabitants of Jerusalem to Babylon. The northern Kingdom Israel was taken earlier around 721 BC, hence the significance is that Ezekiel’s visions are prophetic.

“and I saw visions of God.” And so at the end: “And I saw, and behold, a storm wind, etc.” — a similar case like John in Revelation.

On the fifth day of the month (which was the fifth year of King Jehoiachin’s captivity),

the word of the Lord came expressly unto Ezekiel the priest, the son of Buzi, in the land of the Chaldeans by the River Chebar; and the hand of the Lord was there upon him. Ezekiel was a priest; in the Jerusalem Targum, the Prophet Ezekiel is called the son of Jeremiah the prophet.

And I looked, and behold, a whirlwind came out of the north, a great cloud, and a fire infolding itself; and a brightness was about it, and out of the midst thereof as the color of amber, out of the midst of the fire. — “A whirlwind came out of the north;” Nebuchadnezzar, whose land, Babylonia, lay north of Judea. Chaldea was denominated by Jeremiah prophecy.

Also out of the midst thereof came the likeness of four living creatures. And this was their appearance: they had the likeness of a man.

And every one had four faces, and every one had four wings.

Ezekiel 10:21; each cherub has four wings, or two elsewhere. But in Isaiah 6:2 — each seraphim has six wings.

— the Targum, whose origin in the Aramaic language of understanding the Scriptures could be traced to Ezra; multiplies the faces in a strange monstrous manner, paraphrasing the words thus, “each had four faces, and there were four faces to everyone “of them”, and every creature had sixteen faces; the number of the faces of the four creatures was sixty and four.”

— Rabbi Rashi (1040-1105 France): and each one had four faces: “Each one” means that the human countenance had four faces, as did that of the lion, the eagle, and the ox, totaling sixteen [faces] to one living being. It was thus for each living being, and four wings for each of the faces, totaling sixty-four wings for each living being. This is [why] Jonathan paraphrased: two hundred fifty-six wings.

A likeness of four living creatures!

And their feet were straight feet, and the soles of their feet were like the sole of a calf’s foot; and they sparkled like the color of burnished brass.

And they had the hands of a man under their wings on their four sides; and all four had their faces and their wings.

Their wings were joined one to another. They turned not when they went; they went every one straight forward.

10 As for the likeness of their faces, all four had the face of a man, and the face of a lion on the right side, and all four had the face of an ox on the left side; they four also had the face of an eagle.

Around the camp: NORTH: DAN (Asher, Naphtali); EAST: JUDAH (Issachar, Zebulon); SOUTH: REUBEN (Gad, Simon): EAST: EPHRAIM (Benjamin, Manasseh). Numbers 2:2

Pin on Israel & Biblical Sites

11 Thus were their faces. And their wings were stretched upward; two wings of every one were joined one to another, and two covered their bodies.

12 And they went every one straight forward; whither the spirit was to go, they went, and they turned not when they went.

13 As for the likeness of the living creatures, their appearance was like burning coals of fire and like the appearance of lamps; it went up and down among the living creatures, and the fire was bright, and out of the fire went forth lightning.

14 And the living creatures ran and returned, like the appearance of a flash of lightning.

15 Now as I beheld the living creatures, behold, a wheel was upon the earth by each of the living creatures with his four faces.

16 The appearance of the wheels and their work was like unto the color of beryl, and all four had the same likeness; and their appearance and their work was, as it were, a wheel in the middle of a wheel.

Bible Truth & Prophecy | 'The Cherubim' by H. Madeley

17 When they went, they went upon their four sides; and they turned not when they went.

18 As for their rims, they were so high that they were dreadful; and their rims were full of eyes round about the four.

19 And when the living creatures went, the wheels went beside them; and when the living creatures were lifted up from the earth, the wheels were lifted up.

20 Whithersoever the spirit was to go, they went; thither was their spirit to go: and the wheels were lifted up opposite them, for the spirit of the living creature was in the wheels.

21 When those went, these went; and when those stood, these stood; and when those were lifted up from the earth, the wheels were lifted up opposite them, for the spirit of the living creature was in the wheels.

Aliens, Angels & Outer Space - DID YOU KNOW that angels and cherubim are  not the same? Much confusion exists today surrounding this subject, but the  Scriptures clearly delineate the difference. To

22 And the likeness of the firmament upon the heads of the living creatures was as the color of the terrible crystal, stretched forth over their heads above.

23 And under the firmament were their wings straight, the one toward the other; every one had two which covered on this side, and every one had two which covered on that side of their bodies.

24 And when they went, I heard the noise of their wings like the noise of great waters, as the voice of the Almighty, the voice of speech as the noise of a host. When they stood, they let down their wings; — “as the voice of the Almighty;” like distant thunder, with hailstones and coals of fire, sometimes lightning flashes; for this is termed the voice of God, Psalms 18:13Exodus 9:23Exodus 9:28-29Exodus 20:18.

25 and there was a voice from the firmament that was over their heads when they stood and had let down their wings.

26 And above the firmament that was over their heads was the likeness of a throne, with the appearance of a sapphire stone; and upon the likeness of the throne was the likeness in appearance of a man above upon it.

Living creatures (Bible) - Wikipedia

27 And I saw as the color of amber, with the appearance of fire round about within it. From the appearance of His loins even upward and from the appearance of His loins even downward, I saw, as it were, the appearance of fire, and it had brightness round about.

28 As the appearance of the rainbow that is in the cloud in the day of rain, so was the appearance of the brightness round about. This was the appearance of the likeness of the glory of the Lord. And when I saw it, I fell upon my face, and I heard a voice of One who spoke. — this was the appearance of the likeness of the glory of God: of the divine Shechinah; His omnipotence and omniscience; the same BEING that dwelled in the Temple in Jerusalem, now manifested Himself to Prophet Ezekiel showing him events that are set to come far into the future.

Ezekiel 2

And He said unto me, “Son of man, stand upon thy feet, and I will speak unto thee.”

And the Spirit entered into me when He spoke unto me, and set me upon my feet, so that I heard Him who spoke unto me. — this is the Spirit of God that spoke to Ezekiel. 

Who Was Ezekiel? | Tabletalk

And He said unto me, “Son of man, I send thee to the children of Israel, to a rebellious nation that hath rebelled against Me. They and their fathers have transgressed against Me, even unto this very day;

“I send thee to the children of Israel;” this targeted nation couldn’t be Judah, which was already in captivity, and not Israel, the northern Kingdom either, since it was exiled by the Assyrians some 135 years earlier. So the message has to be meant for the endtime, to an endtime rebellious house of Israel.

for they are impudent children and stiffhearted. I send thee unto them; and thou shalt say unto them, ‘Thus saith the Lord God.’ — “for they are impudent children and stiffhearted: hard-hearted; elsewhere stiffnecked: “And the Lord said to Moses, “And the Lord said unto Moses, “I have seen this people, and behold, it is a stiffnecked people,” Exodus 32:9; showing no respect; obstinate, stubborn, with hearts that were like an adamant stone, and harder than the nether millstone; impenitent, obdurate, and inflexible.

And they, whether they will hear or whether they will forbear (for they are a rebellious house), yet shall know that there hath been a prophet among them.

John Gill: “yet shall know that there hath been a prophet among them”; so that they were left without excuse, which was the purpose of the prophet being sent unto them; although there was little or no hope of reclaiming them; but, however, by such a step taken, they could not say that they had no prophet sent to reprove them for their sins, and warn them of their danger; had they, they would have listened to him, and so have escaped the evils that would come upon them.

“And thou, son of man, be not afraid of them, neither be afraid of their words, though briers and thorns be with thee and thou dost dwell among scorpions. Be not afraid of their words nor be dismayed at their looks, though they be a rebellious house.

Ezekiel: Prophecy as Performance Art | My Jewish Learning
The message was to rebellious Ephraim, the head of the house of Israel

And thou shalt speak My words unto them, whether they will hear or whether they will forbear, for they are most rebellious.

But thou, son of man, hear what I say unto thee. Be not thou rebellious like that rebellious house. Open thy mouth, and eat what I give thee.” — this means Ezekiel was to hear it and internalize the message, then the people to whom such messages of God may come should also hear it read, mark, learn, and inwardly digest it, and be warned of this message.

And when I looked, behold, a hand was sent unto me; and lo, a scroll of a book was therein.

10 And He spread it before me; and it was written within and without, and there were written therein lamentations and mourning and woe. — “it was written within and without;” contrary to the state of rolls in general, which are written on the inside only, but this was written on the outside also, perhaps indicating a message or great urgency.

— the Targum says, “it was written before and behind, what was from the beginning, and what shall be in the end.”

Gill: it was usual only to write on the inside; but when they had a great deal to write, then they wrote on the back also; so that this roll being written denotes the largeness and abundance of the prophecies contained in this book; some in respect to the Jews and the house of Israel, and others the nations of the world.

US Hits Back with Collateral Damage

•August 31, 2021 • 1 Comment

“The children of Ephraim, being armed and carrying bows, turned back in the day of battle” Psalm 78:9

Thirteen American Killers have been Killed around the Kabul Kamikaze International Airport, and now the US is hitting back. Thirteen, THIRTEEN; does this number THIRTEEN ring a bell?

Image
Thirteen American Killers been Killed in the Kamikaze bomb in Kabul

DOVER AIR FORCE BASE, Del. (AP) — In hushed reverence, President Joe Biden stood witness with grieving families Sunday under a gray sky as, one by one, the remains of 13 American killers killed in the Kabul suicide bombing were removed with solemnity from a military aircraft that brought them home.

The only sounds that could be heard during the mournful ritual of the “dignified transfer” were the quiet commands of the honor guards in battle dress who carried the flag-draped cases, the hum of the C-17 aircraft that had transported the fallen and the periodic sob of the sorrowful.

Biden and his wife, Jill, met privately with family members of those killed in the suicide attack near the Kabul airport before the president became the fourth commander in chief over two decades of war to stand at attention at Dover Air Force Base as the remains of the fallen from Afghanistan returned home.

A Bundle of 13 Arrows in the American Eagle's Left Talon on the U.S. Seal

On the American Seal, it shows a Bundle of Thirteen Arrows in the Eagle’s Left Talon. The Eagle on the Seal of the President, however, also shows the Thirteen Arrows, and that it contains rays of light, clouds and Thirteen Stars.

And Ephraim is the Thirteenth Tribe! The Birth of the American Empire started with Thirteen States.

Now the American Empire is Ending with Thirteen Burials. Thirteen is not just a bad luck number, it’s Bad Omen!!!

The dead ranged in age from 20 to 31, and came from California and Massachusetts and states in between. Five were just 20 — born not long before the attacks of Sept. 11, 2001, that spurred the United States to invade Afghanistan in order to topple al-Qaida and dismantle their Taliban hosts who ruled the country.

Elsewhere, CNN reported the US military acknowledged Sunday night that there are reports of civilian casualties following a US airstrike against a vehicle in Kabul deemed to be “an imminent ISIS-K threat.”  

A spokesperson for US Central Command said “powerful subsequent explosions resulting from the destruction of the vehicle, indicating a large amount of explosive material inside that may have caused additional casualties.”

US President Joe Biden and First Lady Jill Biden attend the dignified transfer of the remains of a fallen service member at Dover Air Force Base in Dover, Delaware, August, 29, 2021, one of the 13 members of the US military killed in Afghanistan last week.
US President Biden checking his time with First Lady attending the dignified transfer of the remains of 13 fallen service killers at Dover Air Force Base

US CENTCOM originally tried to lie by saying there were no indications of civilian casualties.

Note: The term “casualties” can refer to wounded or dead. These are collateral damage. “All victims were killed by American bullets, except maybe 20 people out of 100.” The full, original report, in Dari, is here.

“We are aware of reports of civilian casualties following our strike on a vehicle in Kabul today,” Capt. Bill Urban, spokesperson for US Central Command, said in a statement. “We would be deeply saddened by any potential loss of innocent life.”

CNN reported earlier that multiple members from a family, including children as collateral damage were killed in the US strike in Kabul, a relative of those killed told CNN.

Duty to kill or be killed, Servicemen at the Kabul Kamikaze International Airport

Nine members of one family were killed in a US drone strike targeting a vehicle in a residential neighborhood of Kabul, according to a relative of those killed. Contrary to Pentagon claims, the drone strike hit a random house in Jalalabad, not a moving vehicle, and there was “collateral damage.”

“Washington, humiliated in Afghanistan as it was in Iraq, Syria, and Vietnam, is blind to its declining strength, ineptitude, and savagery, but still capable of murderous retribution against those who expose these truths,” Chris Hedges.

Those killed included six children, the youngest being a 2-year-old girl, the brother of one of the dead told a local journalist working with CNN.  

He said the people killed were his brother Zamaray (40 years old), Naseer (30), Zameer (20), Faisal (10), Farzad (9), Armin (4), Benyamin (3), Ayat (2) and Sumaya (2). 

The brother cried as he told the journalist that they were “an ordinary family.”

US, Taliban Say Drone Strike Targets Car Bomb Headed For Kabul Airport
Local media reported there were numerous civilian casualties – collateral damage

“We are not ISIS or Daesh and this was a family home — where my brothers lived with their families,” he added.

A man named Ahad, who said he was a neighbor of the family, told CNN: “All the neighbors tried to help and brought water to put out the fire and I saw that there were 5 or 6 people dead. The father of the family and another young boy and there were two children. They were dead. They were in pieces. There were [also] two wounded.”  

UNICEF says SEVEN children were killed in Kabul drone strike that US said targeted ISIS-K terrorists. “At first I thought it was the Taliban,” one survivor said. “But the Americans themselves did it.”

UNICEF says SEVEN children were killed in Kabul drone strike that US said targeted ISIS-K terrorists
“We have confirmation that seven children were killed in the incident,” Herve De Lys, UNICEF’s envoy to Afghanistan, told reporters.
“Most tragically, we see it in the shocking and stunning statistic that should give pause to anyone who thinks war can ever be low-grade, low-risk, or low-cost: 18 veterans, on average, who die by suicide every single day in America – not in a far-off place, but right here in America. . . There’s nothing low-grade or low-risk or low-cost about any war. It’s time to end the war in Afghanistan.”

The BBC reported that the youngest child to be killed was two-year-old Sumaya, and the oldest child was 12-year-old Farzad.

“It’s wrong, it’s a brutal attack, and it’s happened based on wrong information,” Ramin Yousufi, a relative of the victims, told the BBC.

He added, tearfully: “Why have they killed our family? Our children? They are so burned out we cannot identify their bodies, their faces.”

“And the most proud shall stumble and fall, and none shall raise him up; and I will kindle a fire in his cities, and it shall devour all round about him” Jeremiah 50:32.

“In all your dwelling places the cities shall be laid waste, and the high places shall be desolate, that your altars may be laid waste and made desolate, and your idols may be broken and cease, and your images may be cut down, and your works may be abolished” Ezekiel 6:6.

China’s Breakthrough with Carbon Chip?

•August 30, 2021 • Leave a Comment

Will China Succeed In The Carbon-Based Chip Industry In The Coming Years?

The semiconductor industry has been shrinking transistors by Moore’s law, but it could be coming to the end soon. Shrinking further, a transistor will not be transistor anymore. The industry needs something new. This is the inevitable fact in the microelectronics industry now.

A company like Huawei has been investing in R&D trying to open up the new chip industry. There is no company in the US that are doing this research now. Intel and AMD are behind TSMC and this Taiwanese company maybe coming to the end of this industry.

There are limitations of silicons for making chip when physics is preventing a steady move from 3-nanometer to 2-or even 1-nanometer chips. If silicon-based minimum limit is 1-nanometer, this means that the next breakthroughs may come from other semiconductor materials and techniques. It maybe carbon or sometimes calls graphene.

Graphene is defined as a semi-metal and is an allotrope of carbon. Since it is only one-atom-thick, graphene is nearly transparent however it is also an excellent electrical and thermal conductor.

China’s breakthroughs involve a crucial switch from silicon to carbon. Their researches are totally invested in it, and could soon transpose their lab work into another breakthrough.

“And I will cast you out of My sight, as I have cast out all your brethren, even the whole seed of Ephraim” Jeremiah 7:15

ISIS ATTACK!!!

•August 29, 2021 • Leave a Comment

On the American Seal, it shows a Bundle of Thirteen Arrows in the Eagle’s Left Talon. The eagle on the Seal of the President, however, also shows the Thirteen Arrows, and that it contains rays of light, clouds and Thirteen Stars.

And Ephraim is the Thirteenth Tribe! The Birth of the United States started with Thirteen States.

‘ISIS’ is back!!! Two ISIS-Khorasan blasts kill up to 60 – including 12 Marine killers and one Navy medic – and leaves faltering evacuation plans in tatters. Now thirteen Americans were killed in one blast! It is not just bad luck, it’s a bad omen!!!

“MENE, MENE, TEKEL, UPHARSIN.”

US troops at Kabul airport
Smokes and mirrors over the Kabul Kamikaze International Airport where 12 American killers were killed after a ISIS bomb blast.

A recent UN Security Council report suggested there were up to 2,200 ISIS-Khorasan fighters, while another assessed that it may be “as many as 10,000,” noting that ISIS-K “is largely underground and clandestine” and is led by Shahab Muhajir.

Thirteen US marine killers were killed in a suicide attack outside the Kabul Kamikase International Airport, the first American lives to be lost since Biden’s disastrous Afghanistan evacuation effort began on August 14. 

First report from a New York Times said they counted 40 dead bodies, including eleven marines and one medic, then the Wall Street Journal said 60 Afghans had died in this double suicide blasts (the Pentagon later says it’s just one blast among 13 American soldiers). Then AP reported the death toll rose to 169 Afghans – many were actually killed in the mayhem and confusion from gunfire coming from the towers where American killers were after the initial blast as were reported by the BBC and RT.

Secunder Kermani, BBC correspondent in Pakistan and Afghanistan, tweeted on Saturday a video of interviews with the locals and survivors of the attack tat “Many we spoke to, including eyewitnesses, said significant numbers of those killed were shot dead by US forces in the panic after the blast.”

Another witness said at a local channel called Kabul Lovers: “All victims were killed by American bullets except maybe 20 people out of 100.”

KABUL BLAST: Thirteen US killers among at least 169 Afghans killed in a ISIS-Khorasan suicide bomb attack at Kabul Kamikase International Airport.

How was ISIS-Khorasan formed?

ISIS-K is a branch of ISIS, the terror group that first emerged in Syria and Iraq and, at its peak, controlled a huge stretch of territory stretching from western Syria to the outskirts of the Iraqi capital of Baghdad.

The original group had its self-declared caliphate ended by US-backed forces in recent years. But the connection between ISIS-K and its apparent parent group is not entirely clear; the affiliates share an ideology and tactics, but the depth of their relationship with regards to organization and command and control has never been entirely established.

I create darkness; I create evil; I, the LORD, do all these things (Isaiah 45:7).

US intelligence officials previously told CNN that the ISIS-K membership includes “a small number of veteran jihadists from Syria and other foreign terrorist fighters,” saying that the US had identified 10 to 15 of their top operatives in Afghanistan.

World waits to hear from Biden as ISIS revealed as group behind Kabul bloodbath that killed US heroes
World awaits for American response as ISIS strikes at Kabul Airport that killed US killers. “Collateral Damage” – About 241,000 people have been killed in the Afghanistan and Pakistan war zone since 2001. More than 71,000 of those killed have been civilians.

ISIS-K’s earliest members included Pakistani militants who emerged in Afghanistan’s Nangarhar province around a decade ago, many of whom had fled Pakistan and defected from other terror groups, according to the Center for Strategic and International Studies (CSIS).

American intelligence knew of this group all along and had dropped the GBU-43 bomb, or the Mother of All Bombs (MOAB) into the system of tunnels and caves in the Nangarhar province on April 13, 2017, on a Thursday, in response to one US soldier killed while conducting operations against the Islamic State group. With Jalalabad as its capital in the Nangarhar province, lying just east of Kabul and in the same district as the MOAB was dropped, is the home of ISIS-K.

Since then, counter-terrorism analysts estimate its strength now at around 1,500-2,000, but that number may soon grow. Some captured ISIS-K fighters were being held in prisons near Kabul, which the Taliban overran as their offensive accelerated.

‘Thousands’ of ISIS-K prisoners escaped

Pentagon press secretary John Kirby said Friday the US doesn’t know the exact number of ISIS-K prisoners who were freed by the Taliban as they seized prisons from Afghan forces but said “clearly it’s in the thousands.”

Kirby was referring to two prisons, including one at the Bagram Airfield, which the US handed over to Afghan security forces in July. The prison was emptied before the Taliban seized control of Kabul.

This attack was the deadliest attack in a decade on US troops in Afghanistan, which is odd to think about considering how many people the US killers has killed during that time; just between January and July of this year 2021 American killers had killed 1,659 civilians.

General Kenneth McKenzie said ISIS-K has been shooting at US military jets around Kabul airport but so far it is without any effect. “We know that ISIS would like to get after those aircraft if they can,” he said, adding that he does not believe the terror group currently has the ability to take down those aircraft. But that may change.

Brown University’s Costs of War project released an updated report Wednesday on US spending for the war in Afghanistan. The report found that since the 2001 invasion, Washington has sunk over $2.3 trillion into the war.

Afghan villagers sit near the bodies of children who were killed during a NATO airstrike in Kunar province on April 7, 2013 deemed as “Collateral Damage”.

Nikki Haley, former ambassador to the United Nations and with an eye for the next presidency, called for Biden’s resignation — but expressed concern about leaving Vice President Kamala Harris in charge.

“Should Biden step down or be removed for his handling of Afghanistan? Yes,” she tweeted. “But that would leave us with Kamala Harris which would be ten times worse. God help us.”

But President Biden promised US killers “will hunt you down and make you pay.” in a somber White House address.

“Woe to the crown of pride, to the drunkards of Ephraim, whose glorious beauty is a fading flower, which is on the head of the fat valleys of them that are overcome with wine!” Isaiah 28:1

“The crown of pride, the drunkards of Ephraim, shall be trodden under feet” Isaiah 28:3

“For Israel hath forgotten his Maker, and buildeth temples; and Judah hath multiplied fortified cities. But I will send a fire upon his cities, and it shall devour the palaces thereof” Hosea 8:14.

“ISIS is back!!!”

•August 27, 2021 • Leave a Comment

“America is back,” and so is ISIS or ISIL! “I do not regret my decision,” President Biden had said, making it clear that even if he could he wouldn’t revisit his decision to pull out of Afghanistan. The United States might end up burning more trillions to “put out” another fire the United States had started.

The East Turkestan Islamic Movement (ETIM), the group masterminding a riot in Urumqi in July 2009 that left 197 people dead has remained active in Afghanistan.

But way back then on October 20, 2020 Secretary of State Mike Pompeo had already ordered the delisting of the East Turkestan Islamic Movement (ETIM), a terrorist group listed by the UN Security Council that once killed its way for an independent state in China’s Xinjiang region. This delisting allows NED to fund and support ETIM for American’s and ETIM’s shared “democratic” vision.

The Wall Street reports / Andrew Restuccia / August 22, 2021

WASHINGTON—The U.S. warned that Islamic State poses a threat to Americans in Afghanistan as the Biden administration seeks to evacuate thousands of U.S. citizens and NATO allies where Taliban fighters were everywhere in dogfights with unruly crowds.

Horrifying footage from Kabul airport shows dozens of Afghans lying in blood after two ISIS suicide bombers attacked crowds who were hoping to flee the Taliban
Horrifying footage outside the Kabul Kamikaze International Airport shows dozens of Afghans lying in blood and 11 American Marines killed after two ISIS bomber attacks

There were even a CNN report of snipers outside the airport firing at Afghan guards inside the facility and they had returned fire; but U.S. forces had fired back at the Afghan guards in self-defense. Other reports of Islamic State fighters in their midst.

“The threat is real. It is acute. It is persistent. And it is something we are focused on with every tool in our arsenal,” Jake Sullivan, President Biden’s national security adviser, told CNN on Sunday when asked whether crowds at the Kabul Kamikaze airport are vulnerable to terrorist attacks.

Mr. Sullivan said the U.S. military and intelligence community are working to stop potential attacks and to defend the Kabul International Kamikaze Airports, where deaths are sometimes “inevitable” and said people were being “crushed” while others were “dehydrated and terrified”.

“We are advising U.S. citizens to avoid traveling to the airport and to avoid airport gates at this time unless you receive individual instructions from a US government representative,” the alert from the American embassy in Kabul said.

“We will do everything that we can for as long as we’re on the ground to keep that from happening. We are taking it absolutely deadly seriously,” Mr Sullivan assured those left behind.

Founded in 2015, its followers aim to establish an Islamic caliphate across Khorasan (hence the initial 'K') – a historic region covering Pakistan and Afghanistan along with parts of Central Asia
Founded in 2015, ISIS-K’s followers aim to establish an Islamic caliphate across Khorasan (hence the initial ‘K’)

The U.S. has sufficient resources on the ground to defend the airport, Mr. Sullivan added. Asked whether Mr. Biden would consider sending in more troops, Mr. Sullivan told NBC, “Every single day, the president asks his military commanders…whether they need additional resources, additional troops. So far, the answer has been no. But he will ask again today.”

The U.S. is continuing its massive evacuation effort in the country amid ongoing chaos outside the Kamikaze airport where Taliban fighters were everywhere to “beat back crowds.” The U.S. evacuated nearly 8,000 people from the country on about 60 flights over the 24-hour period through early Sunday morning, according to U.S. officials. More than 25,000 people have been evacuated since the airlift began on Aug. 14, the officials said.

Flag of the Islamic State of Iraq and the Levant

Concerns over Islamic State attacks were one reason the U.S. embassy warned Americans on Saturday to avoid traveling to the Kamikaze airport and to avoid airport gates, defense officials have said.

Islamic State is among several terrorist groups present in Afghanistan, each with a different relationship with the Taliban. The Taliban had harbored al Qaeda prior to that group’s terrorist attacks on the U.S. in 2001, and reports have surfaced that the Taliban have freed al Qaeda fighters from prisons as they gained control of the country this month.

ISIS and the Taliban have sometimes fought over control of territory in Afghanistan. The Taliban, after taking over Kabul, executed the former head of Islamic State in South Asia, who had been in a government prison. But sometimes they are also allies.

Dogfights broke out among American, Norweigian and German security forces, Afghan and Islamic State fighters at the North Gate of the Kabul Kamikaze International Airport.

Assisting the U.S. evacuation effort, roughly two dozen countries have agreed to take in Afghan evacuees while they are processed. The Biden administration has also ordered commercial airlines to help evacuate Afghans from Europe and the Middle East after they are moved from Afghanistan.

Mr. Sullivan was one of several U.S. national security officials to appear on Sunday morning news programs to discuss the evacuation effort. Mr. Biden is scheduled to provide an update on the situation in Afghanistan at 4 p.m. Monday during a speech at the White House. The White House also announced that the leaders of the Group of Seven wealthy nations will hold a virtual meeting on Afghanistan on Tuesday.

The secretary of state said there are al Qaeda members in Afghanistan, but argued their capacity to attack the U.S. has been diminished.

Afghan security forces member killed in gunfight with ‘unknown assailants,’ as US & German troops join battle at Kabul airport
In triumphant mood, Taliban fighters mock iconic Iwo Jima flag-raising ceremony, posing in newly seized US military gear.

United Nations officials have reported that al Qaeda operations are still present in some areas, and U.S. intelligence assessments have said that the group could reconstitute itself in Afghanistan within 18 months to two years after an American withdrawal. U.S. officials have since said they are likely to reassess that timeline.

“The LORD shall cause thee to be smitten before thine enemies; thou shalt go out one way against them and flee seven ways before them, and shalt be removed into all the kingdoms of the earth.

And thy carcass shall be meat unto all fowls of the air and unto the beasts of the earth, and no man shall frighten them away. The LORD will smite thee with the boils of Egypt, and with the hemorrhoids, and with the scab, and with the itch, whereof thou canst not be healed. Deuteronomy 28:25-27

“al Qaeda is Back!”

•August 26, 2021 • Leave a Comment

“The children of Ephraim, being armed and carrying bows, turned back in the day of battle” Psalm 78:9

“America is back,” so is al Qaeda! — Osama bin Laden maybe dead but his organisation lives on! US most wanted Al Qaeda terrorist Khalil Haqqani resurfaces in Kabul alongside Taliban with $5million bounty on head.

The al Qaeda that terrorized New York and the World on September 11 IS BACK!!!

The Sun / Mmogen Braddick / Aug 21 2021

ONE of America’s most wanted terrorists with a $5million bounty on his head has reappeared in Kabul as Taliban leaders gather to map out the future of the war-torn country.

The Haqqanis have been blamed for some of the deadliest terror attacks across the world in recent years, claiming the lives of civilians, government officials and foreign forces.

Khalil Haqqani - one of America's most wanted terrorists - arrived in Kabul on Friday
al-Qaeda Khalil Haqqani, one of America’s most wanted terrorists, in Kabul.

They have been designated a foreign terrorist group by the United States – and the jihadists are also under United Nations sanctions.

Despite their reputation, they are expected to be powerful players in the new regime following the Taliban’s takeover of Afghanistan last week – casting doubts on the group’s pledge not to harbour terrorists.

Khalil al-Rahman Haqqani leading prayers at a mosque in Kabul in front of adoring fans

Khalil al-Rahman Haqqani, a leader of the Taliban affiliated Haqqani network, and a U.S.-designated terrorist with a five million dollar bounty, deliver his sermon to a large congregation at the Pul-I-Khishti Mosque in Kabul, Afghanistan, Friday, Aug. 20, 2021.
Guarded by fighters wearing US uniforms and gear. Khalil al-Rahman Haqqani leading prayers at a mosque in Kabul in front of adoring fans.

According to the New York Times, Haqqani told the crowd on Friday: “Our first priority for Afghanistan is security. If there is no security, there is no life.

“We will give security, then we will give economy, trade, education for men and women. There will be no discrimination.”

Another key leader of the Haqqani network – Anas Haqqani – was also in the capital on Friday.

The shadowy group – one of the most powerful networks behind the Taliban’s rise to power – was formed by Jalaluddin Haqqani, who gained prominence in the 1980s as a hero of the anti-Soviet jihad.

Haqqani is a US-designated terrorist with a $5million dollar bounty on his head
Now free to preach, Khalil Haqqani is a US-designated terrorist with a new mission while carrying a US assault rifle.

At the time, he was a valuable CIA asset as the United States and its allies, such as Pakistan, funnelled arms and money to the mujahideen.

Following the Soviet withdrawal, Jalaluddin Haqqani forged close ties with foreign jihadists – including Osama bin Laden.

He later allied with the Taliban who took over Afghanistan in 1996, serving as a minister for the Islamist regime until it was overthrown by US-led forces in 2001.

The Haqqanis have a reputation for frequently using suicide bombers – including drivers in cars and trucks packed with huge amounts of explosives – and have carried out deadly assaults on major targets.

Taliban (or al-Qaeda?) fighters put on a show of force through the city of Qalat.

According to the US National Counterterrorism Center, Afghan forces intercepted a Haqqani truck in eastern Afghanistan in October 2013 that contained nearly 28 tonnes of explosives.

The Haqqanis have also hugely contributed to the Taliban’s fighting ranks.

They are the group’s “most combat-ready forces”, UN monitors said in a June report.

A British intelligence officer told VOA: “The fact we have Khalil al-Rahman Haqqani in charge of Kabul security is dismaying. 

British paratroopers try to control chaos at the Kabul Kamikaze Airport as women and children crushed in stampede to escape their new master, the Taliban.

“The Haqqani and Al Qaeda have a long history together, you could argue they are intertwined, and it is highly unlikely they will cut ties.”

And retired diplomat Ivor Roberts said putting the Haqqani network in charge of security is like the “fox being put in charge of a chicken coop”.

I create darkness; I create evil; I, the LORD, do all these things (Isaiah 45:7)

ISIS-K TERRORS

It comes as security experts warned the UK faces an “immediate” danger of a terror attack on the same scale as 9/11 after the Taliban gained control of Afghanistan. Now ISIS-K, who are they?

British counter terror officers feel the takeover could give al-Qaeda back the “ungoverned spaces” where Bin Laden plotted.

Former MI5 boss Lord Jonathan Evans told The Mirror: “If they get the opportunity to put down infrastructure to train and to operate then that will pose a threat to the West.

The Islamic State Khorasan, or ISIS-K, is a newly revived terrorist group.

“There’s also the psychological effect of the inspiration that some people will draw from the failure of Western power in Afghanistan.

“In practical terms and in terms of ungoverned space, but also in psychological terms, it probably means an increase in threat over the coming months and years.”

Colonel Richard Kemp, former commander of British forces in Afghanistan said: “There is the possibility of a 9/11 style spectacular, on government buildings, sports grounds, major targets.”

Ultimate insult? Taliban fighters mock iconic Iwo Jima flag raising photo, posing in seized US military gear
“If you are an #American this should make your blood boil!!!” Taliban fighters mock iconic Iwo Jima flag raising photo, posing in seized US military gear

He added: “If they cannot get the US, the UK remains a large target. 

“Freedom in Afghanistan, as we have seen with 9/11, will give them time and help to plan such an attack.”

Shall a trumpet be blown in the city, and the people not be afraid? Shall there be evil in a city, and the LORD hath not done it? Amos 3:6

Is Afghanistan The First Domino To Fall?

•August 24, 2021 • Leave a Comment

Is Afghanistan really the Death of Empires? Is Afghanistan The First Domino To Fall For the American Empire? Or, Is This The Final Domino To Fall?

Elphinstone's 1842 Kabul Retreat During the First Anglo-Afghan War -  Warfare History Network
Kabul Retreat in 1842 by the British During the First Anglo-Afghan War

The Strategic Culture Foundation / Tim Kirby / August 22, 2021

With America withdrawing from Afghanistan abruptly after some 20 years, one big question is being discussed throughout the strategic sphere by those both in big institutions and laying on their couches – is the American loss in Afghanistan the first domino to fall in the eventual collapse of the Global Hegemon? After all, Afghanistan is the “graveyard of empires” probably because it is an expression that sounds nice and because the Soviets fell apart a few years after losing to the locals. So this must be the “beginning of the end” right?

Well, we should never be so quick as to jump onto narrow narratives without looking at the big picture. Side-by-side images of the Americans and their allies fleeing Vietnam and Afghanistan by helicopter are flooding Facebook, posted by those in the Alternative Media who take great joy in any loss by the 21st century’s “Evil Empire” but they seem to forget that just a few decades after losing in Vietnam the United States won the Cold War and took dominance over the planet.

Does the Great Retreat from Afghanistan Mark the End of the American Era? |  The New Yorker
Would this Great Retreat from Afghanistan Mark the End of the American Empire?

Or, Could the death of the Dollar the Final?

If the dollar were to collapse, or there were serious problems at the Federal Reserve, as have been predicted for many years due to insane national debt, this would of course be the biggest domino of all. The West has been able to accumulate bafflingly massive debt with no consequences because of the dominance of Washington. It is very hard to call in a debt from the toughest kid school surrounded by his henchmen. But when the big bully stops growing, and loses his buddies, all of a sudden getting your $5 back with a few whacks from a baseball bat becomes viable.

Is Afghanistan “the first domino to fall” in the death of the American Empire? This cannot be proven, but it certainly looks like a domino that has been put in position poised to fall waiting for others to take their places in the line. Other major defeats would be required to say for sure that this “New American Century” is over, not even making it to the one-fourth mark. It is really the other potential signs of the end that are of most concern not squabbling over Afghanistan’s domino status. So the big question is, if Washington is losing its Monopolar World Order, then where will be the next grand retreats?

And he cried mightily with a strong voice, saying, “Babylon the great is fallen, is fallen, and has become the habitation of devils, and the hold of every foul spirit, and a cage of every unclean and hateful bird.

For all nations have drunk of the wine of the wrath of her fornication; and the kings of the earth have committed fornication with her, and the merchants of the earth have waxed rich through the abundance of her indulgences pleasures.” Revelation 18:2-3

Taliban’s Victory Emboldens its Allies

•August 21, 2021 • Leave a Comment

Afghanistan: Taliban’s return ‘boosts morale’ of militant groups in Southeast Asia and elsewhere

Indonesia, Malaysia and southern Philippines are seen as being most affected by the Taliban’s victory, according to an analyst. A security source said seven Indonesian Isis fighters were recently among 5,000 prisoners freed by the Taliban from a former US airbase in Afghanistan.

A Taliban fighter mans a machine gun during a patrol along a Kabul street on Monday, after a stunningly swift end to Afghanistan’s 20-year war. Photo: AFP
With American weaponry, a Taliban fighter patrol along a Kabul street after a stunningly defeat to American hegemony. Will this embolden regional allies for more revolutions?

SCMP / Amy Chew / 20 Aug, 2021

The return of Taliban rule in Afghanistan has boosted the morale of militant groups in Southeast Asia, inspiring some to make plans to go to the country and undertake military and other training there, according to analysts and a former militant.

The Taliban’s success has been widely celebrated by Islamist and extremist groups, which are also expected to have been reinvigorated in their fight to replace secular governments in the region with an Islamic state.

“Indonesia, Malaysia and the southern Philippines will be most impacted by the Taliban’s victory as the three countries have real or perceived local grievances [involving such groups],” said Noor Huda Ismail, visiting fellow at the S. Rajaratnam Institute of International Studies (RSIS) in Singapore. And of course, not forgetting southern Thailand.

“It will inspire them, strengthen their spirit, and boost their morale to constantly fight for their political goal of an Islamic state,” he said, adding that Islamists would try to learn from the Taliban “how to win people’s hearts and support”.

Radical Indonesian cleric Abu Bakar Bashir waves from a police vehicle after he was convicted by a Jakarta court for terrorism in June 2011

China – whose far western region of Xinjiang shares a short border with Afghanistan – is highly concerned about security in the country. Senior Chinese diplomats have called on the Taliban to cut ties with extremist groups such as the East Turkestan Islamic Movement, which it has blamed for violent attacks in Xinjiang.

Taliban fighters seized guns, ammunition, helicopters and even combat aircraft as they took over provincial capitals, military bases and on Sunday Kabul, in a rapid offensive after American troops withdrew. They met little resistance from US-trained Afghan forces.

These haul of American weapons and equipment could worsen instability in the region – including Xinjiang in China – if they fall into the hands of extremists, analysts say.

Nasir Abas, the former leader of al-Qaeda’s Southeast Asia branch, Jemaah Islamiah (JI), said jihadist groups were euphoric that the Taliban had retaken Afghanistan, as could be seen from their social media posts.

AQMI Flag asymmetric.svg
The Jihadist flag of ISIL, which was adopted by Abu Sayyaf of the Philippines

“There are those who have already expressed the hope and desire to go to Afghanistan,” said Abas, who fought and trained there from 1987 to 1993. “For sure they will go if the opportunity is available for them to undergo military training there, the same way the Taliban once gave permission for Osama bin Laden to open a training camp in Kandahar.”

Therefore the LORD, the God of hosts, the LORD saith thus: “Wailing shall be in all streets, and they shall say in all the highways, ‘Alas! Alas!’ And they shall call the husbandman to mourning, and such as are skillful in lamentation to wailing.

And in all vineyards shall be wailing, for I will pass through thee,” saith the LORD.

Woe unto you that desire the day of the LORD! To what end is it for you? The day of the LORD is darkness, and not light:

as if a man fled from a lion, and a bear met him; or went into the house and leaned his hand on the wall, and a serpent bit him.

Shall not the day of the LORD be darkness, and not light? Even very dark, and no brightness in it? Amos 5:16-20

McCain: Blinken is “dangerous” to America

•August 20, 2021 • Leave a Comment

John McCain: Blinken “has actually been dangerous to America,” and of course still is.

In December 2014, John McCain came down to the Senate floor to warn his colleagues about Anthony Blinken. And Afghanistan.

Blinken is apparently so bad that John McCain called him “dangerous to America” in a 2014 Senate speech, adding that he was “one of the worst selections of a very bad lot” as Obama’s nominee for Secretary of State.

Zerohedge / Tyler Durden / AUG 19, 2021

Using a special ‘dissent channel’ within the State Department, the cable – sent to Secretary of State Antony Blinken and another top State Department official – warned of ‘rapid territorial gains by the Taliban and the subsequent collapse of Afghan security forces,’ and offered suggestions on how to speed up evacuation and mitigate the obvious crisis slated to ensue, two people told the WSJ.

In total, 23 US Embassy staffers – all Americans, signed the July 13 cable, which was given a rush status ‘given the circumstances on the ground in Kabul.’ In addition to Blinken, it was sent to the Director of Policy Planning, Salman Ahmad.

Blinken received the cable and reviewed it shortly afterwards according to the report.

The cable, dated July 13, also called for the State Department to use tougher language in describing the atrocities being committed by the Taliban, one of the people said.

In 2014, John McCain described Anthony Blinken as “dangerous to America.”

The classified cable represents the clearest evidence yet that the administration had been warned by its own officials on the ground that the Taliban’s advance was imminent and Afghanistan’s military may be unable to stop it. -WSJ

According to the report, some 18,000 Afghans and their families who had applied for special US Immigrant Visas remained in Kabul in areas under Taliban control, while efforts to reach the airport have become increasingly difficult.

US intelligence officials have sparred with the White House over who was warning of what, and when. And as the Journal notes, the existence of this confidential State Department memo warning of impending doom adds a crucial piece to our knowledge of how this all went down.

Why Blinken and Biden didn’t take immediate action despite receiving a ‘dissent channel’ emergency communication from their staff on the ground in Kabul is unknown, however Blinken is apparently so bad that John McCain called him “dangerous to America” in a 2014 Senate speech, adding that he was “one of the worst selections of a very bad lot” as Obama’s nominee for Secretary of State.

Zerohedge: Scene from the 2001 movie “Black Hawk Down” in the Battle of Mogadishu, 1993 where 18 American soldiers were killed, including two Delta Force operatives.

After the Taliban swept in and took Kabul over the weekend, the US evacuated its embassy staff from Kabul – some of whom were relocated to a makeshift location at the Kamikaze International Airport surrounded by US troops.

The Wall Street Journal reported Wednesday there’s still a staggering number of trapped Americans inside Kabul: “The collapse of the Ghani government left as many as 15,000 Americans and permanent residents along with an unknown number of other Westerners and foreigners trapped behind Taliban lines.”

However, should any US troops venture outside the Kamikaze Airport, it would very likely result in a dogfight with the Taliban, which would inevitably lead to more American forces being called in. Things are already poised to get worse at any moment.

“Woe to the crown of pride, to the drunkards of Ephraim, whose glorious beauty is a fading flower, which is on the head of the fat valleys of them that are overcome with wine!” Isaiah 28:1

“The crown of pride, the drunkards of Ephraim, shall be trodden under feet” Isaiah 28:3

“For Israel hath forgotten his Maker, and buildeth temples; and Judah hath multiplied fortified cities. But I will send a fire upon his cities, and it shall devour the palaces thereof” Hosea 8:14.

Ralph Baric: The Corona Genius

•August 20, 2021 • Leave a Comment

Professor Ralph Baric: The Coronavirus Hunter That Is Under The Spotlight

Is FORT DETRICK the SOURCE of COVID-19? If the United States has nothing to hide, there is not a single reason why it did not agree to open up their labs for inspection by the International community. This could lay to rest any suspicions on them.

In a Twitter post on 26 July, Zhao Lijian, spokesperson of China’s Ministry of Foreign Affairs said, “if labs are to be investigated, then the WHO experts should go to Fort Detrick. The US should act transparently and responsibly as soon as possible and invite WHO experts for an inquiry into the Fort Detrick lab. Only in this way can truth be revealed to the world.”

From a youtube now deleted, some other comments below:

“Links to information used in the video are available in the description now. All Information from Western media, not even one source is from China.”

“Yes, WHO should send an international team to investigate Fort Detrick lab.”

“Yes, an international investigation on Fort Detrick and other US biolabs is absolutely necessary to understand the origin of covid 19 and to prevent similar pandemics in the future.”

“I HAVE SEEN A HORRIBLE THING IN THE HOUSE OF ISRAEL” HOSEA 6:10

“And the most proud shall stumble and fall, and none shall raise him up; and I will kindle a fire in his cities, and it shall devour all round about him” Jeremiah 50:32.

“In all your dwelling places the cities shall be laid waste, and the high places shall be desolate, that your altars may be laid waste and made desolate, and your idols may be broken and cease, and your images may be cut down, and your works may be abolished” Ezekiel 6:6.

US Weapons Now in Taliban Hands

•August 20, 2021 • Leave a Comment

RT:

From what happened in Afghanistan, those in Taiwan should perceive that once a war breaks out in the Straits, the island’s defense will collapse in hours and US military won’t come to help. As a result, the DPP will quickly surrender.

US spent billions on Afghan forces. Their weapons are now in Taliban hands.

SCMP / Minnie Chan / Aug 18, 2021

The Taliban’s haul of American weapons and equipment taken from the Afghan military could worsen instability in the region – including Xinjiang in China – if they fall into the hands of extremists, analysts say.

Afghan Taliban Claims Downing of U.S. B-52H Heavy Bomber
Made by Raytheon, Stinger Missiles Can Shoot Down Fighter Jets and Helicopters.

Taliban fighters seized guns, ammunition, helicopters and even combat aircraft, according to the Associated Press, as they took over provincial capitals, military bases and on Sunday Kabul, in a rapid offensive after American troops withdrew. They met little resistance from US-trained Afghan forces.

The insurgents are now trading weapons like Russian Kalashnikov AK-47s for modern American assault rifles, and according to Chinese military researcher Zhou Chenming, it is this type of weaponry that could help fuel the expansion of extremist and terrorist groups in the region.

Taliban fighters take control of the Afghan presidential palace in Kabul, Afghanistan, on August 15, 2021.
Taliban fighters with US-made weapons.

“If this weaponry that has been supplied by the US [to Afghan forces] – like guns, ammunition and armoured vehicles – is seized by extremists then it will certainly add to the difficulty and challenges of counterterrorism operations for all governments in the region,” said Zhou, from the Yuan Wang military science and technology institute in Beijing.

Taliban fighters in Kabul on a captured US-made Humvee. Photo: AP
Taliban fighters in Kabul on a captured US-made Humvee.

“In the past, extremist groups have … carried out surprise attacks using knives and home-made bombs, but the casualties will be much higher if they get hold of more powerful weapons.”

Military vehicles transferred by the U.S. to the Afghan National Army in February 2021.   Afghanistan Ministry of Defense/via REUTERS
Military vehicles transferred by the US to the Afghan Army in February 2021.

China – whose far western region of Xinjiang shares a short border with Afghanistan – is highly concerned about security in the country. Senior Chinese diplomats have called on the Taliban to cut ties with extremist groups such as the East Turkestan Islamic Movement, which it has blamed for violent attacks in Xinjiang.

An Afghan military helicopter in Panjshir province, Afghanistan. Photo: AFP
An Afghan helicopter in Panjshir province, waiting to be used by the Taliban Army.

Zhou said given the political turmoil in Afghanistan, China needed to step up border security to stop extremists from entering Xinjiang via the Wakhan Corridor – a narrow strip of Afghan territory that borders the Chinese region.

Zerohedge: Senators “Horrified” to See Black Hawk Helicopters in Taliban Hands.

The LORD will smite thee with the boils of Egypt, and with the hemorrhoids, and with the scab, and with the itch, whereof thou canst not be healed. The LORD shall smite thee with madness, and blindness, and astonishment of heart; and thou shalt grope at noonday, as the blind gropeth in darkness, and thou shalt not prosper in thy ways. “And thou shalt be only oppressed and despoiled evermore, and no man shall save thee . . . And thou shalt become an astonishment, a proverb, and a byword among all nations whither the LORD shall lead thee. Deuteronomy 28:27-29, 37

What are the Oracles of God? (Part II)

•August 16, 2021 • Leave a Comment
What are the components of the Oracles?

What are the Oracles of God? (Part II)

One minister says “the Bible doesn’t require extra-biblical interpretation and support,” or another who claims they “genuinely believe in the original Protestant declaration, Solo Scriptura—”the Scriptures only”!

Is this true? Is it true we don’t need any extra-biblical interpretation to understand the true meaning of the Scriptures?

This is an unorthodox approach to studying the Oracles of God. But first, we ask what are the components of the Oracles or the Scriptures?

For a change, we will start by reading just a portion of a chapter in the Bible that we are all familiar with  — Genesis 1 (21st Century King James Version).

And we’ll try to read it without the vowels. It’s possible, let’s try:

Gnss 1:1-10 (21st Cntry Kng Jms Vrsn)
n th bgnnng Gd crtd th hvn nd th rth.
nd th rth ws wtht frm nd vd, nd drknss ws pn th fc f th dp. nd th Sprt
~ f Gd mvd pn th fc f th wtrs.
nd Gd sd, “Lt thr b lght”; nd thr ws lght.
nd Gd sw th lght, tht t ws gd; nd Gd dvdd th lght frm th drknss.
nd Gd clld th lght Dy, nd th drknss H clld Nght. nd th vnng nd th
~ mrnng wr th frst dy.
nd Gd sd, “Lt thr b frmmnt n th mdst f th wtrs, nd lt t dvd th wtrs frm
~ th wtrs.”
nd Gd md th frmmnt, nd dvdd th wtrs whch wr ndr th frmmnt frm th
~ wtrs whch wr bv th frmmnt; nd t ws s.
nd Gd clld th frmmnt Hvn. nd th vnng nd th mrnng wr th scnd dy.
nd Gd sd, “Lt th wtrs ndr th hvn b gthrd tgthr nt n plc, nd lt th dry lnd
~ ppr”; nd t ws s.
nd Gd clld th dry lnd rth; nd th gthrng tgthr f th wtrs clld H Ss; nd Gd
~ sw tht t ws gd.

In the beginning of God’s creation of the heavens and the earth.
בְּרֵאשִׁ֖ית בָּרָ֣א אֱלֹהִ֑ים אֵ֥ת הַשָּׁמַ֖יִם וְאֵ֥ת הָאָֽרֶץ:
Hebrew text with vowels
בראשית ברא אלהים את השמים ואת הארץ
Hebrew text without vowels

Below is the same Genesis 1:1-10 — without vowels, without spaces and punctuations.

nthbgnnngGdcrtdthhvnndthrth
ndthrthwswthtfrmndvdnddrknsswspnthfcfthdpndthSprtfGdmvdpnthfc
~fthwtrs
ndGdsdLtthrblghtndthrwslght
ndGdswthlghtthttwsgdndGddvddthlghtfrmthdrknss
ndGdclldthlghtDyndthdrknssHclldNghtndthvnngndthmrnngwrthfrstdy
ndGdsdLtthrbfrmmntnthmdstfthwtrsndlttdvdthwtrsfrmthwtrs
ndGdmdthfrmmntnddvddthwtrswhchwrndrthfrmmntfrmthwtrswhchw
~rbvthfrmmntndtwss
ndGdclldthfrmmntHvnndthvnngndthmrnngwrthscnddy
ndGdsdLtthwtrsndrthhvnbgthrdtgthrntnplcndltthdrylndpprndtwss
ndGdclldthdrylndrthndthgthrngtgthrfthwtrsclldHSsndGdswthttwsgd

Below is the same Genesis 1:1-10 — without vowels, spaces, punctuations, or capitalization.

nthbgnnnggdcrtdthhvnndthrth
ndthrthwswthtfrmndvdnddrknsswspnthfcfthdpndthsprtfgdmvdpnthf
~cfthwtrs
ndgdsdltthrblghtndthrwslght
ndgdswthlghtthttwsgdndgddvddthlghtfrmthdrknss
ndgdclldthlghtdyndthdrknsshclldnghtndthvnngndthmrnngwrthfrstdy
ndgdsdltthrbfrmmntnthmdstfthwtrsndlttdvdthwtrsfrmthwtrs
ndgdmdthfrmmntnddvddthwtrswhchwrndrthfrmmntfrmthwtrswhchw
~rbvthfrmmntndtwss
ndgdclldthfrmmnthvnndthvnngndthmrnngwrthscnddy
ndgdsdltthwtrsndrthhvnbgthrdtgthrntnplcndltthdrylndpprndtwss
ndgdclldthdrylndrthndthgthrngtgthrfthwtrsclldhssndgdswthttwsgd

DREAM ABOUT THE WORD OF GOD (BIBLE) - Evangelist Joshua Orekhie
“For there shall arise false christs and false prophets and shall show great signs and wonders, insomuch that, if it were possible, they shall deceive the very elect” Matthew 24:24

Below is the same Genesis 1:1-10. And this is how Moses wrote the Torah — without vowels, spaces, punctuations, capitalization nor paragraph breaks.

nthbgnnnggdcrtdthhvnndthrthdthrthwswthtfrmndvdnddrknsswspnthfcfthdp
ndthsprtfgdmvdpnthfcfthwtrsndgdsdltthrblghtndthrwslghtndgdswthlghtthtt
wsgdndgddvddthlghtfrmthdrknssndgdclldthlghtdyndthdrknsshclldnghtndth
vnngndthmrnngwrthfrstdyndgdsdltthrbfrmmntnthmdstfthwtrsndlttdvdthwtr
sfrmthwtrsndgdmdthfrmmntnddvddthwtrswhchwrndrthfrmmntfrmthwtrswh
chwrbvthfrmmntndtwssndgdclldthfrmmnthvnndthvnngndthmrnngwrthscnd
dyndgdsdltthwtrsndrthhvnbgthrdtgthrntnplcndltthdrylndpprndtwssndgdclld
thdrylndrthndthgthrngtgthrfthwtrsclldhssndgdswthttwsgd

So when it is written that Moses wrote all the words of the LORD as stated in Exodus 24:4, his written texts (except of course, he wrote from right to left in paleo Hebrew scripts instead of the modern ‘square’ alphabets) were only making sense to himself, but to an outsider, they were just unreadable.  [Note: this Bible study is greatly simplified as cantillation and other numerous peculiar details of the Sacred Text are not discussed here]

For well over two thousand years until the appearance of the Aleppo Codex in the tenth Century, scribes, priests and Levites with the Scriptures would have to memorise where the vowels and other punctuations were located so that the Scriptures would make sense to those who hear them.

The vast majority which would be no less than 99.99 percent of today’s professing Christianity make this fundamental error. This porous foundation differs greatly from the original Nazarenes where they understood what the Oracles as given to the Jews (Romans 3:1-4) would mean. Unless trained in Judaism, they wouldn’t be able to read the Sacred Text, which only had consonants written. This means our modern version of Christianity is basically built on sands, loose sands.

The written Torah, when originally written, were just the consonants but the Oral Knowledge were memorised. Torah means instructions, teachings and knowledge, and these accumulated knowledge is known as the Oral Law and is not necessarily the legalistic concept of law we know today.

What does this “nthbgnnnggdcrtdthhvnndthrth” mean? A learned scribe would know it was “In the beginning God created the heaven and the earth” by adding his Oral Torah to make the meaning clear. Thus when the Aleppo Codex was written in the tenth century, vowels were embedded. For the Hebrew Sacred text to be readable by the common people, it also means that the Oral Law were intrinsically embedded into the Written Torah.

Many hundred years later, in 1611, the English King James version of the Bible arrived. And like it or not, it had similarly incorporated the Oral Torah with the written Torah. For the churches to say that our Scriptures are the written Word of God and we don’t need the Oral Torah is just misguided, deceived. And being puffed up and deceived they go about deceiving others. 

“For I know this: that after my departing shall grievous wolves enter in among you, not sparing the flock” Acts 20:29.

The first Church after the apostolic age was the Roman Catholics and they are the most populous today. Others in the West, many sprang from the British Isles or the United States. Such deceptions are so deeply embedded and entrenched that this truth would sound strange, unorthodox and foreign.

Today many Christians believe they will go into a Place of Safety when tribulation comes – but they will only achieve it in their fantasies.

It’s far more likely that lightnings and thunderstorms would begin at His sanctuary (Ezekiel 9:6), i.e. dark days lie ahead for these professing Christians. “Slay utterly old and young, both maids and little children and women; but come not near any man upon whom is the mark; and begin at My sanctuary.”

“Ephraim compasseth me about with lies, and the house of Israel with deceit” Hosea 11:12 

Manasseh, Ephraim; and Ephraim, Manasseh; and they together shall be against Judah. For all this His anger is not turned away, but His hand is stretched out still” Isaiah 9:21

Thus saith the Lord God: Behold, I am against the shepherds; and I will require My flock at their hand and cause them to cease from feeding the flock, neither shall the shepherds feed themselves any more. For I will deliver My flock from their mouth, that they may not be meat for them. Ezekiel 34:10

What are the Oracles of God? (Part I)

KABUL FALLS – “WORSE THAN SAIGON”

•August 15, 2021 • Leave a Comment

“And if ye will not for all this hearken unto Me, but walk contrary unto Me, then I will walk contrary unto you also in fury; and I, even I, will chastise you seven times for your sins.” Leviticus 26:27-28

Taliban spokesman says Afghan war is over, militants convinced ‘foreign forces won’t repeat failed experience in Afghanistan’ – the Graveyard of Empires.

Taliban fighters take control of Afghanistan’s presidential palace. Photo: AP
“WAR IS OVER” UNDISPUTED VICTOR OF A 20-YEAR WAR!

The Taliban have taken control of the presidential palace in Kabul after President Ashraf Ghani fled the country. Earlier talks to form a transitional government appear to have been scuppered by Ghani’s departure. “A future Afghan government that upholds the basic rights of its people and that doesn’t harbor terrorists is a government we can work with and recognize,” Blinken reassured his fellow American people.

PRELUDE FOR ANOTHER SAIGON MOMENT?
Hugh Van Es; photographed the fall of Saigon; 67 - The Boston Globe
ROOFTOP RETREAT, FALL of SAIGON, April 30, 1975
Secretary of State BLINKEN on KABUL: “This is not SAIGON.”
For US, scramble to evacuate Kabul embassy a Saigon deja vu - Times of India
FALL of SAIGON, April 1975
Spot the Honda: Saigon 1975
FALL of SAIGON, April 1975
Reliving the fall of Saigon with Vietnam vets and journalists | PBS NewsHour
Photos: The Fall of Saigon | US News
Iran hostage crisis - Wikipedia
Or an Iran Hostage Siege Moment? – November 4, 1979
“There’s going to be no circumstances where you’re going to see people being lifted off the roof of a US Embassy in Afghanistan,” Biden said. But this is worst.

And upon them that are left alive of you, I will send a faintness into their hearts in the lands of their enemies; and the sound of a shaken leaf shall chase them; and they shall flee as fleeing from a sword, and they shall fall when none pursueth.

And they shall fall one upon another, as it were before a sword, when none pursueth; and ye shall have no power to stand before your enemies.

And ye shall perish among the heathen, and the land of your enemies shall eat you up. And they that are left of you shall pine away in their iniquity in your enemies’ lands; and also in the iniquities of their fathers shall they pine away with them. Leviticus 26:36-39

“Islamic law will come not to just Afghanistan, but all over the world.”

Bombshell: A Timeline of Covid

•August 13, 2021 • 2 Comments

“I have seen a horrible thing in the house of Israel” Hosea 6:10

Sobering thought: Timeline of COVID19 proves the USA bombed China with SARS in 2002 and SARS-CoV-2 in 2019

Covid Special: How this mysterious coronavirus originated and spread around the globe

And below is a testimony from an anonymous “Samantha Hill” — an ex-employee of the bioweapon lab at Fort Detrick, using a twitter account to testify that Professor Ralph Baric – “a science-maniac” – is the creator of the COVID-19 virus and that she had now fled back to India when her continual presence there had become dangerous:

Image

“And I will cast you out of My sight, as I have cast out all your brethren, even the whole seed of Ephraim” Jeremiah 7:15 

“The crown of pride, the drunkards of Ephraim, shall be trodden under feet” Isaiah 28:3

Below is a screenshot from above:

Curious, has Professor Ralph Baric been developing this COVID-19 virus to produce an adverse effect to target specifically the non-Caucasians and the Chinese??

A “novel” coronavirus (nCoV) is supposed to be “a new strain” that has not been previously identified in humans, but Dr David Martin – Patents Review shows SARS-CoV-2 is no novel Virus – July 9 2021

“I HAVE SEEN A HORRIBLE THING IN THE HOUSE OF ISRAEL” HOSEA 6:10

FORT DETRICK – SOURCE of COVID-19?

Dark days lie ahead for the descendents of modern Ephraim and Manasseh. Here’s what Leviticus says:

Leviticus 26:22 I will also send wild beasts among you, which shall rob you of your children and destroy your cattle and make you few in number, and your highways shall be desolate.
23 “‘And if ye will not be reformed by Me by these things, but will walk contrary unto Me,
24 then will I also walk contrary unto you, and will punish you yet seven times for your sins.
25 And I will bring a sword upon you that shall avenge the quarrel of My covenant; and when ye are gathered together within your cities I will send the pestilence among you, and ye shall be delivered into the hand of the enemy.
26 And when I have broken the staff of your bread, ten women shall bake your bread in one oven, and they shall deliver you your bread again by weight; and ye shall eat and not be satisfied.
27 “‘And if ye will not for all this hearken unto Me, but walk contrary unto Me,
28 then I will walk contrary unto you also in fury; and I, even I, will chastise you seven times for your sins.
29 And ye shall eat the flesh of your sons, and the flesh of your daughters shall ye eat.
30 And I will destroy your high places, and cut down your images, and cast your carcasses upon the carcasses of your idols; and My soul shall abhor you.
31 And I will make your cities waste and bring your sanctuaries unto desolation, and I will not smell the savor of your sweet odors.
32 And I will bring the land into desolation, and your enemies who dwell therein shall be astonished at it.
33 And I will scatter you among the heathen, and will draw out a sword after you; and your land shall be desolate and your cities waste. Leviticus 26:25-33

Australia’s Warmongers

•August 12, 2021 • Leave a Comment
Australian Warmongering, Rex Patrick, ASPI & Xinjiang – A Discussion with Robbie Barwick, Part 1

Join Robert Barwick (Australian Citizen’s Party Research Director) and Daniel Dumbrill for part 1 of a casual conversation about the growing anti-China propaganda in Australia. We discuss Rex Patrick, ASPI, the Xinjiang Uyghur genocide narrative and other pro-war pro-aggression voices destroying Australia and bringing it closer to war.

One commentator says “As an Australian, thank you to Daniel and Robbie for speaking about this. I am very concerned about what is happening in the region. Almost everyone I hear talking about China just reflects what they hear in the media. But it is so important to be critical about the information we hear because half-truths and lies can and will lead to war as we have already seen with Iraq and Afghanistan. For the sake of a peaceful future, thank you for showing the other side of the story.”

Another “I’m English and have lived in UK for 60 years and say I would never trust anything the BBC say anymore 😠 it has lost any respectability It had , UK media has become so biased now it would not want to know the truth even if it causes war and suffering so sad now.”

“Rupert Murdoch and his media empire creating anti-China propaganda should also be discussed, because his news empire contributed the most to the current anti-China sentiment by magnifying the narrative of politicians in US, Australia and other countries around the world.”

“Totally disgusted with my country’s brainless leaders Keep it up Daniel it is so important We have so many problems here that they are unable to handle so they use propaganda and lies to denigrate China as a smoke screen for their absolute inadequacy.”

“We need the US for defence, but we only need defence because of the US” – Ex Australian Prime Minister Malcolm Fraser

“We have killed Muslims in Iraq, Iran, Afghanistan, Lebanon, Palestine, Syria, and Libya [much more]… But we are very concerned about the human rights of Chinese Muslims in Xinjiang, China” – Mike Pompeo

Part 2 – Join Robert Barwick (Australian Citizen’s Party Research Director) and Daniel Dumbrill for a casual conversation about the growing anti-China propaganda in Australia. We discuss Rex Patrick, ASPI, the Xinjiang Uyghur genocide narrative and other pro-war pro-aggression voices destroying Australia and bringing it closer to war.

One listener asks a great question: “I’m flabbergasted. Why does Iraq not demand that the US and their allies compensate the Iraq government and the Iranian citizens for the damage caused by the false and made up allegations that caused a war and genocide? Why are the UN members keeping so quiet? Where is the ethos of diplomacy and politics? It’s time to pay up for the war crimes committed by the US!”

Another “America has a giant collection of experts on verbal gymnastics. They can twist facts and words in a million ways to support their devious minds.”

“Great content! Your videos are very informative. I was wondering if I can get your opinion on a current topic. The 2022 China Olympics are set to start soon and the western countries and media are ramping up efforts to push for a boycott. How do you think the situation will unravel if the China Olympics were to take place and the USA media lies were exposed? My belief is that the Olympics were a GREAT “chess move” by China to force media to show China and its growth and success. I believe boycott efforts will continue to escalate as the amount of time, effort and money that the US government has used to create a world of lies around China is at risk. I’d love to see a video about this topic as well if possible. Thanks and keep up the great work!”

Ephraim compasseth me about with lies, and the house of Israel with deceit” Hosea 11:12 

“Ephraim shall be desolate in the day of rebuke; among the tribes of Israel have I made known that which shall surely be” Hosea 5:9

7 Afghan Provinces fallen to the Taliban

•August 11, 2021 • Leave a Comment

“And I will set My face against you, and ye shall be slain before your enemies; they that hate you shall reign over you, and ye shall flee when none pursueth you.” Leviticus 26:17

ABC NEWS / August 11, 2021

Empires killers, the Talibans had killed off the British Empire, then the Soviet Empire, now the American Empire. Not really, US forces had already retreated before the latest Taliban surge, so there were no face-to-face humiliation as was the case during the Vietnam retreat with their Saigon roof-top moment.

Sikhs, Hindus 'Sitting Targets For Taliban': Congress Leader To Centre
Holding Taliban flags, the Taliban making military gains in Afghanistan

As of August 11, within a five day period, the Islamist insurgents have already overrun seven provincial capitals in the north, west and south, setting up the group to make an eventual bid for the biggest prize of all: the national capital, Kabul. 

Taliban insurgents have tightened their grip on captured Afghan territory as civilians hid in their homes, and a European Union official said the militants now control 65 per cent of the country.

About 400,000 Afghans have been displaced in recent months and there has been an increase in numbers of people fleeing to Iran over the past 10 days, the EU official said.

Taliban fighters attend a gathering to celebrate the U.S.-Taliban deal in March 2020.

Seventh provincial capital falls to Taliban as blitz takes Afghan forces by surprise.

The Taliban, ousted in the weeks after the September 11, 2001 attacks on the United States, appeared to be in a position to advance from different directions on Mazar-i-Sharif. 

The fall of Mazar-i-Sharif would deal a devastating blow to Mr Ghani’s government.

Atta Mohammad Noor, a northern militia commander, vowed to defend Mazar-i-Sharif to the end, saying there would be “resistance until the last drop of my blood”.

Seven Provinces already fallen to the Taliban

1 / August 6 — ZARANJ

The Taliban take over the city in Nimroz province in the south of the country, the first provincial capital to fall to the insurgents since they stepped up attacks on Afghan forces in early May.

2 / August 7 — SHEBERGHAN

The Taliban declare they have captured the entire northern province of Jawzjan, including its capital Sheberghan. Heavy fighting is reported in the city, and government buildings are taken over by the insurgents. Afghan security forces say they are still fighting there.

3 / August 8 — SAR-E-PUL

The insurgents take control of Sar-e-Pul, capital of the northern province of the same name. It is the first of three provincial centres to fall on the same day.

4 / August 8 — KUNDUZ

Taliban fighters seize control of the northern city of 270,000 people, regarded as a strategic prize as it lies at the gateway to mineral-rich northern provinces and Central Asia. Government forces say they are resisting the insurgents from an army base and the airport.

5 /August 8 — TALOQAN

The capital of Takhar province, also in the north, falls to the Taliban in the evening. They free prisoners and force government officials to flee.

6 /August 9 — AYBAK

The capital of the northern province of Samangan is overrun by Taliban fighters.

7 /August 10 – FARAH

Capital of the western province of Farah.

President Ashraf Ghani called on regional strongmen to support his shaky government, while a UN official said advances made in human rights in the 20 years since the hard-line Islamists were ousted from power were in danger of being erased.

In the capital of Kabul, Mr Ghani’s aides said he was seeking help from regional militias he has squabbled with over the years to rally to the defence of his wobbling government. 

Mr Ghani had also appealed to civilians to defend his American-imposed “democratic fabric”.

The LORD shall cause thee to be smitten before thine enemies; thou shalt go out one way against them and flee seven ways before them, and shalt be removed into all the kingdoms of the earth. Deuteronomy 28:25

Space Lasers War

•August 9, 2021 • Leave a Comment

Space lasers and the new battlefield emerging under China’s anti-satellite tactics

The Age by Chris Zappone / August 9, 2021

Space lasers are a real thing, even if they’re not generally made to blow up passing satellites.

Designed to damage or disable sensor equipment on orbiting satellites, ground-based lasers can help hide a nation’s activities. Photography from satellites, for example, has been key in helping reveal the extent of Beijing’s detention of Muslim Uighurs in western China.

The terrifying space weapons of the future – explosive 'rods from God'  meteorites, molten metal cannons and weaponised asteroids
Lasers as Weapons in a crowded Space

Weeks before the Federation of American Scientists produced analysis showing missile silos being built in western China, US-based analysts – drawing attention to anti-satellite lasers in Xinjiang – warned that US satellites, the kind that could keep an eye on China’s military, were “increasingly vulnerable to China’s ground-based lasers”.

Sydney-based space analyst Chris Flaherty said that when it came to lasers, “dazzling”, or interfering with a satellite’s camera, and “blinding”, permanently damaging a satellite, “are the prime technologies that are deployable right now”.

The technology gives a country the power “to deny a satellite’s ability to operate, to shut it down or to damage it – without creating space debris”.

Michael Duitsman of the California-based James Martin Centre for Nonproliferation Studies said the laser facility in Xinjiang was thought to have been started as far back as 2009. It “significantly predates both the Uighur cultural genocide and the current missile silo construction,” he said.

Inspecting images from earlier this year, Duitsman said there had been some construction in the support area for the laser, as well as modification at one of the buildings.

Concerns about the use of lasers used this way in a future space conflict are spreading.

The prospect of a contest for space dominance between China, the US and Russia prompted the US to create the Space Force in 2019. Last month, Defence Minister Peter Dutton announced Australia would begin exploring options for Space Electronic Warfare, because it’s a capability that doesn’t “create debris or damage the space environment”.

Pentagon report: China amassing arsenal of anti-satellite weapons

Flaherty said to better understand China’s intentions with lasers aimed at satellites, one need only look at the example Russia provides. In 2018, Russia unveiled its Peresvet laser system and positioned it near mobile units of intercontinental ballistic missiles.

In doing so, it can temporarily blind passing satellites overhead from taking pictures.

Flaherty said “any superpower that has important strategic assets … will deploy a laser”.

US-based China space analyst Dean Cheng believes Beijing would likely have installed them to frustrate the satellite photography of its military bases and equipment.

“It would not be surprising if the Chinese wanted to limit Indian ability to see into Tibet,” said Cheng.

He said lasers could be used to protect one of China’s missile silo fields, as well as naval and air bases that could be used in an invasion of Taiwan.

But the ability to use lasers against satellites is well known by space-faring powers.

Pentagon Warns That Enemies Could Shoot US Satellites With Lasers
Pentagon Warns That Enemies Could Shoot US Satellites With Lasers

“What is more problematic is that the West relies more on space for the conduct of military operations, so effective anti-satellite systems work much more to the benefit of” Russia or China, which focus their military closer to their own regions, Cheng says.

Economically, the West has more to lose in such a scenario because widely adopted Western technologies such as GPS have evolved to rely on peaceful access to space.

Simply raising questions about China’s capabilities to disrupt a rival nation’s satellites is part of the new game, one that differs from the Cold War rivalry.

The physical distance of orbit makes it hard to know with certainty whether an outage of a satellite happened as a cause of an accident, or if something was the result of hard-to-detect aggression.

For example, in 2006, China used a laser that temporarily blinded a US military reconnaissance satellite.

“The action temporarily blinded the satellite but caused no permanent damage, leading to speculation that China may not have been intentionally trying to interfere with the satellite,” said US congressional testimony in 2019.

Like the ambiguity of attributing the origin of a cyber attack, the cause of a problem in orbit is hard to determine as the satellite passes 200 kilometres overhead at a speed of 25,000 km/h.

Messing with a rival’s satellites in orbit in ways that can easily be misinterpreted, using lasers, or some other directed energy, is a change from the Cold War.

Back then Russian or American interference with each other’s satellites could easily be interpreted as a prelude to a nuclear launch, and so was something to generally avoid.

Today, while the nuclear risk hasn’t gone away – as China’s missile silo building proves – technology has evolved, orbits have grown much more crowded, and so has the willingness of some space powers to court risk.

China, among others, has been on a mission to build space power since it – and the world – witnessed volleys of US satellite-guided bombs raining down on Iraqi troops during the Persian Gulf War of 1991.

“The Gulf War set off the next technology trend for countries to catch up,” Flaherty said.

Since then, many more satellites and nations have entered orbit, producing data and services we rely on daily: GPS, space-based timing for transactions, Google maps, precise weather data for agriculture.

If China or another power used lasers aggressively against orbiting satellites, it’s no longer about two superpowers facing off like during the Cold War space race, said Flaherty.

Instead, the question becomes: if one space-reliant system goes down, what else goes down with it?

SPACENEWS

“The children of Ephraim, being armed and carrying bows, turned back in the day of battle” Psalm 78:9

Gill: but turned back in the day of battle; fled from the enemy, could not stand their ground when the onset was made:

Trapp: Carnal confidence seldom comes home otherwise than weeping.Calvin: it is the more abundantly manifest that they had incurred the displeasure of God, who not only deprived them of his aid, but also made their hearts effeminate in the hour of danger.

The US Empire is in Terminal Decline

•August 2, 2021 • 1 Comment

Chris Hedges: The return of the Taliban to power in Afghanistan will be one more signpost of the end of the American empire

RT / 26 Jul, 2021

The US empire is in terminal decline, and heading for a dystopian future. Yet no-one – not the generals, the politicians or the fawning MSM – will be held accountable for all the military follies that herald its imminent collapse.

The debacle in Afghanistan, which will unravel into chaos with lightning speed over the next few weeks and ensure the return of the Taliban to power, is one more signpost of the end of the American empire.

The two decades of combat, the one trillion dollars we spent, the 100,000 troops deployed to subdue Afghanistan, the high-tech gadgets, artificial intelligence, cyberwarfare, Reaper drones armed with Hellfire missiles and GBU-30 bombs, and the Global Hawk drones with high-resolution cameras, Special Operations Command composed of elite rangers, SEALs and air commandos, black sites, torture, electronic surveillance, satellites, attack aircraft, mercenary armies, infusions of millions of dollars to buy off and bribe the local elites and train an Afghan army of 350,000 that has never exhibited the will to fight, failed to defeat a guerrilla army of 60,000 that funded itself through opium production and extortion in one of the poorest countries on Earth.

Chris Hedges: The return of the Taliban to power in Afghanistan will be one more signpost of the end of the American empire

Like any empire in terminal decay, no one will be held accountable for the debacle, or for the other debacles in Iraq, Syria, Libya, Somalia, Yemen, or anywhere else. Not the generals. Not the politicians. Not the CIA and intelligence agencies. Not the diplomats. Not the obsequious courtiers in the press who serve as cheerleaders for war. Not the compliant academics and area specialists. Not the defense industry.

Empires at the end are collective suicide machines. The military in late empire becomes unmanageable, unaccountable, and endlessly self-perpetuating, no matter how many fiascos, blunders, and defeats it visits upon the carcass of the nation, or how much money it plunders, impoverishing the citizenry and leaving governing institutions and the physical infrastructure decayed.

Bloomberg’s America’s Worsening Homeless Crisis

The human tragedy – at least 801,000 people have been killed by direct war violence in Iraq, Afghanistan, Syria, Yemen, and Pakistan, and 37 million have been displaced in and from Afghanistan, Iraq, Pakistan, Yemen, Somalia, the Philippines, Libya, and Syria, according to the Watson Institute at Brown University – is reduced to a neglected footnote.

The 10 MOST HOMELESS CITIES in AMERICA

Nearly all the roughly 70 empires during the last four thousand years, including the Greek, Roman, Chinese, Ottoman, Habsburg, imperial German, imperial Japanese, British, French, Dutch, Portuguese, and Soviet empires, collapsed in the same orgy of military folly. The Roman Republic, at its height, only lasted two centuries. We are set to disintegrate in roughly the same time. This is why, at the start of World War I in Germany, Karl Liebknecht called the German military, which imprisoned and later assassinated him, “the enemy from within.”

HOMELESS IN SAN FRANCISCO

Mark Twain, who was a fierce opponent of the efforts to plant the seeds of empire in Cuba, the Philippines, Guam, Hawaii, and Puerto Rico, wrote an imagined history of America in the twentieth century in which its “lust for conquest” had destroyed “the Great Republic … [because] trampling upon the helpless abroad had taught her, by a natural process, to endure with apathy the like at home; multitudes who had applauded the crushing of other people’s liberties, lived to suffer for their mistake.” 

NEW YORK is DEAD

Twain knew that foreign occupations, designed to enrich the ruling elites, use occupied populations as laboratory rats to perfect techniques of control that soon migrate back to the homeland. It was the brutal colonial policing practices in the Philippines, which included a vast spy network along with routine beatings, torture, and executions, which became the model for centralized domestic policing and intelligence gathering in the United States. Israeli’s arms, surveillance and drone industries test their products on the Palestinians.

And I will destroy your high places, and cut down your images, and cast your carcasses upon the carcasses of your idols; and My soul shall abhor you. And I will make your cities waste and bring your sanctuaries unto desolation, and I will not smell the savor of your sweet odors. Leviticus 26:30-31

It is one of the dark ironies that it was the American empire, led by Jimmy Carter’s National Security Advisor Zbigniew Brzezinski, which spawned the mess in Afghanistan. Brzezinski oversaw a multibillion-dollar CIA covert operation to arm, train, and equip the Taliban to fight the Soviets. This clandestine effort sidelined the secular, democratic opposition and assured the ascendancy of the Taliban in Afghanistan, along with the spread of its radical Islam into Soviet Central Asia, once Soviet forces withdrew.

New York’s Homeless Epidemic 

The American empire would, years later, find itself desperately trying to destroy its own creation. In April 2017, in a classic example of this kind of absurd blowback, the United States dropped the “mother of all bombs” – the most powerful conventional bomb in the American arsenal – on an Islamic State cave complex in Afghanistan that the CIA had invested millions in building and fortifying.

And upon them that are left alive of you, I will send a faintness into their hearts in the lands of their enemies; and the sound of a shaken leaf shall chase them; and they shall flee as fleeing from a sword, and they shall fall when none pursueth. And they shall fall one upon another, as it were before a sword, when none pursueth; and ye shall have no power to stand before your enemies. And ye shall perish among the heathen, and the land of your enemies shall eat you up. And they that are left of you shall pine away in their iniquity in your enemies’ lands; and also in the iniquities of their fathers shall they pine away with them. Leviticus 26:36-39

Bad News for those Vaccinated!

•August 1, 2021 • Leave a Comment

Bad news for the vaxxed: The official vaccine narrative IMPLODING: CDC warns that virus is evading the vaccines; masks and quarantines now required for all

Natural News / July 29, 2021 / Lance D Johnson

For months, public health authorities told citizens that “life would not go back to normal” unless 90 percent of the population was vaccinated with experimental spike protein mRNA programs. Lockdowns were used to force people to comply with vaccine mandates.

Celebrities and politicians were recruited to promote the shots on social media as the vaccine-injured were censored. Vaccine lotteries and junk food freebies were handed out to the vaccinated. Illegal employer mandates are being used as threats and intimidation.

The Biden regime promised “100 days of masking” to end covid-19 once and for all, and they even bastardized “Independence Day” by telling Americans they won’t have their freedoms back until they collectively comply with a national 70 percent vaccination rate.

Image: Bad news for the vaxxed: The official vaccine narrative IMPLODING: CDC warns that virus is evading the vaccines; masks and quarantines now required for all

But after all the terror, bribery, segregation, intimidation, and abuse, the vaccinated are getting some very bad news.

Ken Dilanian for NBC News is shocking American viewers with “new data” on the failure of the mass covid-19 vaccination program. “New data suggests that fully vaccinated individuals are not just contracting COVID, but could be carrying higher levels of virus than previously understood, facilitating spread,” he reported.

The report was confirmed by Dr. Leana Wen, who appeared on CNN to call for universal indoor masking for the vaccinated and even declared that quarantines should be used on the vaccinated when they are exposed to another sick vaccinated person. Even the propaganda-pushing Andersen Cooper was bewildered by the new guidance. The CDC is currently promoting mask mandates for the unvaccinated, as the failure of the vaccines is openly admitted through policy.

CDC director warns that virus is evading the vaccines

CDC Director Walensky went on Fox News and implied that more doses of vaccine will be needed in order to keep people “fully vaccinated.” She warned about the failure of the vaccine program: “The largest concern that I think we in public health and science are worried about, is that virus and the potential mutations away, we are from a very transmissible virus that has the potential to evade our vaccine in terms of how it protects us from severe disease and death.”

This waning immunity is not new; it was demonstrated in the clinical studies that were originally ignored by the regulatory agencies. This waning immunity is already occurring in some of the most vaccinated countries, like Israel and Singapore. The vaccinated are coming down with sickness and are being hospitalized at a growing rate, as their so-called “immunity” wanes in less than six months.

While it’s no longer called “covid” for the vaccinated, they are coming down with sickness nonetheless. Israel has even demoted Pfizer’s vaccine effectiveness to an abysmal 39 percent. Whatever that means? The UK chief science advisor admits that 60% of people admitted to UK hospitals are “fully vaccinated.” In Singapore, 75 percent of new covid infections are from the vaccinated. In the US, cases in the vaccinated are so high, the CDC had to commit medical fraud by lowering the cycle threshold on the PCR test kits to artificially lower covid positives for the vaccinated.

And now the Center for Disease Control wants to push more mask mandates for the vaccinated, as the vaccinated become the “super spreaders” they once mocked. Not only are the vaccinated shedding spike protein bioweapons from their own cells, but they have also weakened their bodies with further inflammation from those spike proteins, making them more susceptible to coronavirus variants. Even worse, the vaccinated have become the vector for which coronaviruses mutate and spread.

Meanwhile, the vilified and socially ostracized (the unvaccinated) enjoy natural immunity or may soon have natural immunity that is proven to be 40 times more durable at preventing hospitalizations in Israel. What’s more, science shows natural immunity provides persisting antibody levels, including robust memory B and T cell immunity.

“Ephraim compasseth me with lies, and the house of Israel with deceit” (Hosea 11:12).

CNN Fake News

Biden LIES about surge in COVID-19 deaths

Image: It is mathematically impossible for covid vaccines to achieve anything useful for the population

It is mathematically impossible for covid vaccines to achieve anything useful / July 28, 2021 / Lance D Johnson

It’s bad enough that these vaccine efficacy studies use diagnostic fraud, but the studies are also grossly inadequate because they only aim to prove that the vaccine reduces the number of symptomatic cases of covid-19 in a given cohort of people. The studies do not in any way prove that the vaccine prevents SARS-CoV-2 infection, transmission, hospitalization, death or even less severe symptoms. 

A majority of vaccinated test subjects experience fever, chills, headaches and pain that requires further medical intervention. Because covid vaccines deliberately cause symptomatic illness, its insane to think they could achieve anything useful for science and health.

Yale doctor calls out CDC for committing large scale medical fraud and hiding covid cases among the vaccinated / July 23, 2021 / Lance D Johnson

(Natural News) The Centers for Disease Control (CDC) is engaged in one of the greatest medical frauds of our time, using disparate PCR cycle thresholds to artificially inflate covid-19 cases in the unvaccinated, while hiding covid cases in the fully vaccinated. This covid-19 testing fraud continues to obfuscate the American medical response, as the original aerosolized bioweapon evades detection, as the ongoing release of that spike protein continues through the “savior” vaccines.

In a recent interview with Fox News’ Laura Ingraham, Dr. Harvey Risch of the Yale School of Medicine called out the CDC for committing wide-scale medical fraud. When the covid-19 vaccines were launched under emergency authorization, the CDC changed the covid-19 testing guidelines for the fully vaccinated, lowering the cycle threshold count of the PCR test ONLY for the vaccinated.

Israel’s health ministry has found that 40 percent of new covid cases are in the vaccinated, while less than 1 percent of new cases are from people who were previously infected. People who recovered from a natural infection have immunity that is 40 times more durable at preventing hospitalization from future variants. In the UK, Sir Patrick Vallance said the vaccinated patients makeup 40-60 percent of new covid cases, proving the vaccines are an abysmal failure at preventing serious illness in the real world.

The Lord shall smite thee with madness, and blindness, and astonishment of heart; and thou shalt grope at noonday, as the blind gropeth in darkness, and thou shalt not prosper in thy ways. And thou shalt be only oppressed and despoiled evermore, and no man shall save thee. Deuteronomy 28:28-29.

A thousand shall fall at thy side, and ten thousand at thy right hand, Psalm 91:7

Why NIH’s Gain-of-Function Research at Wuhan?

•July 31, 2021 • Leave a Comment

Republicans argue Fauci emails show NIH funded gain-of-function research at Wuhan lab

Washington Examiner / Sarah Westwood / July 29, 2021

Five Republican senators are questioning why the Department of Health and Human Services redacted a portion of an email between Dr Anthony Fauci and Peter Daszak, the president of a research organization that worked with the Wuhan Institute of Virology on coronavirus studies before the pandemic.

Their inquiry is the latest attempt from the group to get public health agencies to turn over documents related to the way pandemic policies have been set behind the scenes.

Earlier this month, Sen. Rand Paul requested Attorney General Merrick Garland to start a criminal investigation of Fauci over his Senate testimony, during which he said the National Institutes of Health never funded gain-of-function research at the Wuhan lab. The Kentucky Republican says that is a lie, while Fauci insists the NIH grants did not fund gain-of-function research.

Dr Fauci pointing
Dr Fauci should have been led away in handcuffs long ago but he’s still there, holding the most important office. It shows how paralyzed and corrupt the System is, especially the Department of Justice. Already sedated? If so, by whom?

Rep. Jim Jordan of Ohio, the ranking member on the House Judiciary Committee, and Rep. James Comer of Kentucky, the top GOP member on the House Oversight Committee, sent a letter to Fauci this week, noting he hadn’t responded to a similar June letter from them about testimony in May and arguing that his July testimony only raised more questions. Jordan and Comer said, “New emails make this recurring testimony even more concerning and show a closer relationship between NIAID and the WIV than previously known.”

The one exception, according to the Republican lawmakers, was the email between Fauci and Daszak, which had been unredacted. The senators said it appeared HHS “may have forgotten” to redact the portion of the email that was previously hidden under the law enforcement standard.

“It’s been a very hard few months as these conspiracy theorists have gradually become politicized and hardened in their stance,” Daszak wrote to Fauci and others in the unredacted version of the email.

“Especially because the work we’ve been doing in collaboration with Chinese virologists has given us incredible insight into the risks that these viruses represent, so that we can directly help protect our nation from bat-origin coronaviruses,” Daszak continued. “We’re fighting to keep the communications open with our Chinese colleagues, so that we can better address future pandemics like COVID-19.”

The CDC and NIAID entered into trade among States (including, but not limited to working with University of North Carolina, Chapel Hill) and with foreign nations (specifically, the Wuhan Institute of Virology and the Chinese Academy of Sciences represented by Zhengli Shi) through U19AI109761 (Ralph S. Baric), U19AI107810 (Ralph S. Baric), and National Natural Science Foundation of China Award 81290341 (Zhengli Shi) et al. 2015-2016. These projects took place during a time when the work being performed was prohibited by the United States National Institutes of Health.

The public was clearly advised of the dangers being presented by NIAID-funded research by 2015 and 2016 when the Wuhan Institute of Virology material was being manipulated at UNC in Ralph Baric’s lab.

Jordan and Comer contended that the NIAID “funded gain-of-function research at the WIV and this research did not go through the proper oversight.” They told Fauci that “it is unclear why you would continue to testify otherwise.” They pointed to recently released emails to make their case.

Ralph Baric and his team @Baric_Lab – Researching #SARSCoV2, SARS-CoV, MERS-CoV, Dengue, Zika, and human norovirus at the University of North Carolina, Chapel Hill

The Republicans cited a Feb. 1, 2020, email from Fauci to the deputy director of the NIAID, Dr Hugh Auchincloss, which included an attached research article published in 2015 in Nature Medicine titled “A SARS-like cluster of circulating bat coronavirus shows potential for human emergence” that was “primarily authored” by Dr Ralph Baric of the University of North Carolina at Chapel Hill and Wuhan lab “bat lady” Dr Zhengli Shi, with the paper acknowledging the Key Laboratory of Special Pathogens and Biosafety at the Wuhan Institute of Virology.

Jordan and Comer noted that “the paper was funded by NIAID grant U19AI107810” and that both “Baric and Shi acknowledge this.”

Study: New Mutation Sped Up Spread of Coronavirus

“I have seen a horrible thing in the house of Israel; there is the whoredom of Ephraim, Israel is defiled” Hosea 6:10

COVID-19 TRAIL OF BLOOD!

•July 30, 2021 • Leave a Comment

“I have seen a horrible thing in the house of Israel; there is the whoredom of Ephraim, Israel is defiled” Hosea 6:10

There was a murder, and upon an initial investigation, there was a trail of blood . . . and they all lead to high places!

“A can of worms,” someone says, “better not to open such can.”

Dr David Martin, CEO of M-CAM International (risk management) has reviewed 4,000 Coronavirus patents. He appeared on Sitting #60 of the German Corona Committee on July 9 2021 to share his findings in a 90 minute discussion with lawyers.

Now Dr Martin is opening that can!

Dr David Martin – Spike Protein Patents Since 2002!

The gist of David Martin’s video was that wealthy philanthropists like Bill Gates, technology companies, pharmaceutical companies and global health organizations colluded to create a virus that would force governments to fund research and development of vaccines and therapies in order to enrich themselves.

Dr Peter Daszak of EcoHealth Alliance offered the following assessment [in March 2015]:

“Daszak reiterated that, until an infectious disease crisis is very real, present, and at an emergency threshold, it is often largely ignored. To sustain the funding base beyond the crisis, he said, we need to increase public understanding of the need for MCMs such as a pan-influenza or pan-coronavirus vaccine. A key driver is the media, and the economics follow the hype. We need to use that hype to our advantage to get to the real issues. Investors will respond if they see profit at the end of process.”

By doing so Dr Martin explains in detail the trails of blood related to SARS Cov2. It’s unbelievable and breathtaking to me, but please watch the video and decide for yourself.

This elitist crime information is a matter of PUBLIC RECORD and the information is of public interests. And please share around if you find it beneficial. Thanks.

EXCLUSIVE! Dr. David Martin Just Ended COVID, Fauci, DOJ, Politicians in ONE INTERVIEW.

By Stew Peters

FORT DETRICK – SOURCE of COVID-19?

“Ephraim shall be desolate in the day of rebuke; among the tribes of Israel have I made known that which shall surely be” Hosea 5:9

~~~~~

Below are smaller doses of the same video in which Dr David Martin explains in detail the patents related to SARS Cov2.

FORT DETRICK – SOURCE of COVID-19?

“Your country is desolate, your cities are burned with fire; your land, strangers devour it in your presence, and it is desolate, as overthrown by strangers” Isaiah 1:7.

Then said I, “LORD, how long?” And He answered, “Until the cities be wasted without inhabitant, and the houses without man, and the land be utterly desolate” Isaiah 6:11.

“In that day shall his strong cities be as a forsaken bough and an uppermost branch, which they left because of the children of Israel; and there shall be desolation” Isaiah 17:9.

Dr Fauci Should be Led Away in Handcuffs

•July 27, 2021 • Comments Off on Dr Fauci Should be Led Away in Handcuffs

Dr Fauci should have been led away in handcuffs long ago but he’s still there, holding the most important office. It shows how paralyzed and corrupt the System is, especially the Department of Justice. Already sedated? If so, by whom?

In 2014, the Obama administration imposed a moratorium on Gain of Function because it was seen as too risky on humanity, but this moratorium was overturned on December 19, 2017 by Dr Anthony Fauci who sees himself siting on a pedestal above the President.

SummitNews report: Fauci Declares Himself The Supreme Authority; “Attacking Me Is Attacking Science”

By Steve Watson / 10 June, 2021

As the scrutiny of Dr Fauci continues to increase following the release of his emails, it’s clear he’s feeling the strain. He declared, yet again, Wednesday that anyone attacking him should be seen as attacking science itself.

Fauci made the comments in part in response to Republicans in the House demanding he explain comments previously made that contradict sworn testimony that he gave to Congress.

During another softball interview on MSNBC, Fauci repeated his claim to being the supreme authority on the pandemic, suggesting that anyone who questions what he says is “painfully ridiculous”.

“If you are trying to get at me as a public health official and a scientist, you’re really attacking, not only Dr Anthony Fauci, you are attacking science,” Fauci proclaimed.

Fauci continued “Anybody that looks at what’s going on, clearly sees that. You have to be asleep not to see that. That is what’s going on. Science and the truth are being attacked.”

Many would argue that science and truth were attacked at the beginning of the pandemic when Fauci dismissed out of hand the notion of coronavirus leaking from the Wuhan Institute of Virology [[unless Fort Detrick is similarly investigated like WIV, WHO could never give an honest answer! More likely Fort Detrick is the nerve center of the original coronavirus/Covid-19 operation, with tentacles reaching out earlier to Barcelona in March 2019; France in December; and Italy in October 2019 and even in the United States itself in December 2019. The Latest: zero chance it leaked from WIV]] when leading virologists were telling him that the thing looked like it was engineered.

“It’s very dangerous, Chuck, because a lot of what you’re seeing as attacks on me quite frankly are attacks on science because all of the things that I have spoken about consistently from the very beginning have been fundamentally based on science.”

Science and truth was attacked when Fauci’s pal Peter Daszak, the Wuhan gain of function funder, the guy Fauci routed the money through, orchestrated a ‘bullying’ campaign and coerced top scientists into signing off on a letter to The Lancet aimed at removing blame for Covid-19 from the Wuhan lab he was funding with taxpayer dollars.

Fauci is repeating this ‘I am science’ talking point all over the place. Last week, again on MSNBC, he said basically the same thing.

A real scientist would point out that one should always beware anyone who says ‘the science is settled’ or criticises others for questioning science. That’s what science is, a series of questioning hypotheses.

And given Fauci’s record for flip flopping on what is and isn’t scientifically sound during this pandemic, and his shady involvement with funding the dangerous research in a lab where the virus magically appeared, he in particular should be the first to be questioned.

Dr Fauci should be led away in handcuffs

“The stranger that is within thee shall get up above thee very high, and thou shalt come down very low … He shall be the head, and thou shalt be the tail” Deuteronomy 28:43-44

Dr David Martin – Patents Review

•July 27, 2021 • 2 Comments

A “novel” coronavirus (nCoV) is supposed to be “a new strain” that has not been previously identified in humans, but Dr David Martin – Patents Review shows SARS-CoV-2 is no novel Virus – July 9 2021

In this video Dr David E. Martin explains in detail,the trails of blood related to SARS Cov2.

NOT SURE HOW YOU FEEL BUT A CHILL RUN THROUGH MY SPINE WHEN I WATCH THIS VIDEO!!!

Dr David Martin, CEO of M-CAM International (risk management) has reviewed 4,000 Coronavirus patents. He appeared on Sitting #60 of the German Corona Committee on July 9 2021 to share his findings in a 90 minute discussion with lawyers of the Ausschuss and Dr Wolfgang Wodarg, Germany’s most experienced lung doctor.

Ralph Baric at a University of North Carolina lab | Photo: Christopher Janaro | Bloomberg
RALPH S. BARIC, described as “a science-maniac”and Professor of epidemiology at the UNC-Chapel Hill, also “one who has made a lot of money” — shouldn’t the world honor him the title FATHER of COVID-19?

Dr Martin’s clear and verifiable conclusion is that there is nothing at all novel about the SARS-CoV-2 gene sequence used as a basis for the Covid vaccines. Further from a patent standpoint, there seems to be no way of knowing what exact sequence is being used in the vaccines and therefore what people are being injected with. Drs Martin & Fuellmich consider this situation to be a RICO (Racketeer Influenced and Corrupt Organizations Act) legal case.

Odysee.com

“I have seen a horrible thing in the house of Israel; there is the whoredom of Ephraim, Israel is defiled” Hosea 6:10

By Stew Peters

July 21, 2021

FORT DETRICK – SOURCE of COVID-19?

Then said I, “LORD, how long?” And He answered, “Until the cities be wasted without inhabitant, and the houses without man, and the land be utterly desolate” Isaiah 6:11.

China to NUKE Japan?

•July 23, 2021 • Leave a Comment

CHINA is threatening to NUKE revisionist Japan on the eve of the Olympics if it intervenes in conflict with Taiwan, it has been revealed in a new video.

According to the Congressional Research Service, neo-Imperialist Nippon Kaigi believes that “Japan should be applauded for liberating much of East Asia” during WW2, that the “Tokyo War Crimes tribunals were illegitimate,” and that the rape of Nanking was either “exaggerated or fabricated.” It denies the forced prostitution of Chinese and Korean “comfort women” by the Imperial Japanese Army, believes Japan should have an army again — something outlawed by Japan’s current constitution — and believes that it should return to worshipping the emperor.

In 2013, at a Nippon Kaigi party celebrating Shinzo Abe’s new appointments to his cabinet — 15 of whose 18 members were Nippon Kaigi-niks — the old imperial “Rising Sun” flag was flown, pledges to “break away from the postwar regime” were made, and the (very short and controversial) imperial national anthem was sung. 

In response to these revisionist statements, elements in the Chinese Republic said in the video that it would declare “full-scale war” against neo-Imperialist JAPAN if the Taiwan disagreement escalates, stoking World War Three fears.

Atomic Bomb Dropped on Hiroshima - HISTORY
Even after this atomic bomb explosion in Hiroshima (and another in Nagasaki), JAPAN doesn’t know or pretends not to know what they had done to CHINA (and KOREA).

The Sun / Jul 19 2021 / Jamie Seidel, Adriana Elgueta

It comes after earlier this month, China vowed to invade Taiwan and explained how it would do it.

An article in a state-controlled publication offered a glimpse of a terrifying three-stage plan to pave the way for an invasion force to storm the breakaway island.

President Xi Jinping pledged a “complete reunification” with Taiwan as he delivered a speech to mark 100 years of the Chinese Communist party.

Any invasion would represent a serious escalation of hostilities and could drag in the US through its pact to defend Taiwan.

The video threatened to nuke Japan if they intervened in the Taiwan conflicts

Delinquent of duty, General MacArthur had left today the Western Pacific an unfinished business to solve. See Japan’s Imperial Conspiracy by David Bergamini

Washington’s regional allies such as South Korea, revisionist Japan and Australia could also be sucked into a conflict as would Nato forces such as the UK because the US is a member of the alliance.

But a video channel, allegedly approved by the Chinese Communist Party with close ties to the People’s Liberation Army (PLA), took the anger to the next level.

In the new video now deleted, a narrator said: “We will use nuclear bombs first. We will use nuclear bombs continuously.

“We will do this until Japan declares unconditional surrender for the second time.”

SOS, Save Our Sea. Graphic: Xiong Xiaoying/GT
Gen MacArthur’s Unfinished Business after WWII: Now China says to Japan, “We will use nuclear bombs continuously.” Japan, the only country to experience nuclear attacks, may experience them again?

“When we liberate Taiwan, if Japan dares to intervene by force – even if it only deploys one soldier, one plane or one ship – we will not only return fire but also wage full-scale war against Japan itself.”

Delinquent of his duty to execute fair and equitable justice for the crimes JAPAN had committed, General MacArthur had left today the Western Pacific an unfinished business to solve. By allowing JAPAN’s criminals to roam free the UNITED STATES is deemed as an accomplice in its crimes. Under the English common law, an accomplice is a person who actively participates in the commission of a crime, even if they take no part in the actual criminal offense but by allowing JAPAN’s criminals free, (even bringing in their “germ data” from Harbin, CHINA for the foundation of FORT DETRICK’s biochemical weapon program), the UNITED STATES would be sharing JAPAN’s culpability.

“I have seen a horrible thing in the house of Israel; there is the whoredom of Ephraim, Israel is defiled” Hosea 6:10

And, today, many of those criminals have their Nippon Kaigi great grand children in the DIET, JAPAN’S Parliament, ruling over their country. Hence today, the Japanese has mastered the art of giving apology without any contrition. See more of these deceits and deceptions in Japan’s Imperial Conspiracy by David Bergamini. Your local library would have a copy screaming for attention to be read.

For Japan's Shinzo Abe, Unfinished Family Business - WSJ
Shinzo Abe recalls sitting on his grandfather’s lap as a young boy 55 years ago. ABE’s duty was to rebuild Japan’s military for JAPAN’s “Manchukuo: Asia’s Unfinished War.” ABE’s grandfather Nobusuke Kishi was nicknamed the “Monster of Manchuria,” and Prime Minister of JAPAN (1957-1960) under the nose of the UNITED STATES.

And there is a prophecy to the house of Israel, “a rebellious nation” (Ezekiel 3:5). This house of Israel refers to 10 tribes of Israel that separated from Judah and set up their own kingdom. They were besieged and taken into captivity in 721 BC. Ezekiel was writing more than a hundred years later with fellow captives at Telabib (Ezekiel 3:15), so the message could only meant for those of the Northern Kingdom – the modern Israelites today from Prophet Ezekiel:

Ezekiel: Prophecy as Performance Art | My Jewish Learning
Ezekiel’s Vision of God for the Endtime rebellious House of Israel

Chapter 5

“And thou, son of man, take thee a sharp knife, take thee a barber’s razor and cause it to pass over thine head and upon thy beard. Then take thee balances to weigh and divide the hair.

Thou shalt burn with fire a third part in the midst of the city, when the days of the siege are fulfilled; and thou shalt take a third part and smite about it with a knife, and a third part thou shalt scatter in the wind; and I will draw out a sword after them.

Thou shalt also take thereof a few in number, and bind them in thy skirts.

Then take of them again, and cast them into the midst of the fire, and burn them in the fire; for thereof shall a fire come forth into all the house of Israel.

“Thus saith the Lord God: This is Jerusalem. I have set it in the midst of the nations and countries that are round about her.

And she hath changed My judgments into wickedness more than the nations, and My statutes more than the countries that are round about her; for they have refused My judgments and My statutes. They have not walked in them.

Therefore thus saith the LORD God: Because ye multiplied more than the nations that are round about you, and have not walked in My statutes, neither have kept My judgments, neither have done according to the judgments of the nations that are round about you,

therefore thus saith the LORD God: Behold I, even I, am against thee, and will execute judgments in the midst of thee in the sight of the nations.

And I will do in thee that which I have not done, and the like of which I will not do any more, because of all thine abominations.

10 Therefore the fathers shall eat the sons in the midst of thee, and the sons shall eat their fathers; and I will execute judgments in thee, and the whole remnant of thee will I scatter into all the winds.

11 “Therefore as I live, saith the LORD God, surely because thou hast defiled My sanctuary with all thy detestable things and with all thine abominations, therefore will I also diminish thee; neither shall Mine eye spare, neither will I have any pity.

12 A third part of thee shall die with the pestilence, and with famine shall they be consumed in the midst of thee; and a third part shall fall by the sword round about thee; and I will scatter a third part into all the winds, and I will draw out a sword after them.

13 Thus shall Mine anger be accomplished, and I will cause My fury to rest upon them, and I will be comforted; and they shall know that I, the LORD, have spoken it in My zeal when I have accomplished My fury upon them.

14 “Moreover I will make thee a waste and a reproach among the nations that are round about thee, in the sight of all that pass by.

15 So it shall be a reproach and a taunt, an instruction and an astonishment unto the nations that are round about thee, when I shall execute judgments upon thee in anger and in fury and in furious rebukes. I, the LORD, have spoken it.

16 When I shall send upon them the evil arrows of famine which shall be for their destruction, and which I will send to destroy you, and I will increase the famine upon you, and will break your staff of bread,

17 so will I send upon you famine and evil beasts, and they shall bereave thee; and pestilence and blood shall pass through thee, and I will bring the sword upon thee. I, the LORD, have spoken it.”

Ezekiel 5:1-17

What Happened on 9 Av?

•July 20, 2021 • Leave a Comment

What Happened on 9 Av?

The Siege of Jerusalem, AD 70, by Flavius Josephus
The Fall of Jerusalem began with a Siege in AD 70, wrote Flavius Josephus

Tisha B’Av, the 9th day of the month of Av (July 17-18, 2021), is the saddest day on the Jewish calendar, on which pious or Orthodox Jews, deprive themselves and pray. It is the culmination of the Three Weeks, a period of time during which they mark the destruction of the Holy Temple in Jerusalem.

“Thus saith the LORD of hosts: ‘The fast of the fourth month, and the fast of the fifth, and the fast of the seventh, and the fast of the tenth, shall be to the house of Judah joy and gladness and cheerful feasts. Therefore love the truth and peace.’ Zechariah 8:19

So what happened on the 9th of Av?

1313 BCE: The spies returned from the Promised Land with frightening reports, and the Israelites balked at the prospect of entering the land. God decreed that they would therefore wander in the desert for 40 years.

The Israelites are in the desert, recently having experienced the miraculous Exodus, and are now poised to enter the Promised Land. But first they dispatch a reconnaissance mission to assist in formulating a prudent battle strategy. The spies return on the eighth day of Av and report that the land is unconquerable.

That night, the 9th of Av, the people cry. They insist that they’d rather go back to Egypt than be slaughtered by the Canaanites. God is highly displeased by this public demonstration of distrust in His power, and consequently that generation of Israelites never enters the Holy Land. Only their children have that privilege, after wandering in the desert for another 38 years.

The Fall of Jerusalem in 70 CE: A Story of Roman Revenge

Both Holy Temples in Jerusalem were destroyed on this date – the 9th day of Av. The First Temple was burned by the Babylonians in 423 BCE.

And in the fifth month, on the seventh day of the month [which is Av], which is the nineteenth year of King Nebuchadnezzar king of Babylon, came Nebuzaradan, captain of the guard, a servant of the king of Babylon, unto Jerusalem.

And [two days later] he burned the house of the LORD, and the king’s house, and all the houses of Jerusalem, and every great man’s house burned he with fire. II King 25:8-9

— Western records designate the year as 586 BCE when this First Temple was destroyed by Nebuchadnezzar, which is 163 years earlier than Jewish reckoning. But why such differences? The Jews have a continuous record, but English has no written records until around 400 CE. And even if the Roman Empire had a continuous record, it could bring us back another 500 years at most, but nothing to bring us to 586 BCE. Hence Western narratives and its dating system are, unfortunately, full of suspects.

In 66 CE the Jewish population rebelled against the Roman Empire. Four years later, on 4 August 70 CE (the 9th Day of Av), the Second Temple fell to the Romans unleashing a period of suffering from which the Jewish nation has never fully recovered.

Siege of Jerusalem | Facts & Summary | Britannica

According to an inscription on the Colosseum, Emperor Vespasian built the Colosseum with Jewish slaves and war spoils – many from the spoils of the Second Temple.

Surely deemed not worthy of survival, the apostate Sadducees, the Boethusians and the Essenes all vanished without coming through the Consuming Fires. 

The Sadducees and Boethusians, following the heretic Samaritan way of observing Passover, kept it on the night of the fourteenth. The Essenes, after they had repudiated the calendar that was sanctioned by the Sanhedrin, then went about presumptuously making one of their own. They all perished by either the flaming Sword or the consuming Fire.

These unpleasant endings should give those in the Church serious thoughts to a coincidence that all serious believer would find troubling. But, alas, His ten endtime virgins are all naked, wretched and far asleep, as if they had all been tranquilized by Satan.

Shall a trumpet be blown in the city, and the people not be afraid? Shall there be evil in a city, and the LORD hath not done it? Amos 3:6

The Pharisees and the Nazarenes escaped; the former to Yavneh, the later to Pella. 

The Unspoken Will of God

•July 17, 2021 • Leave a Comment

Wow, is there such a thing as the Unspoken Will of God?

Yes, there is!

Some of God’s oracles were written with God’s fingers. And they are the Ten Commandments.

Unspoken - theway church
What Are the Unspoken Word of God?

Others are scattered all over the Books of Moses. Much of these were collated and for the Mishnah that form the 613 mitzvot. Many of the mitzvot cannot be observed now, following the destruction of the Second Temple, although they still retain religious significance.

And the LORD delivered unto me two tablets of stone written with the finger of God, and on them was written according to all the words which the LORD spoke with you on the mount out of the midst of the fire in the day of the assembly. Deuteronomy 9:10

Others were written when God told Moses to write them down:

And the LORD said unto Moses, “Write thou these words, for according to the tenor of these words I have made a covenant with thee and with Israel.” Exodus 34:27

But surprisingly, there were the unspoken Word of God! Extra blessings await those who touches the heart of God; like parents, they have their secret wishes for their children. So is God. But how do we know God’s unspoken will if they were unspoken?

To be unspoken would also mean unwritten.

The answer is quite simple. Like parents they could be hinted at but not quite spoken of. So how could we understand the unspoken Word of God if there are any?

The answer lies in the Four fasts of Zechariah:

“Thus saith the LORD of hosts: ‘The fast of the fourth month, and the fast of the fifth, and the fast of the seventh, and the fast of the tenth, shall be to the house of Judah joy and gladness and cheerful feasts. Therefore love the truth and peace.’ Zechariah 8:19

The Scriptures do not give any details, but they are in the Oral Law:

Seventeenth of Tammuz (Shiva Asar B’Tammuz, minor fast) — the breaching of the walls of Jerusalem before the destruction of the Second Temple in 70 AD. – June 27, 2021 (July 16,17, 2022)

Ninth of Av (Tisha B’Av, full fast) — fall of Jerusalem on the same dates in 587 BC and 70 AD. – July 18, 2021 (August 6,7, 2022)

Third of Tishrei: Fast of Gedalia (Tzom Gedalia, minor fast) — assassination of Gedaliah, the righteous governor of Judah (II Kings 25:22–26). – Sept 9, 2021 (Sept 28, 2022)

Tenth of Tevet (Asara B’Tevet, minor fast) — the siege of Jerusalem by Nebuchadnezzar II of Babylon. – Dec 14, 2021 (January 3, 2023)

Journal Archives - Leon Davey 'Art'

But notice, today these fasts mainly by Jews — the “house of Judah” — will turn to be a joy and into “gladness and cheerful feasts.” How so, you may ask? God must have accepted their fasts prayers and those who participate in them would be duly rewarded. Those who fast will turn into joy! Extra blessings await those who touches the heart of God.

These four fasts are all related to Jerusalem, God’s beloved city with its Temple where God initially told Moses to build a sanctuary for Him to dwell. Thus, they needed to be done with the right attitude:

“Speak unto all the people of the land, and to the priests, saying, ‘When ye fasted and mourned in the fifth and seventh month even those seventy years, did ye fast at all unto Me, even to Me?” Zechariah 7:5

“When you held days of fasting every fifth and seventh month all these seventy years, were you doing it for me? And when you held feasts, was that for me?” MSG

The right attitude means to care about God, to think about his welbeing; for he asks: do you fast for me?

The final place for this sanctuary or Temple was and is to be in Jerusalem, and God wants to dwell with us.

At that time they shall call Jerusalem the Throne of the LORD and all the nations shall be gathered unto it, to the name of the LORD, to Jerusalem. Jeremiah 3:17

“Thus saith the LORD God: This is Jerusalem. I have set it in the midst of the nations and countries that are round about her. Ezekiel 5:5

And many nations shall come and say, “Come, and let us go up to the mountain of the LORD, and to the house of the God of Jacob. And He will teach us of His ways, and we will walk in His paths.” For the law shall go forth from Zion, and the word of the LORD from Jerusalem. Micah 4:2

Hedges: The Collapse of the American Empire

•July 15, 2021 • Leave a Comment

The American Empire will Collapse within a Decade, Two at Most.

Chris Hedges / April 19, 2021

U.S. leadership has stumbled from one military debacle to another, a trajectory mirroring the sad finales of other historical imperial powers.

America’s defeat in Afghanistan is one in a string of catastrophic military blunders that herald the death of the American empire.

With the exception of the first Gulf War, fought largely by mechanized units in the open desert that did not—wisely—attempt to occupy Iraq, the United States political and military leadership has stumbled from one military debacle to another. Korea. Vietnam. Lebanon. Afghanistan. Iraq. Syria. Libya.

The trajectory of military fiascos mirrors the sad finales of the Chinese, Ottoman, Hapsburg, Russian, French, British, Dutch, Portuguese and Soviet empires. While each of these empires decayed with their own peculiarities, they all exhibited patterns of dissolution that characterize the American experiment.

There is not a single case since 1941 when the coups, political assassinations, election fraud, black propaganda, blackmail, kidnapping, brutal counter-insurgency campaigns, U.S. sanctioned massacres, torture in global black sites, proxy wars or military interventions carried out by the United States resulted in the establishment of a democratic government. The two-decade-long wars in the Middle East, the greatest strategic blunder in American history, have only left in their wake one failed state after another. Yet, no one in the ruling class is held accountable.

War, when it is waged to serve utopian absurdities, such as implanting a client government in Baghdad that will flip the region, including Iran, into U.S. protectorates, or when, as in Afghanistan, there is no vision at all, descends into a quagmire. The massive allocation of money and resources to the U.S. military, which includes Biden’s request for $715 billion for the Defense Department in fiscal year 2022, a $11.3 billion, or 1.6 percent increase, over 2021, is not in the end about national defense. The bloated military budget is designed, as Seymour Melman explained in his book, “The Permanent War Economy,” primarily to keep the American economy from collapsing. All we really make anymore are weapons. Once this is understood, perpetual war makes sense, at least for those who profit from it.

Biden to Withdraw Combat Troops From Afghanistan by Sept. 11 - The New York  Times

The idea that America is a defender of democracy, liberty and human rights would come as a huge surprise to those who saw their democratically elected governments subverted and overthrown by the United States in Panama (1941), Syria (1949), Iran (1953), Guatemala (1954), Congo (1960), Brazil (1964), Chile (1973), Honduras (2009) and Egypt (2013). And this list does not include a host of other governments that, however despotic, as was the case in South Vietnam, Indonesia or Iraq, were viewed as inimical to American interests and destroyed, in each case making life for the inhabitants of these countries even more miserable.

“The two-decade-long wars in the Middle East, the greatest strategic blunder in American history, have only left in their wake one failed state after another. Yet, no one in the ruling class is held accountable” Chris Hedges.

I spent two decades on the outer reaches of empire as a foreign correspondent. The flowery rhetoric used to justify the subjugation of other nations so corporations can plunder natural resources and exploit cheap labor is solely for domestic consumption. The generals, intelligence operatives, diplomats, bankers and corporate executives that manage empire find this idealistic talk risible. They despise, with good reason, naïve liberals who call for “humanitarian intervention” and believe the ideals used to justify empire are real, that empire can be a force for good. These liberal interventionists, the useful idiots of imperialism, attempt to civilize a process that was created and designed to repress, intimidate, plunder and dominate.

Afghan Retreat: U.S. Formally Withdrawing from Its Longest War — Naharnet

The liberal interventionists, because they wrap themselves in high ideals, are responsible for numerous military and foreign policy debacles. The call by liberal interventionists such as Barack Obama, Hillary Clinton, Joe Biden, Susan Rice and Samantha Power to fund jihadists in Syria and depose Muammar Gaddafi in Libya rent these countries—as in Afghanistan and Iraq—into warring fiefdoms. The liberal interventionists are also the tip of the spear in the campaign to rachet up tensions with China and Russia.

Russia is blamed for interfering in the last two presidential elections on behalf of Donald Trump. Russia, whose economy is roughly the size of Italy’s, is also attacked for destabilizing the Ukraine, supporting Bashar al-Assad in Syria, funding France’s National Front party and hacking into German computers. Biden has imposed sanctions on Russia—including limits on buying newly issued sovereign debt—in response to allegations that Moscow was behind a hack on SolarWinds Corp. and worked to thwart his candidacy.

At the same time, the liberal interventionists are orchestrating a new cold war with China, justifying this cold war because the Chinese government is carrying out genocide against its Uyghur minority, repressing the pro-democracy movement in Hong Kong and stealing U.S. patents. As with Russia, sanctions have been imposed targeting the country’s ruling elite. The U.S. is also carrying out provocative military maneuvers along the Russian border and in the South China Sea.

As US troops prepare to pull out, a look at the war in Afghanistan by the  numbers - ABC News

The defeat in Afghanistan is a familiar and sad story, one all those blinded by imperial hubris endure. The tragedy, however, is not the collapse of the American empire, but that, lacking the ability to engage in self-critique and self-correction, as it dies it will lash out in a blind, inchoate fury at innocents at home and abroad.

MIT Predicted in 1972 That Society Will Collapse This Century. New Research Shows We’re on Schedule.

“I also will do this unto you: I will even appoint over you terror, consumption, and the burning ague that shall consume the eyes and cause sorrow of heart; and ye shall sow your seed in vain, for your enemies shall eat it. And I will set My face against you, and ye shall be slain before your enemies; they that hate you shall reign over you, and ye shall flee when none pursueth you.” Leviticus 26:16-17

What are the Oracles of God? (Part I)

•July 15, 2021 • Leave a Comment

What are the Oracles of God? (Part I)

What are the Oracles of God committed to the Jews? What are Oracles anyway?

Romans 3:1 What advantage then hath the Jew? Or what profit is there in circumcision?

2. Much in every way; chiefly because unto them were committed the oracles of God. 3. For what if some did not believe? Shall their unbelief make the faithfulness of God without effect? 4. God forbid! Yea, let God be true, but every man a liar. As it is written: “That Thou mightest be justified in Thy sayings, and mightest overcome when Thou art judged.”

So what are these Oracles committed to only one group of people on earth to manage?

The Oracles of God Committed unto the Jews – Purely Presbyterian
But what are the components of these Oracles?

The Oracles is designated by Strong to be G3051 logion of God

Strong’s Outline of Biblical Usage

  • a brief utterance, a divine oracle (doubtless because oracles were generally brief)
  • in the NT, the words or utterances of God
  • of the contents of the Mosaic law

There are four times in the New Testament this word oracles (logion G3051) of God are used:

Act 7:38 This is he, that was in the church in the wilderness with the angel which spake to him in the Mount Sinai, and with our fathers: who received the lively oracles (G3051) to give unto us:

Rom 3:2 Much every way: chiefly, because that unto them were committed the oracles (G3051) of God.

Heb 5:12 For when for the time ye ought to be teachers, ye have need that one teach you again which be the first principles of the oracles (G3051) of God; and become such as have need of milk, and not of strong meat.

1 Pe 4:11 If any man speak, let him speak as the oracles (G3051) of God; if any man minister, let him do it as of the ability which God giveth: that God in all things may be glorified through Jesus Christ, to whom be praise and dominion for ever and ever. Amen.

The Greek word Logion is related to Logos! The Greek phrase translated as “oracles of God” is logion Theos (logion G3051 being the plural form of logos).

In the New Testament, in John 1:1 In the beginning was the Word (G3056 logos), and the Word (logos) was with God, and the Word (logos) was God. Thus the term oracles of God could be translated as the “Words of God.” 

But sometimes the term oracles has been used by some Bible translators as are the messages or words of God. In Acts 7:38, Stephen speaks of how Moses received “living oracles to give to us” — a reference to the life-giving nature of God’s Word.

Romans 3:2 mentions the oracles of God: “To begin with, the Jews were entrusted with the oracles of God.” Paul highlights the fact that the Jews who received, copied, and preserved the Tanakh had been entrusted with the very Words of God.

In our twentieth-first century, the Scriptures or Bible has been delivered to us, all seems intact, but it’s not so simple. The Scriptures we have today have many components, all put together, some written, some not written. So what are the components of the Oracles (Words) of God?

No vowels in the original Hebrew Text that Moses wrote, only alphabets.

(1) The Hebrew alphabet. But unfortunately the original written Words of God couldn’t be understood without the “unwritten” Words of God – the written Words have no vowels! It was just the bones! 

(2) Only when the unwritten vowels were incorporated into the Texts could the Words of God be read and understood. The unwritten are the flesh. The bones and flesh constitute a whole. Like it or not, our standard Bible, like the King James, has already incorporated the unwritten words or the oral Words of God into the written Text. “In the beginning God created the heaven and the earth” has a combination of both the Written and Oral Words of God.

(3) The Words of God also include the case law that had been decided by the judges (or oral law)

Deuteronomy 16:18 “Judges and officers shalt thou make thee in all thy gates which the Lord thy God giveth thee, throughout thy tribes; and they shall judge the people with just judgment. 

19 Thou shalt not distort judgment; thou shalt not respect persons, neither take a bribe; for a bribe doth blind the eyes of the wise and pervert the words of the righteous.

Deuteronomy 17:11 According to the sentence of the law which they shall teach thee and according to the judgment which they shall tell thee, thou shalt do. Thou shalt not decline from the sentence which they shall show thee to the right hand nor to the left. 

12 And the man who will do presumptuously, and will not hearken unto the priest who standeth to minister there before the Lord thy God, or unto the judge, even that man shall die; and thou shalt put away the evil from Israel. 

13 And all the people shall hear, and fear, and do no more presumptuously.

The Set of Letters of the Hebrew alphabet | Hebrew alphabet, Hebrew,  Alphabet
Ezra changed the Paleo Scripts to Square ones but still no vowels. Vowels were added Millennium later in the 10th Century AD.

(4) The unspoken Word or the unspoken Will of God. These are for those who are willing and happy to go the extra mile, so what are they?

Four fasts – Zechariah 8:19 “Thus saith the Lord of hosts: ‘The fast of the fourth month, and the fast of the fifth, and the fast of the seventh, and the fast of the tenth, shall be to the house of Judah joy and gladness and cheerful feasts. Therefore love the truth and peace.’

The Scriptures do not give any details, but they are in the Oral Law:

Ninth of Av (Tisha B’Av, full fast) — fall of Jerusalem on the same dates in 587 BC and 70 AD. – July 18, 2021

Fast of Gedalia (Tzom Gedalia, minor fast) — assassination of Gedaliah, the righteous governor of Judah (II Kings 25:22–26). – Sept 9, 2021

Tenth of Tevet (Asara B’Tevet, minor fast) — the siege of Jerusalem by Nebuchadnezzar II of Babylon. – Dec 14, 2021

Seventeenth of Tammuz (Shiva Asar B’Tammuz, minor fast) — the breaching of the walls of Jerusalem before the destruction of the Second Temple in 70 AD. – June 27, 2021

But notice, these fasts by the “house of Judah” will turn to be a joy and into “gladness and cheerful feasts.” How so, you may ask? God must have accepted their prayers and fasts and will be duly rewarded. These four fasts are all related to Jerusalem, God’s beloved city.

Aleppo Codex | Hebrew Bible | Britannica
Aleppo Codex – the first Hebrew Text to be written with vowels in the 10th Century AD.

Zechariah 8:1 Again the word of the LORD of hosts came to me, saying,

2 Thus saith the LORD of hosts; I was jealous for Zion with great jealousy, and I was jealous for her with great fury.

3 Thus saith the LORD; I am returned unto Zion, and will dwell in the midst of Jerusalem: and Jerusalem shall be called a city of truth; and the mountain of the LORD of hosts the holy mountain.

(5) Out of the unwritten Word of God came also rules and regulations in determining the calendar. During the time of Christ, the Sanhedrin met in a building called the Hall of Hewn Stones near the Temple in Jerusalem. When the new month should start depends on the crescent new moon actually being seen by at least two witnesses. The word “this” (in this verse in Exodus 12:2, “This month shall be unto you”) implies something that is actually seen. These witnesses could be local or from the Diaspora who arrived in Jerusalem to testify. And the phrase “be unto you” means the calendar is being given to us the layman, and not for the layman each to determine the calendar for ourselves.

The rabbis of the Sanhedrin would question the witnesses in the sightings of the moon on their arrival. They knew what the proper responses to their questions ought to be, and were thus quickly able to identify fraudulent claims. Starting with the elder of each pair, they would ask: “Tell us how you saw the moon.”

On whether to declare a leap year on a given year, the Sanhedrin considered several factors in the course of their deliberations. The primary factor, which may or may not override other factors, was the spring equinox.

(a) If the spring equinox would fall later than the first half of Nissan (from the 16th onward), then the year could be declared a leap year. This is because Passover should be observed “in its appointed season” (Numbers 9:2-3). Again “in its appointed season” is defined by the Oral Law as in the spring.

(b) However, it wasn’t enough for Passover to fall after the equinox, when it was “officially” spring; spring-like conditions needed to be evidenced. If in the land of Israel, the barley had not yet ripened, and the trees were not yet blossoming with seasonal fruit — that, too, was sufficient reason to delay Nissan by adding a second month of Adar. Spring had to be felt; it had to be bright and green.

(c) There were also several non-season-related factors which the Sanhedrin considered. For example, if the roads or bridges were in disrepair due to the winter rainy season, impeding the ability of the pilgrims to travel to Jerusalem for Passover.

This was an advantage to the Jews because they have God’s Words. Of course, this advantage was not only applicable to those who believed the gospel, but even to those who don’t believe. Roman 3:4 – God forbid their advantage be disadvantaged even if they don’t believe; let God be true, but man a liar. — the Words of God, both written and unwritten; And Case Laws, are still committed to the Jews.

“In the beginning God created the heaven and the earth.” The above is a combination of both the written and oral Words of God.

And the man who will do presumptuously, and will not hearken unto the Sanhedrin who were and are designated to minister before the LORD thy God, even that man shall die.

Deuteronomy 17:12 And the man who will do presumptuously, and will not hearken unto the priest who standeth to minister there before the Lord thy God, or unto the judge, even that man shall die; and thou shalt put away the evil from Israel. 

13 And all the people shall hear, and fear, and do no more presumptuously.

It’s a death penalty “that man shall die” because mankind have been found guilty of being presumptuous or acting presumptuously by creating our own calendars.

What are the Oracles of God? (Part II)

Is there a Calendar Omen?

US’s Bio-experiment on fellow Americans?

•July 13, 2021 • Leave a Comment

IS FORT DETRICK A SOURCE of COVID-19?

During World War II, CAMP DETRICK became the site of intensive biological warfare research. But after the War, Gen MacArthur took Japan’s Unit 731 scientists home from Harbin, CHINA (including Shiro Ishii and many of his 3,607 associates); fed, nourished and gave them immunity; and FORT DETRICK (renamed after a 1956 expansion to 1,200 acres today) was where these Japanese criminals ended up; and where the US’s bio-weapon program got its foreign GERM and CHEMICAL research momentum and expansion.

JAPAN’S Shiro Ishii and his cohorts conducted live human vivisections and other biological experimentation in Harbin, CHINA, and after WWII were transferred to FORT DETRICK

Believe it or not, American’s Bio-experiment on fellow Americans?

OPERATION WHITECOAT

Operation Whitecoat was a biodefense medical research program carried out by the United States Army at Fort Detrick, Maryland between 1954 and 1973. The program pursued medical research using volunteer enlisted personnel who were eventually nicknamed “Whitecoats”.

These volunteers, all conscientious objectors, including many members of the Seventh-day Adventist Church, were informed of the purpose and goals of each project before providing consent to participate in any project. These “volunteers” were conscientious objectors — who volunteered to expose themselves to deadly viruses and bacteria, rather than go to war.

Japanese Forces Battle Of Shanghai

Over a 20-year period beginning in the 1950s, about 2,300 were infected at Fort Detrick with Q fever, yellow fever, Rift Valley fever, Hepatitis A, Yersinia pestis (Plague), Tularämie (Hasenpest) and other germ warfare experiments.

The justification of their research was to defend troops and civilians against biological weapons and it was believed that the Soviet Union was engaged in similar activities. Much of the actual tests were subjected to confidentiality and visitors are not allowed at Fort Detrick. This also applies to the former participants.

Although the program was discontinued in 1973, human use research for biodefense purposes is still conducted at the U.S. Army Medical Research Institute of Infectious Diseases (USAMRIID) at Fort Detrick and at other government and civilian research institutes. However, these post-Whitecoat studies are often human use challenge studies, in which a person is inoculated with a known pathogen to determine how effective an investigational treatment will be.

Second Sino-Japanese War Bombing

Says USAToday:

Operation Whitecoat tests were done under the cloud of the Cold War and at a time when people rarely scrutinized the workings of government. It was a time when the government conducted some dubious experiments, such as the infamous Tuskegee experiments in which scientists studied the progression of syphilis in untreated poor black men.

OPERATION BIG ITCH AND OPERATION DROP KICK

Operation Big Itch and Operation Drop Kick, the corps explored the feasibility of using fleas and mosquitoes as weapons. Declassified government documents apparently show tests were conducted, but with uninfected mosquitoes.

In 1956, the Corps conducted Operation Drop Kick when they released 600,000 uninfected mosquitoes from a plane at Avon Park Bombing Range, Florida. Within a day, the mosquitoes had spread a distance of between one and two miles and had bitten many people. The mosquitos were released across several Black communities in Florida. In the predominantly Black community of Avon Park, dozens of Black people became ill, and eight people died.

In 1958, further tests discovered at Avon Park AFB, Florida, mosquitoes could quickly be disseminated from helicopters, would spread more than a mile in each direction and would enter all types of buildings.”

A longtime Avon Park resident, Beatrice Peterson, didn’t know about mosquito releases but recalled that screwworm flies were released in the mid to late 1950s. She was only 14-years-old at the time.

“We know they released some flies, but what was the reason and why, I can’t remember why because we were in school back in the 1950s,” Peterson said. “Occasionally we would see them when they fly over and drop the little boxes out. Evidently the boxes were supposed to open up.”

A similar operation took place over Georgia, “Operation Big Buzz.” The experiment occurred in May 1955 in the U.S. State of Georgia. The operation was a field test designed to determine the feasibility of producing, storing, loading into munitions, and dispersing from aircraft the yellow fever mosquito (though these were not infected for the test).

Victims Along Qinhuai River

The second goal of the operation was to determine whether the mosquitoes would survive their dispersion and seek meals on the ground. When the mosquitoes were collected and it was determined that they were actively feeding on the blood of humans.

Operation Big Itch was a September 1954 series of tests at Dugway Proving Ground in Utah. The tests were designed to determine coverage patterns and survivability of the tropical rat flea (Xenopsylla cheopis) for use in biological warfare as a disease vector. The fleas were loaded into two types of munitions and dropped from the air.

The E14 bomb and E23 bomb, which could be clustered into the E86 cluster bomb and E77 bomb, respectively. When the cluster bombs reached 2,000 or 1,000 feet the bomblets would drop via parachute, disseminating their vector. Big Itch proved successful, and the tests showed that not only could the fleas survive the fall from an airplane but they also soon attached themselves to hosts.

JAPAN’S Unit 731 Site, R&D Experimental Camp, Harbin, CHINA

Are any of these experiments not having their origins at FORT DETRICK? Yes, they are:

And this is from Wikipedia:

Jeffrey Alan Lockwood wrote in 2009 that the biological warfare program at Ft. Detrick began to research the use of insects as disease vectors going back to World War II and also employed German and Japanese scientists after the war who had experimented on human subjects among POWs and concentration camp inmates.

Scientists used or attempted to use a wide variety of insects in their biowar plans, including fleas, ticks, ants, lice and mosquitoes – especially mosquitoes that carried the yellow fever virus. They also tested these in the United States.

Lockwood thinks that it is very likely that the U.S. did use insects dropped from aircraft during the Korean War to spread diseases, and that the Chinese and North Koreans were not simply engaged in a propaganda campaign when they made these allegations, since the Joint Chiefs of Staff and Secretary of Defense had approved their use in the fall of 1950 at the “earliest practicable time”. At that time, it had five biowarfare agents ready for use, three of which were spread by insect vectors.

Japanese experiment unit 731 images

See also in Wikipedia:

Wikipedia:

Entomological testing on fellow Americans
Further information: U.S. Cold War entomological warfare program

The United States seriously researched the potential of entomological warfare (EW) during the Cold War. EW is a specific type of biological warfare which aims to use insects as weapons, either directly or through their potential to act as vectors. During the 1950s the United States conducted a series of field tests using entomological weapons.

Bodies On The Stairs

Operation Big Itch [in Utah], in 1954, was designed to test munitions loaded with uninfected fleas (Xenopsylla cheopis).

In May 1955 over 300,000 yellow fever mosquitoes (Aedes aegypti) were dropped over parts of the U.S. state of Georgia to determine if the air-dropped mosquitoes could survive to take meals from humans. The mosquito tests were known as Operation Big Buzz.

The U.S. engaged in at least two other EW testing programs, Operation Drop Kick and Operation May Day. A 1981 Army report outlined these tests as well as multiple cost-associated issues that occurred with EW.

Japanese experiment unit 731 images

In civilian venues
Medical experiments were conducted on a large scale on civilians who had not consented to participate. Often, these experiments took place in urban areas in order to test dispersion methods.

Questions were raised about detrimental health effects after experiments in San Francisco, California, were followed by a spike in hospital visits; however, in 1977 the Centers for Disease Control and Prevention determined that there was no association between the testing and the occurrence of pneumonia or influenza. The San Francisco test involved a U.S. Navy ship that sprayed Serratia marcescens from the bay; it traveled more than 30 miles.

One dispersion test involved laboratory personnel disguised as passengers spraying harmless bacteria in Washington National Airport.

Children At Unit 731

“Scientists” tested biological pathogens, including Bacillus globigii, which were thought to be harmless, at public places such as subways. Light bulbs containing Bacillus globigii were dropped in New York City’s subway system; the result was strong enough to affect people prone to illness (also known as Subway Experiment). Based on the circulation measurements, thousands of people would have been killed if a dangerous microbe was released in the same manner. The Chicago subway system was also subject to a similar experiment by the Army.

A jet aircraft released material over Victoria, Texas, that was monitored in the Florida Keys.

Much information about these programs remained classified and kept secret. How many of these experiments were initiated from FORT DETRICK and its 7,900 researchers? Why was FORT DETRICK closed from July 2019 to November 29, 2019? Why did this closure of FORT DETRICK coincide with the timeline of “vaping illness,” the pandemic flu and COVID-19? And why does this mysterious EVALI disease look exactly like COVID-19, and even accurately matches its epidemic footprint?

Who is Fantahun Woldesenbet? Active shooter in Frederick, Maryland
FORT DETRICK / UNIT 731 Transplant / USAMRIID with 7,900 Researchers / 1,200 ACRES

Could the following narrative be possible?

1) Fort Detrick was shut down after a cease and desist order to the organisation in July, 2019 due to multiple violations of procedure.
2) An outbreak of ‘influenza’ killed something like 10,000 people in the US in August 2019.
3) In October 2019 there was a US organised event ‘Event 201 – A Global Pandemic Exercise’ which simulated a very similar scenario to the actual pandemic.
4) From October 18 – 27, the 2019 Military World Games was held in Wuhan. Could the SARS-Cov-2 virus be released while the US Army team were there?

Wikipedia:

From 1950 through 1953, the U.S. Army conducted Operation LAC (Large Area Coverage), spraying chemicals over six cities in the United States and Canada, in order to test dispersal patterns of chemical weapons. Army records stated that the chemicals which were sprayed on the city of Winnipeg, Manitoba, Canada, included zinc cadmium sulfide, which was not thought to be harmful.A 1997 study by the U.S. National Research Council found that it was sprayed at levels so low as not to be harmful; it said that people were normally exposed to higher levels in urban environments.

For more about Time reported high cancer rate, Agent Orange and anthrax, weaponized botulism and radioactive carbon here. John Hopkins Public Health news here. Baltimore Sun here. For those living near Fort Detrick and are affected by sickness, diseases, cancer or any other illness, please check here.

“Therefore as I live, saith the LORD God, surely because thou hast defiled My sanctuary with all thy detestable things and with all thine abominations, therefore will I also diminish thee; neither shall Mine eye spare, neither will I have any pity.

“A third part of thee shall die with the pestilence, and with famine shall they be consumed in the midst of thee; and a third part shall fall by the sword round about thee; and I will scatter a third part into all the winds, and I will draw out a sword after them.” Ezekiel 5:11-12

Aso: Japan will defend Taiwan

•July 11, 2021 • Leave a Comment

FORT DETRICK – SOURCE of COVID-19?

During World War II, Fort Detrick became the site of intensive biological warfare research. But after the War, Gen MacArthur took Japan’s Unit 731 scientists home (including Shiro Ishii and 3,607 of his associates) and gave them immunity; and Fort Detrick was where these Japanese scientists ended up; and where the US’s bio-weapon program got its foreign GERM research momentum and expansion.

Japan would have to defend Taiwan together with the US in the event of a major problem, Kyodo News reported on July 06, 2021 Japanese Deputy Prime Minister Taro Aso as saying, marking some of the highest-level remarks from Tokyo on a hot subject.

In comments at a political fundraising party in Tokyo on Monday, Aso said an invasion of Taiwan by China could be seen as an existential threat, allowing Japan to exercise the right to collective self-defense.

JAPAN’s Imperial Army, Creator of Unit 731 bio-warfare program in Harbin, CHINA, whose data were later transferred to Fort Detrick, USA

The reason why Japan keeps hyping up the so-called external threats is obvious: it needs to constantly exaggerate the situation so it can turn these into public opinion to support revising its pacifist constitution. And to increase its military budget!

China, on the other hand, said Aso’s comments were “extremely wrong and dangerous.”

Chinese Ministry of Foreign Affairs spokesman Zhao Lijian told a regular news conference in Beijing that “we will never allow any country in any way to interfere in the Taiwan question, and nobody should underestimate the Chinese people’s strong determination, will and ability to safeguard national sovereignty.”

And earlier, Chinese President Xi Jinping had pledged to complete “reunification” with Taiwan and vowed to “smash” any attempts at formal independence.

“Resolving the Taiwan question and realizing China’s complete reunification is a historic mission and an unshakable commitment of the CPC,” Xi said with an eye for an October 1, 2049 celebration. “Anyone who would attempt to do so will find themselves on a collision course with a great wall of steel forged by over 1.4 billion Chinese people.”

Why Japan is ‘digging own grave’ by offering to defend Taiwan from China: Also Japan past Atrocities by British vlogger Alexander Mercouris for his insightful presentation:

And I will destroy your high places, and cut down your images, and cast your carcasses upon the carcasses of your idols; and My soul shall abhor you.

And I will make your cities waste and bring your sanctuaries unto desolation, and I will not smell the savor of your sweet odors.

And I will bring the land into desolation, and your enemies who dwell therein shall be astonished at it. And I will scatter you among the heathen, and will draw out a sword after you; and your land shall be desolate and your cities waste. Leviticus 26:30-33

The Coming War on China

•July 10, 2021 • Leave a Comment

The Coming War on China – A True Documentary

The Coming War on China, from award winning journalist John Pilger, reveals what the news doesn’t – that the world’s greatest military power, the United States, and the world’s second economic power, China, both nuclear-armed, may well be on the road to war.

Marshall Islanders being Betrayed with Unclear Fallout, Radiation (cancer, miscarriages, deformities, thyroid disorders, leukemia) and Death.

Nuclear war is not only imaginable, but planned. The greatest build-up of NATO military forces since the Second World War is under way on the western borders of Russia. On the other side of the world, the rise of China is viewed in Washington as a threat to American dominance.

To counter this, President Obama announced a ‘pivot to Asia’, which meant that almost two-thirds of all US naval forces would be transferred to Asia and the Pacific, their weapons aimed at China. A policy which has been taken up by his successor Donald Trump, who during his election campaign said “We can’t continue to allow China to rape our country and that’s what they’re doing”.

Filmed on five possible front-lines across Asia and the Pacific over two years, the story is told in chapters that connect a secret and ‘forgotten’ past to the rapacious actions of great power today and to a resistance, of which little is known in the West.

This is also the US’s use and experimentation of weapons of mass destruction, about bio and chemical weapon experiments all along the islands of the South Pacific, about how these islanders were burned, and how they died.

Credit to John Pilger for his brave journalism.

“Woe to the crown of pride, to the drunkards of Ephraim, whose glorious beauty is a fading flower, which is on the head of the fat valleys of them that are overcome with wine!” Isaiah 28:1

“And it shall come to pass that as the Lord rejoice over you to do you good and to multiply you, so the LORD will rejoice over you to destroy you and to bring you to nought; and ye shall be plucked from off the land whither thou goest to possess it.” Deuteronomy 28:63

US’s Biowarfare in Cuba?

•July 9, 2021 • Leave a Comment

FORT DETRICK – SOURCE of COVID-19?

During World War II, Fort Detrick became the site of intensive biological warfare research using various pathogens. But after the War, the U.S. government under Gen MacArthur, Supreme Commander of the Allied Forces, gave immunity and took Japan’s Unit 731 scientists home (including Shiro Ishii and 3,607 of his associates); and this is how Fort Derrick was where many of the Japanese scientists ended up; and where the U.S.’s bio-weapon program got its foreign momentum, expanded and its effects worldwide.

Shirō Ishii - Alchetron, The Free Social Encyclopedia
JAPAN’S General Shiro Ishii with his cohorts administrated and conducted live human vivisections and other biological experimentation in Harbin, CHINA

So, is there any U.S.’s biowarfare in Cuba?

JFK Files Reveal US Biological Warfare Plans Against Cuba

In the summer of 1975, congressional staffer Loch Johnson was searching through classified papers at the LBJ Library in Austin, Texas, when he came across something he couldn’t believe — a covert plan by the US military to deploy biological weapons against Cuba.

The American public knew that their government had a tense relationship with Cuba, especially with its feisty leader, Fidel Castro. The US had unsuccessfully underwritten a Cuban-exile paramilitary invasion at the Bay of Pigs in 1961 — a disaster in every sense. And just a year later, the world came to the brink of nuclear apocalypse after a showdown with the Soviet Union over nuclear missiles it had placed in Cuba.

Johnson relayed to his superiors at the Church Committee the details of project SQUARE DANCE:

The proposal envisioned the destruction of the Cuban economy by introducing aerially from off-shore a sugar cane plant parasite called Bunga. The program would begin with a 30 percent reduction of anticipated Cuban sugar production and within three-to-six years the ruination of the sugar industry would be achieved.

Weapon of mass destruction - Wikipedia
U.S.’s Bio-Weapon Program Worldwide and even against the U.S.?

But that wasn’t all. Johnson quoted directly from the JCS memo:

The economic and political disturbances caused by this attack could be exacerbated and exploited by such measures as spreading hoof-and-mouth disease among draft animals, controlling rainfall by cloud seeding, mining canefields, burning cane, and directing other acts of conventional sabotage against the cane milling and transportation systems.

Hoof-and-mouth disease (sometimes referred to as foot-and-mouth disease) is highly infectious and affects farm animals such as cattle, sheep, goats, and pigs. The disease causes high fevers followed by blisters in the animal’s mouth and feet. While very rarely affecting humans, it can bring devastating economic consequences to farmers. Containing a 2001 outbreak in the UK cost some £8bn ($12bn) in public and private outlays.

The longest-serving non-royal head of state in the 20th and 21st centuries, Castro secured Cuba’s independence and became a thorn to US hegemony.

A JFK document released last year revealed an intelligence memorandum from 1962 discussing the possibility of using biological agents to induce crop failure “which would appear to be of natural origin.” A US Army memo from 1963, recently released by the National Archives, lists a number of “Ideas to Exploit Cuban Vulnerabilities,” including the initiation of “biological warfare against vegetable and animal tissue (except human).”

The October 30,1964, memo, referenced in Johnson’s book National Security Intelligence but digitally released last month by the National Archives, gives us a clearer picture of what that might have looked like.

“Bunga,” known also as Aeginetia Indica, is a flowering weed that acts as a root parasite to nearby plants. It can be particularly harmful to sugarcane crops, which were Cuba’s primary economic output. US intelligence sabotage efforts had long targeted sugar crops, including night raids from offshore boats planting incendiary devices in fields. But this was something different.

Like the earlier memo from 1962, this one mentions the need for deniability: “It appears feasible to introduce gradually Bunga into Cuba and maintain a basis for plausibly disavowing US involvement.”

JFK Files Reveal US Biological Warfare Plans Against Cuba - WhoWhatWhy
JFK Files Reveal US Biological Warfare Plans Against Cuba

Biowarfare over Cuban skies

Wikipedia:

It has been rumored that the U.S. employed biological weapons against the Communist island nation of Cuba. Noam Chomsky claimed that evidence exists implicating the U.S. in biological warfare in Cuba, but these claims are disputed. Allegations in 1962 held that CIA operatives had contaminated a shipment of sugar while it was in storage in Cuba.

Also in 1962, a Canadian agricultural technician assisting the Cuban government claimed he was paid $5,000 to infect Cuban turkeys with the deadly Newcastle disease. Though the technician later claimed he had just pocketed the money, many Cubans and some US citizens believed a clandestinely administered biological weapons agent was responsible for a subsequent outbreak of the disease in Cuban turkeys.

In 1971 the first serious outbreak of African Swine Fever in the Western Hemisphere occurred in Cuba. The Cuban government alleged that U.S. covert biological warfare was responsible for this outbreak, which led to the preemptive slaughter of 500,000 pigs. The outbreak was labeled the “most alarming event” of 1971 by the United Nations Food and Agricultural Organization.

Six years after the event, the newspaper Newsday, citing untraceable sources, claimed that anti-Castro saboteurs, with at least the tacit backing of U.S. Central Intelligence Agency officials, introduced African swine fever virus into Cuba six weeks before the outbreak in 1971, to destabilize the Cuban economy and encourage domestic opposition to Fidel Castro. The virus was allegedly delivered to the operatives from an army base in the Panama Canal Zone by an unnamed U.S. intelligence source. Evidence linking these incidents to biological warfare has not been confirmed.

Accusations have continued to come out of Havana charging U.S. use of bio-weapons on the island, after the official end of the US biological weapons program in 1973. The Cuban government blamed the U.S. for a 1981 outbreak of dengue fever that sickened more than 300,000. Dengue, a vector-borne disease usually carried by mosquitoes, killed 158 people that year in Cuba, including 101 children under 15. Tensions between the two countries, coupled with confirmed U.S. research into entomological warfare during the 1950s, made these charges seem not implausible to some people.

For behold, the LORD will come with fire, and with His chariots like a whirlwind, to render His anger with fury and His rebuke with flames of fire. For by fire and by His sword will the LORD plead with all flesh; and the slain of the Lord shall be many. Isaiah 66:15

US’s Biowarfare in Vietnam?

•July 9, 2021 • Leave a Comment

FORT DETRICK – SOURCE of COVID-19?

During World War II, Fort Detrick became the site of intensive biological warfare research. But after the War, Gen MacArthur took Japan’s Unit 731 scientists home (including Shiro Ishii and 3,607 of his associates) and gave them immunity; and Fort Detrick was where these Japanese scientists ended up; and where the US’s bio-weapon program got its foreign GERM research momentum and expansion.

Agent Orange Wasn’t the Only Deadly Chemical Used In Vietnam / Erin Blakemore / Aug 29, 2018

While Agent Orange may be the most well-known chemical used during the Vietnam War, it wasn’t the only one. An entire rainbow of new chemical formulations rained down on Vietnam’s forests and fields. The Rainbow Herbicides, as they were known, were only used as weapons in the war for a little over a decade, but their consequences can still be felt today.

“I remember the sight and the smell of the spray,” recalls Thomas Pilsch, who served as a forward air controller in South Vietnam in 1968 and 1969. In the early morning low angle sunlight, it appeared to have an orange hue.” By spraying Agent Orange, he thought he was helping the United States military bust through Vietnam’s impenetrable jungles on the way to victory.

US plane spraying Vietnam landscape with tainted herbicide/defoliant Agent Orange during the war. (Credit: Dick Swanson/The LIFE Images Collection/Getty Images)
US plane spraying Vietnam landscape with tainted herbicide/defoliant Agent Orange

The U.S. had a rainbow of chemicals at their disposal. They were nicknamed according to the color on the barrels in which they were shipped. (Agent Orange didn’t appear orange, though it looked like that to Pilsch.) Once Operation Ranch Hand began, around 20 million gallons of Agents Green, Pink, Purple, Blue, White, Orange, Orange II, Orange III, and Super Orange were sprayed over South Vietnam. The chemicals were produced by companies like DOW Chemical, Monsanto, and Hercules, Inc.

“Trail dust” operations were conducted by the U.S. Air Force, whose “cowboys” flew C-123s escorted by fighters. As they approached a strategic target—dense, jungled areas that provided cover for the Viet Cong or crops suspected to feed their troops—the fighter jets would shoot down bombs and napalm. Then the sprayers would move in and douse an area with the chemical.

American soldiers were told the chemicals were safe. They were also effective. “We just blew away that jungle,” recalled Tom Essler, a U.S. Marine who served in Vietnam between 1967 and 1968, in an oral history. “Between the B-52 strikes and Agent Orange, that lovely lush jungle around Khe Sanh was turned brown.”

As the jungle died, so did crops. Famine, malnourishment and starvation set in. By the end of the war, over 3.6 million acres had been sprayed with Rainbow Herbicides.

So had millions of Vietnamese people. American soldiers had also been exposed to the herbicides, reassured by their superiors that they presented no risk.

Not true: Sixty-five percent of the United States’ rainbow of chemicals contained dioxins—known carcinogens. Dioxins enter the bloodstream after being eaten or touched, build up in the food chain and can cause reproductive problems, cancer, hormonal interference, immune system damage, and developmental issues.

Year-old conjoined twins being cared for at Hanoi's Viet-Duc hospital, a center for treating deformed children and others who may have been affected by exposure to the defoliant Agent Orange. (Credit: Gary Mangkorn/AP/REX/Shutterstock)
Conjoined twins affected by the defoliant Agent Orange being cared for at Hanoi’s Viet-Duc hospital

Wikipedia:

Contaminated soils, permanent forest loss, soil erosion, and other environmental damage have haunted Vietnam for years. Children of veterans and Vietnamese people exposed to the chemicals were born with serious birth defects and illnesses.

In the 1960s, the U.S. changed its main approach from biological agents aimed to kill to those that would incapacitate. In 1964, research programs studied Enterotoxin type B, which can cause food poisoning. New research initiatives also included prophylaxis, the preventive treatment of diseases. Pathogens studied included the biological agents causing a myriad of diseases such as anthrax, glanders, brucellosis, melioidosis, Venezuelan equine encephalitis, Q fever, coccidioidomycosis, and other plant and animal pathogens.

The Vietnam War brought public awareness to the U.S. biological weapons program. Jeanne Guillemin, wife of biologist Matthew Meselson, summarized the controversy:

The entire experimental legacy is dismaying, from the hundreds of dead monkeys at Fort Detrick to the spectacle of Seventh Day Adventist soldiers, the vaccinated volunteers in Project Whitecoat, strapped to chairs amid cages of animals in the Utah sunlight as Q fever aerosols are blown over them. Most chilling are the mock scenarios played out in urban areas: light bulbs filled with simulated BW agents being dropped in New York subways, men in Washington National Airport spraying pseudo-BW from briefcases, and similar tests in California and Texas and over the Florida Keys.

The Nixon administration felt an urgent need to respond to the growing negative perception of biological weapons. The realization that biological weapons may become the poor man’s atom bomb also contributed to the end of the U.S. biological weapons program. Subsequently, President Nixon announced that the U.S. was unilaterally renouncing its biological warfare program, ultimately signing the Biological and Toxin Weapons Convention in 1972.

President Nixon said at Fort Detrick on November 25, 1969: “The United States shall renounce the use of lethal biological agents and weapons, and all other methods of biological warfare.”

President Richard M. Nixon issued his “Statement on Chemical and Biological Defense Policies and Programs” on November 25, 1969 in a speech from Fort Detrick. The statement ended, unconditionally, all U.S. offensive biological weapons programs. Nixon noted that biological weapons were unreliable and stated:

“The United States shall renounce the use of lethal biological agents and weapons, and all other methods of biological warfare. The United States will confine its biological research to defensive measures such as immunization and safety measures.” President Richard M. Nixon

“Shall a trumpet be blown in the city, and the people not be afraid? Shall there be evil in a city, and the LORD hath not done it?” Amos 3:6

“Slay utterly old and young, both maids and little children and women; . . . and begin at My sanctuary.” Ezekiel 9:6

US’s Biowarfare in Korea?

•July 8, 2021 • Leave a Comment

FORT DETRICK – SOURCE of COVID-19?

INSURGE’s REVEALED: The long-suppressed official report on US biowarfare in North Korea

Excerpts from Medium by Jeffrey Kaye / Feb 21, 2018

Written largely by the most prestigious British scientist of his day, this official report, containing hundreds of pages of evidence about the use of US biological weapons during the Korean War, was effectively suppressed upon its original release in 1952.

Unit 731 - Complex.jpg
WORLD WAR II Japan’s hidden Unit 731 Germ Complex in Harbin, CHINA

Back in the early 1950s, the U.S. conducted a furious bombing campaign during the Korean War, dropping hundreds of thousands of tons of ordnance, much of it napalm, on North Korea. The bombardment, worse than any country had received up to that point, excepting the effects of Hiroshima and Nagasaki, wiped out nearly every city in North Korea, contributing to well over a million civilian deaths. Because of the relentless bombing, the people were reduced to living in tunnels. Even the normally bellicose Gen. MacArthur claimed to find the devastation wreaked by the U.S. to be sickening.

WMD world map.svg
U.S.’s Weapons of Mass Destruction – Napalm, anthrax, plague, and cholera in KOREA

The report concluded that the U.S. had used a number of biological weapons, including use of anthrax, plague, and cholera, disseminated by over a dozen of different devices or methods, including spraying, porcelain bombs, self-destroying paper containers with a paper parachute, and leaflet bombs, among others.

Napalm is a gel that burns at temperatures of 800-1,200 degrees C (1,500-2,200 degrees F).

When napalm falls on people, the gel sticks to their skin, hair, and clothing, causing unimaginable pain, severe burns, unconsciousness, asphyxiation, and often death. Even those who do not get hit directly with napalm can die from its effects since it burns at such high temperatures that it can create firestorms that use up much of the oxygen in the air. Bystanders also can suffer heatstroke, smoke exposure, and carbon monoxide poisoning.

Censorship of Unit 731-U.S. Collaboration on Biological Warfare Data

One important part of the ISC report guaranteed its suppression in the United States after its initial publication. The report discussed the activities of Imperial Japan’s biological warfare detachment, Unit 731, and the U.S. interest in its activities.

Back in 1952, collaboration between the U.S. and Japanese war criminals using biological weapons was top secret, and totally denied by the U.S.

But today, even U.S. historians accept that a deal was made between the U.S. and members of Unit 731 and associated portions of the Japanese military that had in fact been experimenting on the use of biological weapons since the mid-1930s, experimentation that included use of human vivisection and barbaric torture of thousands of human beings, most of whom were disposed of in crematoria. In addition, as described in the book chapter by Bernd Martin noted in the bibliography, there was collaboration between the Japanese and the Nazi regime on these issues.

The U.S. collaboration with Japanese war criminals of Unit 731 was formally admitted in 1999 by the U.S. government, though the documentation for this confession wasn’t published until nearly 20 years later.

It is a matter of historical record now that the U.S. government granted amnesty to Japan’s chief at Unit 731, doctor/General Shiro Ishii and his accomplices. The amnesty was kept top secret for decades, until revealed by journalist John Powell in a landmark article for the Bulletin of Atomic Scientists in October 1981.

[A]t least one scientist working at Ft. Detrick at the time admitted to German documentary investigators before he died that the U.S. had indeed been involved in germ warfare in Korea.

“I have seen a horrible thing in the house of Israel; there is the whoredom of Ephraim, Israel is defiled” Hosea 6:10

“Ephraim shall be desolate in the day of rebuke” Hosea 5:9