NATO’s ‘debt of blood’ for bombing embassy

•July 17, 2023 • Leave a Comment

China has not forgotten NATO’s ‘debt of blood’ for bombing embassy in Yugoslavia — MFA

NATO’s provocative lurch eastward and the ‘supreme fool’ Jens Stoltenberg

When judgement was due, Nebuchadnezzar lost his mind, total; and he was made to dwell among the beasts in the wild; however he regained his sanity after eating grass for seven years.

Now, as another judgement is due, the West has already lost half their sanity; although still humans, they’re behaving like supreme fools!

Tass Russian Agency • July 14, 2023 // Global Times • July 13, 2023

“Isn’t NATO the one who has engaged in bloc politics and military operations around the world, threatening other countries with force and challenging the interests, security and values of the world?” Hua Chunying said.

NATO is submitting to US’s Expansionalist Urge to confront China in Asia

BEIJING, July 14. /TASS/. The Chinese people haven’t forgotten the 1999 bombing of the country’s embassy in Belgrade, which killed three Chinese citizens, Foreign Ministry Spokesperson Hua Chunying said on Twitter.

“We haven’t forgotten the debt of blood NATO owes the Chinese people in bombing the Chinese embassy in Yugoslavia. Asia-Pacific countries don’t welcome a war machine, still less an ‘Asia-Pacific version of NATO’ that stokes bloc confrontation or a new Cold War,” the tweet reads.

“China having coercive policies? Isn’t NATO the one who has engaged in bloc politics and military operations around the world, threatening other countries with force and challenging the interests, security and values of the world?” Hua said.

During Clinton’s NATO 1999 bombing of the Chinese embassy in Belgrade

“Isn’t NATO the one who has trampled underfoot international law and basic norms governing international relations by interfering in other countries’ internal affairs and engaging in wars, causing sufferings to millions of people in the world?” the Chinese diplomat added.

On Tuesday, NATO countries participating in the bloc’s annual summit in Vilnius adopted a communique stating, in particular, that China’s “ambitions and coercive policies” challenge the bloc’s interests, security and values.

The NATO members expressed concern about the expansion and diversification of China’s nuclear arsenal. NATO also believes that the deepening strategic partnership between China and Russia runs counter to its values and interests.

Instead of Nation Building, spending Billions, numerous US Bases Circling China

The communique adds that the EU and NATO will coordinate their steps “to address the systemic challenges posed by the People’s Republic of China to Euro-Atlantic security.” In addition, NATO allies expressed readiness to boost cooperation with their partners in the Asia-Pacific Region, including Australia, New Zealand, South Korea and Japan, in countering common security threats.

In May 1999, a missile struck the Chinese embassy in Belgrade during NATO’s operation in Yugoslavia, killing three Chinese nationals. The alliance claims that the incident was a mistake and the nearby building of the Yugoslav Federal Directorate for Supply and Procurement was the target of the attack.

“For the day of the Lord is near upon all the nations. As you have done, it shall be done to you; your dealings will return upon your own head” Obadiah 1:15

UK passes HK-style Security Law

•July 16, 2023 • Leave a Comment

UK passes Hong Kong-style security law

Some amazing stories this week, which we covered in a short video.

The UK has passed a Hong Kong-style national security law—how ironic. This is an addition to a long line of national security laws and anti-protest laws the UK already has.

Meanwhile, the US national security law gives the CIA the power to assassinate citizens – not making that up! And, yes, it has been used.

We also look at why Hong Kong is annoyed with some of its activists.

And we share an image of the enforcer of America’s national security law: a flying killer robot which has been officially named after the Grim Reaper—didn’t make that up, either.

Isaiah (Ch 11-12)

•July 16, 2023 • Leave a Comment

The Scriptures are often shrouded in cryptic languages; as usual a prophecy of Isaiah will start with the house of Judah and Jerusalem then spread to the house of Israel and soon it includes many prophecies concerning other nations surrounding the region.

However the following may provide a clue:

“The anger of the Lord shall not return, until He has executed and till He has performed the thoughts of His heart; in the latter days ye shall consider it perfectly” Jeremiah 23:20;

“In latter days you will understand it fully,” that is, it means as a whole, we wouldn’t fully understand these prophecies until we’re living in the latter days; after God had executed his judgement in anger and performed the thoughts of his heart!

Our challenge is to decrypt them, especially as it relates to the latter days, our days.

Isaiah 11

1 And there shall come forth a Rod out of the stem of Jesse, and a Branch shall grow out of his roots.

— and there shall come forth a fresh shoot or twig out of the stem of Jesse; he is called a “rod” either because of his unpromising appearance, arising “out of the stem of Jesse” from him, in the line of David;

— out of the stock and a Branch shall grow out of his roots, Zechariah 3:8Zechariah 4:12Jeremiah 23:5Jeremiah 33:15, the root-stock being all that was left of the former grandeur of David’s house, the renewal of his family by this singular Scion would indeed be a miracle;

— second, he is called a “rod” probably he is an instrument of executing a punishment from the hand of the Father to horsewhip his children; the Targum agrees, paraphrasing the words thus, “and a King shall come forth from the sons of Jesse;”

— the Targum confirms this is speaking of the Messiah, “And a king shall come forth from the sons of Jesse, and from his children’s children the Messiah shall be anointed.”

2 And the Spirit of the Lord shall rest upon Him—the Spirit of wisdom and understanding, the Spirit of counsel and might, the Spirit of knowledge and of the fear of the Lord”

— and the Spirit of the Lord shall rest upon him; the rod and branch, the King Messiah, so qualifying him for his office, and the discharge of his duty with the fullness of his power;

— the Spirit of wisdom, which searches all things, even the secrets of God, and understanding, able to make the proper distinction concerning all things,

— the Spirit of counsel, by whom the Messiah is endowed to be the Counselor, and might, for Christ is the mighty God, Isaiah 7:6, the Spirit of knowledge, by means of which he is familiar with all the mysteries of God;

— and of the fear of the Lord, yea “of the fear of the Lord” even the Son has to pay homage to God the Father, the “only true God” praying to his heavenly Father and seeking his leadership, and he was and is to fear his Father, according to his divine nature united with him in an everlasting union as One;

— that night, the night he was betrayed, he had two desires but his requests were denied (1) his desire to eat the Passover with his disciples; (2) his desire for the “cup” to be removed from him (for more see THAT NIGHT COULDN’T BE THE FOURTEENTH!)

3 and shall make Him of quick understanding in the fear of the Lord; and He shall not judge after the sight of His eyes, neither reprove after the hearing of His ears.

— Rashi: and he shall be animated by the fear of the Lord: He shall be filled with the fear of the Lord; that is, even the Son is motivated by the fear of the Lord, Yehovah; the “only true God” John 17:3.

— Q, just curious; how did the Son (the only begotten Son) came into being? Also, could there be another ‘son’ that started well but because of arrogance and pride, eventually went off bad?

— he is highly pleased when men bring to him the sacrifice of their fear of God; and he shall not judge after the sight of his eyes, neither reprove after the hearing of his ears, rendering judgement not according to external appearances, rather according to his understanding of the heart and soul;

4 But with righteousness shall He judge the poor, and reprove with equity for the meek of the earth; and He shall smite the earth with the rod of His mouth, and with the breath of His lips shall He slay the wicked.

— but with righteousness shall he judge the poor, his Savior’s-interest turning especially to the lowly, to those who bear the enmity of the world on account of their faith with the proper meekness, taking the part of those who are persecuted for their confession;

— and he, the Son, shall smite the earth with the rod of his mouth; the ministration of his word, the rod of his strength, rebuking and horsewhipping the hostility of the disobedient world, and with the breath of his lips, his Word, which bears almighty power, shall he slay the wicked, overthrowing the power of Satan and revealing the true character of the Kingdom of God.

5 And righteousness shall be the girdle of His loins, and faithfulness the girdle of His reins.

— and righteousness shall be the girdle of his loins and faithfulness, upon which his believers may rely with full confidence, the girdle of his reins; he was faithful to God, that appointed him as King and Head of the Kingdom; faithful as a Prophet, in declaring his mind and will; and is a faithful High Priest.

6 “The wolf also shall dwell with the lamb, and the leopard shall lie down with the kid; and the calf and the young lion and the fatling together; and a little child shall lead them.

— the wolf also shall dwell with the lamb, and the leopard shall lie down with the kid; and the calf and the young lion and the fatling together; and a little child shall lead them, a figurative representation of ideal spiritual conditions;

— the Targum introduces in this manner, “in the days of the Messiah of Israel, peace shall be multiplied in the earth.”

7 And the cow and the bear shall feed; their young ones shall lie down together; and the lion shall eat straw like the ox.

— during the Millennium the cow and the bear shall feed, all the bloodthirstiness of the latter forgotten; their young ones shall lie down together, his nature so completely changed that he is no longer a carnivorous, but a herbivorous animal; thus the lion shall eat straw like the ox.

8 And the sucking child shall play on the hole of the asp, and the weaned child shall put his hand on the adder’s den.

— and the sucking child, the unweaned infant, shall play on the hole of the asp, on the entrance of the adder’s cave, and the weaned child shall put his hand on the cockatrice’s den, or stretch out his arm to touch the sparkling eye of the basilisk, the poisonous serpents having lost all their vicious habits. All this poetic description is now explained.

9 They shall not hurt nor destroy in all My holy mountain; for the earth shall be full of the knowledge of the Lord, as the waters cover the sea.

— they shall not hurt nor destroy in all my holy mountain, all the members of God’s kingdom, whose former state was characterized by the comparison with the various animals named above, would lose and lay aside their hostile habits toward one another;

— for the earth shall be full of the knowledge of the Lord, as the waters cover the sea. Knowledge of Yehovah, love and fear of God, is the motive in all acts of all believers; because they fear the Lord, because they know him the one true God,

— and the Messiah, Yeshua or Jesus Christ, whom he has sent as the Savior of the world, therefore they, the inhabitants of his holy mountain, the members of his Kingdom, who previously live in the midst of a hateful and hostile world, now live together in peace and harmony.

10 “And in that day there shall be a Root of Jesse, who shall stand for an ensign of the people; to It shall the Gentiles seek, and His rest shall be glorious.”

— and in that day there shall be a root of Jesse, that same wonderful Scion, the Son of David spoken as a most proper person “the Gentiles seek” to be consulted on all occasions, he, not king Hezekiah, being the wonderful Counsellor, Isaiah 9:6.

11 And it shall come to pass in that day that the Lord shall set His hand again the second time to recover the remnant of His people who shall be left, from Assyria, and from Egypt, and from Pathros, and from Cush, and from Elam, and from Shinar, and from Hamath, and from the islands of the sea.

— and it shall come to pass in that day, that the Lord shall set his hand again the second time, stretching it out as once before when he led his chosen people out of Egypt, to recover the remnant of his people which shall be left, not, only the believers of Israel and Judah, but those from all the nations of the world;

— from Assyria, the mighty nation in the valley of the Euphrates, and from Egypt, the empire toward the southwest, and from Pathros, Upper Egypt, and from Cush, or Ethiopia, and from Elam, Southern Media, and from Shinar, Southern Mesopotamia, and from Hamath, the country or province on the Orontes, north of Palestine, and from the islands of the sea, an expression which refers to the entire coast of the Mediterranean and the adjacent countries;

— see also Isaiah 49:22 where will lift up his hand to the Gentiles; to lift up the hand is a sign of beckoning to, or inviting; that God would call the Gentiles to partake of the blessings of the true religion and to embrace the Messiah; could this period also coincide with Ezekiel 390/40 years?)

12 And He shall set up an ensign for the nations, and shall assemble the outcasts of Israel, and gather together the dispersed of Judah from the four corners of the earth.

— and he shall set up an ensign for the nations, around which all the believers might rally, and shall assemble the outcasts of Israel, those of remnant of the house of Israel, his people among the ten tribes;

— and gather together the dispersed from the house of Judah, the Jews, from the four corners or wings of the earth so that they will march under his banner, united in spirit, though outwardly separated by race and language and customs.

13 The envy also of Ephraim shall depart, and the adversaries of Judah shall be cut off; Ephraim shall not envy Judah, and Judah shall not vex Ephraim.

— the hostility with Epraim shall depart, this hostility with Judah having been the chief factor in the division of the nation during the time of the kings in the Old Testament, but that soon, Ephraim shall not envy Judah, and Judah shall not vex Ephraim, that is, the children of Israel would then be a perfect and harmonious union, its various parts living together in perfect harmony.

14 But they shall fly upon the shoulders of the Philistines toward the west; they shall despoil them of the east together. They shall lay their hand upon Edom and Moab, and the children of Ammon shall obey them.

— but they, the house of Israel and the house of Judah, shall fly upon the shoulders of the Phillstines toward the west, this nation being the embodiment of the fiercest hostility since the early history of Israel; they, the house of Israel and the house of Judah, shall spoil them of the east together, the Bedouin hordes of Arabia;

— they shall lay their hand upon Edom and Moab, which are today’s Spain and Jordan, conquering the country of these ancient enemies; and the children of Ammon shall obey them, literally, “their obedience.”

— These scenarios show the manner in which the Lord, through his Kingdom will judge and destroy his enemies. The Last Day will spell their doom, and the children of Jacob, the remnants left of the Day of the Lord, will be present to celebrate their victory:

For more about Edom, a prophecy of Esau or Edom, see Obadiah

More on the Sword from the South, see A Sword from the South!

15 And the Lord shall utterly destroy the tongue of the Egyptian Sea; and with His mighty wind shall He shake His hand over the river, and shall smite it in the seven streams and make men go over dryshod.

— and the Lord shall utterly destroy the tongue of the Egyptian sea; a bay of the Egyptian sea, so called because in the form of a tongue; or the fork of the Arabian Gulf known as the Red Sea as at the time when the children of Israel left the house of their bondage;

— and with his mighty wind shall he shake his hand over the river, over the Euphrates, and shall smite it in the seven streams, separating it into seven shallow brooks, and make men go over dry-shod, walking through its bed on sandals; in references the Lord here promises to the spiritual people of God a wonderful salvation, like that out of Egypt or out of the captivity of Assyria;

— and so the Targum says, “and the Lord shall dry up the tongue of the Egyptian sea, and shall lift up the stroke of His strength upon Euphrates, by the word of His prophets” and this designs the destruction of the land of the Muslims which is signified by the drying up of the river Euphrates; that is, from the Nile to the Euphrates would the house of Israel and the house of Judah return to.

16 And there shall be a highway for the remnant of His people who shall be left from Assyria, as it was to Israel in the day that he came up out of the land of Egypt.

— and there shall be an highway for the remnant of his people, cast up or purposely built for the believers in the Lord’s Kingdom, which shall be left, from Assyria, permitting the captives to return to their inheritance;

— far more than it was to Israel in the day that the house of Jacob came up out of the land of Egypt. This redemption of his people out of the hand of all enemies and oppressors would be the last great deed of the Messiah, and its completion will usher in the peace and glory of eternity. In this way the despised Branch out of the house of David would establish his kingdom, which, although jeered at from all sides, will still conquer in the end.

Isaiah 12

1 And in that day thou shalt say: “O Lord, I will praise Thee; though Thou wast angry with me, Thine anger is turned away, and Thou comforted me.

— and in that day, when the redemption of the spiritual Israel, of the Kingdom of God, shall be completed, thou shalt say, the Saviour triumphant breaking forth in a song of praise;

— O Lord, I will praise Thee, my Lord, my Redeemer and my Saviour; though thou wast angry with me, in a just wrath over the natural sinfulness of those whose redemption was perfected, thine anger is turned away, through the atonement made by Christ, and thou comfortest me, the fact of the salvation gained through the Messiah is the highest consolation of the believers in time and eternity.

2 Behold, God is my salvation; I will trust and not be afraid; for the Lord Jehovah is my strength and my song; He also has become my salvation.”

— behold, my God is my Salvation, literally, “Behold the God of my salvation,” him who planned and carried out the redemption of a world lost in sin; I will trust, placing full reliance upon his promise of help, and not be afraid, not being brought to shame on account of the confidence resting in him;

— for the Lord Yehovah is my Strength, giving full evidence of his power in redeeming his people, and my Song, the object of his elect’s endless praise; he also is become my Salvation, the blessings of which are now enjoyed by all in the Kingdom of God.

3 Therefore with joy shall ye draw water out of the wells of salvation;

— therefore with Joy shall ye draw water out of the wells of salvation, partaking of its benefits richly and endlessly. “At the Feast of Tabernacles water was drawn from the fountain of Siloam for a drink-offering. From the priest that so brought it with solemnity into the Temple, another took it, and, while pouring out the water, used the words of our text.”

4 and in that day shall ye say: “Praise the Lord! Call upon His name! Declare His doings among the people; make mention that His name is exalted.

— and in that day, while enjoying the fullness of the redemption, shall ye say, Praise the Lord, call upon his name, declare his doings among the Gentiles, making them known throughout the earth, make mention that his name, Yehovah, be exalted, their only Saviour and Redeemer, thus giving all glory to him.

— God’s name is the four-letter Hebrew word יהוה‎ YHVH Yehovah (not Jehovah since the letter J wasn’t around but only after the sixteenth century; more on this at the end).

5 Sing unto the Lord, for He hath done excellent things; this is known in all the earth.

— sing unto the Lord, in psalms, hymns and songs, for he hath done excellent things, proving his excellence and majesty in the various acts of his redemption; this is known in all the earth, it should be announced to all mankind.

6 Cry out and shout, thou inhabitant of Zion! For great is the Holy One of Israel in the midst of thee.”

— Cry out and shout, thou inhabitant of Zion; singing aloud with the high praises of God in their mouth, from the mountain where the house of true divine worship are located; for great is the Holy One of Israel in the midst of thee, as the Giver of Victory and the Fountain of Life.

— thus this wonderful hymn, modeled after so many psalms of praise in the Old Testament, especially that sung upon the delivery of the children of Israel at the hands of Pharaoh, Exodus 15:1-18, sets forth the joy of the redemption of God, of the Chosen triumphant, when entering upon the blessings of eternal redemption.

~~~

More on God’s name, Yehovah.

God’s name is the four-letter Hebrew word יהוה‎ YHVH Yehovah, which are embedded in the Masoretic text over 6000 times, yet when translated into our English language most had been translated as Lord, or LORD, which are titles, but not his name. His name is יהוה‎ Yehovah, or YEHOVAH (but there are no capital letters in Hebrew).

It wasn’t until 1524 that Gian Giorgio Trissino, an Italian Renaissance grammarian, invented the letter J that this new letter started to take a hold in the writings of western Europe. Even in 1611 when the English Bible the King James has our subject of study by the prophet Jeremiah, he was known as Ieremiah. So Jehovah is a very late comer.

The following verses with the LORD erred in translation. His name Yehovah should be used:

I am the LORD; that is My name. And My glory will I not give to another, neither My praise to graven images. Isaiah 42:8

And it shall come to pass, that whosoever shall call on the name of the LORD shall be delivered; for in Mount Zion and in Jerusalem shall be deliverance, as the LORD hath said, and in the remnant whom the LORD shall call. Joel 2:32

“I am sought of them that asked not for Me; I am found of them that sought Me not. I said, ‘Behold Me, behold Me,’ unto a nation that was not called by My name. Isaiah 65:1

When we call our God, the LORD, we err, because his name is not the LORD, which is a title. His name is YEHOVAH! May We all ask for his forgiveness, and may Our merciful God forgive us all.

Isaiah (Ch 9-10)

•July 15, 2023 • Leave a Comment

This prophecy of Isaiah starts with some cryptic messages about the prophecised coming of the Messiah; in Galilee, people who live in the dark but were privileged to see a great light.

The Q remains; if these chapters are prophetic, who then are the Assyrians that was prophesied to punish Israel? Are they the Germans? If so, how would this play out? If not, who else?

One clue is this “And it shall come to pass in that day,” that this is prophetic; in the latter day; so we have to wait and see!

Isaiah 9

1 Nevertheless the dimness shall not be such as was in her vexation, when at the first He lightly afflicted the land of Zebulun and the land of Naphtali, and afterward more grievously afflicted her by the way of the sea, beyond the Jordan, in Galilee of the nations.

— Zebulun ~ Holland; Naphtali ~ Sweden; beyond the Jordan: Reuben ~ France; Manasseh ~ UK; Gad ~ Switzerland;

— nevertheless, the (dimness) gloom of those people shall not be such as was in her vexation; these words may be rendered, “for there shall be no weariness to him that straitens” or “afflicts” them; so could refer to the king of Assyria; or Titus Vespasian, who would not be weary of, but tirelessly in carrying on the siege of Jerusalem and parts of Judea, including the land of Zebulun and Naphtali:

— as shown in Matthew 4:12-17, this prophecy was literally fulfilled during the Galilean ministry of Yeshua when he made Capernaum the center of activities and from there set forth on his journeys, not only throughout Galilee, but also into the country east of Jordan, by the way of the sea;

— in Galilee of the nations; which was inhabited not only by Jews, but people of other nations; and all Galilee, were lightly esteemed of, being mean and illiterate, not famous for any arts or sciences and having no prophet among them, should, in the days of the Messiah be highly honoured and made glorious by his presence, ministry and miracles performed there; Matthew 14:13.

2 The people that walked in darkness have seen a great light; they that dwell in the land of the shadow of death, upon them hath the light shined.

— the people that walked in Galilee have seen a great light; the inhabitants of Galilee in the times of the Messiah; see Matthew 4:16; John 1:48 and is a true character of the people of Galilee which are in a state of darkness;

— have seen a great light, the prophet, speaking as the mouthpiece of the eternal and omniscient God, views the Messiah there had seen a great light, for so certain is the fulfillment of God’s promise.

3 Thou hast multiplied the nation and not increased the joy; the will rejoice before Thee liken to the joy in harvest, and as men rejoice when they divide the spoil.

— thou hast multiplied the nation, that is, with light, knowledge, honour and glory, even Galilee of the nations; so the prophet addresses the Lord in a direct hymn of praise, since he, beginning with Galilee, extended the circle of believers in him until his believers were spread over the world;

— and not increased the joy, or “to whom Thou didst not magnify the joy,” the reference once more being to the time of great sorrow and distress under heathen conditions; they rejoice before thee according to the joy in harvest, when the sacrificial feasts were eaten by grateful worshippers, Deuteronomy 12:7; Deuteronomy 14:26.

4 For Thou hast broken the yoke of his burden and the staff of his shoulder, the rod of his oppressor, as in the day of Midian.

— for thou hast broken the yoke of his burden, the spiritual slavery with which the people were burdened, and the staff of his shoulder, the reference being to the cudgel of the overseer in striking the back of the slave;

— the rod of his oppressor, with which the people were kept in subjection, as in the day of Midian, Judges 7:15-22. Even as the Lord, at the time of Gideon, had delivered Israel from the oppression of the Midianites in a miraculous manner, so he effected a deliverance from everlasting bondage, from spiritual slavery, so the Messiah overcame all the enemies of mankind and now divides the spoil among the believers everywhere.

5 For every battle of the warrior is with confused noise and garments rolled in blood, but this shall be with burning and fuel of fire.

— for every battle is with confused noise; with the sound of the trumpet and beating of drums, and the huzzas and shoutings of the soldiers, the stamping and neighing of horses, the rushing of chariots, and rumbling of wheels, and the clashing of swords, spears and shields;

— and garments rolled in blood; but this shall be with burning and fuel of fire, literally: “For every greave” (armor, especially to protect the feet and legs) “of him who girds on his armor with noise, and the soldier’s cloak rolled in blood, it shall become a burning, food for the fire.”

6 For unto us a Child is born, unto us a Son is given; and the government shall be upon His shoulder. And His name shall be called Wonderful, Counselor, The Mighty God, The Everlasting Father, The Prince of Peace.

— for unto us a Child is born, unto us a Son is given, the eternal Word being made flesh for us, not only in our stead, but for our benefit, for the eternal salvation of all believers; and the government shall be upon his shoulder, the absolute and unlimited power, the divine authority in its fullest sense, rests upon him, he is, from his birth, in complete possession of the eternal power and Godhead;

— and his name shall be called Wonderful, not only his birth, but his entire essence being a miracle, Counselor, for he not only knows the right and proper counsel in every difficulty of body and soul, he also carries out his plans for the benefit of men, the Mighty God, for the Messiah, true man as he is, is at the same time above all, God blessed forever, altogether identical with Yehovah;

— from the record, King Hezekiah foolishly show Merodach-baladan, the Babylonian king’s envoys to Hezekiah, of all his treasures and his armory, and Isaiah rebuked him for such foolishness, II Kings 20, Isaiah 39; which they came later and carry all to Babylon; from such record, how could Hezekiah be consider a wise king or a Counselor?

the Everlasting Father, this description isn’t in the Septuagint nor in the Targum; so what could we make of this? The Messiah, the Son of God has never been described as the Father anywhere else in the Scriptures. Is this not the lying pen (ESV) of the scribes as described in Jeremiah 8:8? Is this another one of the self-deceptions of rabbinical Judaism to keep themselves blinded (who claim that King Hezekiah fulfilled this prophecy)?

— the Prince of Peace, the true Shiloh, Genesis 49:10, who has restored the right relation between God and man, making peace by abolishing in his flesh the enmity which existed since the fall of man, Ephesians 2:14-15.

the full Targum says, “The prophet said to the house of David, For unto us a Child is born, unto us a Son is given, and He has taken the law upon Himself to keep it. His name is called from eternity, Wonderful, The Mighty God, who liveth to eternity, The messiah, whose peace shall be great upon us in His days” — yes, the Targum identifies this verse confirming the Messiah had been prophesised but nothing about ‘the Everlasting Father’ and he was to be born, the Son and he was from eternity to eternity;

Remember, laying side by side along with the Masoretic Text, the Targum is another source of the Bible. Started by Ezra for those returning from Babylon and Persia, these returnees they could only understand in Aramaic; hence the Targum is as if Ezra is speaking to them then and to us today from the Hebrew Text quoted.

7 Of the increase of His government and peace there shall be no end, upon the throne of David and upon His Kingdom, to order it and to establish it with judgement and with justice from henceforth even for ever. The zeal of the Lord of hosts will perform this.

— of the increase of his government, in extending the boundaries of his spiritual kingdom, and peace there shall be no end, that is, he brings about a condition of eternal peace between God and man,

— upon the throne of David and upon his kingdom, for the kingdom of David continued and established in order to establish the foundation for the Kingdom of God with judgement and with justice from henceforth even forever;

— the zeal of the Lord of hosts, the eagerness of his love in seeking the salvation of mankind, will perform this. All this was fulfilled in the Son of God, of whom the angel says: “He shall be great and shall be called the Son of the Highest; and the Lord God shall give unto him the throne of his Father David, and he shall reign over the house of Jacob forever, and of his kingdom there shall be no end.

8 The Lord sent a word into Jacob, and it hath lighted upon Israel. — the Lord sent a word into Jacob,

— a warning against his people, and it hath lighted upon Israel, falling from heaven like a morsel intended for the whole nation. God revealed his intention to his servant, and by the preaching of the prophet it reached the place for which it was intended.

9 And all the people shall know—even Ephraim and the inhabitant of Samaria” that say in the pride and stoutness of heart:

— and all the people shall know, even Ephraim and the inhabitant of Samaria, the northern kingdom with its capital being emphatically mentioned first, as being leaders in disobedience and haughtiness, that say in the pride and stoutness of heart.

10 “The bricks are fallen down, but we will build with hewn stones; the sycamores are cut down, but we will change them into cedars.”

— the bricks of the World Trade Center had fallen, but we will build with hewn stones; Jonathan Cahn has lots to say about this verse: the sycamores are cut down, but we will change them into cedars;

— that is, they intended to replace their former lowly dwellings of dried clay and the cheap wood of the sycamore fig-tree by splendid palaces of stone and costly cedar-wood. It is the height of presumption and blasphemous pride if men scorn the punishment of the Lord;

— and notice this is speaking of Ephraim—even Ephraim and the inhabitant of Samaria—one who has lots of “pride and stoutness of heart,” verse 9 above; Oh ye that are Blind, Ephraim refering not to the United Kingdom but the United States!

More on (1) Ephraim / The United States; (2) Ephraim and Manasseh

(3) Who is Ephraim, a Chronic Liar? (4) The Ox without the Unicorn

11 Therefore the Lord shall set up the adversaries of Rezin against him and join his enemies together, — the subject “him”and “his” must be—Ephraim and the inhabitant of Samaria—;

— therefore the Lord shall set up the adversaries of Rezin against him, namely, the Ephraimites and the Assyrians, who, according to God’s plan, conquered Syria took Rezin the king of Syria, and then advanced and join their enemies together, or rather, Yehovah will stir up Ephraim’s enemies (the Syrians and the Philistines), against Ephraim;

Q, is this a prophecy for the endtime or an historical record? The part identified by Jonathan Cahn regarding “the bricks had fallen down, but we will build with hewn stones” as that of the World Trade Center, New York, in the land of Ephraim (that is, Ephraim being identified as the United States) was a prophecy; hence we can confidently say that all the rest could also be a prophecy.

12 the Syrians before and the Philistines behind; and they shall devour Israel with open mouth. For all this His anger is not turned away, but His hand is stretched out still.

— the Syrians before, for as allies of the Assyrians they would attack Israel from the front, and the Philistines behind, for these ancient enemies made use of every opportunity to wreak vengeance upon Israel and Judah, Cf II Chronicles 28:16-19;

— and they shall devour Israel with open mouth, eating with a full mouth, pillaging the land almost to the point of destruction. For all this his anger is not turned away, but his hand is stretched out still. The misfortunes here described were but the beginning of the great destruction which would strike the entire nation for its disobedience by his chastening hand;

— “and they shall devour Israel with open mouth” Q: Could this refer to the captivity of Israel for 190 years and Judah for forty years as phrophecised by Ezekeil in the latter days? For more, see Ezekiel 4 – 390/40 Years.

13 For the people turneth not unto Him that smiteth them, neither do they seek the Lord of hosts.

— for the people turneth not unto God the Almighty that smiteth them, neither do they seek the Lord of hosts. The object of his punishment, therefore, is or was not realized, they refuse to repent of their sins and thus give him a new cause for harsher punishment for them;

Not many repent even with Covid-19 now with about 7 million deaths (worldwide as of July 2023; over a million in the United States (1,127,000); the US has 4.3% of World’s population but 16% of World’s death)! Q: should we expect a more potent variant killer to emerge in the near future?

14 Therefore the Lord will cut off from Israel head and tail, branch and rush, in one day.

— therefore the Lord will cut off from Israel, in wreaking his final vengeance upon the rebellious people, head and tail; the head being interpreted as “the ancient and honourable” men in high places, civil magistrates, judges, governors and elders of the people, the king as supreme, and all subordinate officers;

— branch and rush, in one day, “great and small” like branches of trees; the latter the common, people, like reeds and rushes, weak and feeble; “the strong and the weak” in one great destruction.

— and so the Targum says, “the Lord will destroy from Israel the prince, the captain, the ruler and the governor in one day;”

For more, see America: A Failed State?

15 The ancient and honorable, he is the head; and the prophet that teacheth lies, he is the tail.

— the ancient and honorable, the princes and nobles of the people, he is the head; and the false prophet and false shepherds that teacheth lies, he is the tail;

— the prophets that tell lies, like Fred Coulter, Frank Nelte and John Ritenbaugh; considered themselves leaders among the people, but they are here told, with bitter irony, that they are morally the basest of the people, the vilest part of the nation.

16 For the leaders of this people cause them to err, and they that are led by them are destroyed.

— for the leaders of this people cause them to err, thereby showing themselves utterly unfit for leadership; and they that are led of them are destroyed, literally, “swallowed up,” namely, by the error and its peril, just as the humble rush must perish if submerged and covered with a flood of filthy water.

17 Therefore the Lord shall have no joy in their young men, neither shall have mercy on their fatherless and widows; for every one is a hypocrite and an evildoer, and every mouth speaketh folly. For all this His anger is not turned away, but His hand is stretched out still.

— therefore the Lord shall have no joy in their young men, the all-powerful, who formerly granted success to the arms of Israel’s young men, would withdraw his assistance;

— neither shall have mercy on their fatherless and widows, who formerly had been the special objects of his fostering care; for every one is an hypocrite and an evildoer; that is, corrupt, atrociously bad, inclined to every form of wickedness,

— and every mouth speaketh folly, and every mouth speaketh folly; or falsehood;

— a lie, as the Targum says as all lies are foolish; as also all vain words, all impious ones; or the savour of irreligion or superstition, and indeed every idle word, and all unsavoury and corrupt speech, and there is particularly foolish talking, which is not convenient; for all this his anger Is not turned away, but his hand is stretched out still, ready to apply further punishment.

18 For wickedness burneth as the fire; it shall devour the briers and thorns, and shall kindle in the thickets of the forest, and they shall mount up like the lifting up of smoke.

— for wickedness burneth as the fire, challenging God to continue in his course of punishment, bringing forth its own destruction; it shall devour the briers and thorns, the great mass of the lowly people, who have become weeds and thistles on the face of the earth;

— and shall kindle in the thickets of the forest, of the standing timber, of the upper classes of Israel, and they shall mount up, the fire lifting them up in a heavy column, like the lifting up of smoke. Thus the fire of God’s wrath, growing out of the nation’s wickedness, would bring destruction upon the entire people, the picture being that of a devastating forest-fire.

19 Through the wrath of the Lord of hosts is the land darkened, and the people shall be as the fuel of the fire; no man shall spare his brother.

— through the wrath of the Lord of hosts is the land darkened, but the Septuagint version renders it, “the whole land is burned” – burned out to ashes, utterly destroyed and the people shall be as the fuel of the fire to be devoured without mercy; no man shall spare his brother for selfishness takes account only of its own safety, disregarding all considerations of charity, patriotism and kinship.

20 And he shall snatch on the right hand and be hungry; and he shall eat on the left hand, and they shall not be satisfied; they shall eat every man the flesh of his own arm.

— and he (impersonal subject; his hand, his teeth), that is, every man, shall snatch on the right hand and be hungry, like a beast snapping in every direction; and he shall eat on the left hand, and they shall not be satisfied; they shall eat every man the flesh of his own arm, the members of his own family and tribe:

— the Targum says, “he shall spoil on the south, and still be hungry; and he shall destroy on the north, and not be satisfied.”

— Q, just curious, could this Targum version refers to the killings from the South to the North as in Ezekiel 20:45 to 21:5? For more, see the enemy from the South, see A Sword from the South!

21 Manasseh, Ephraim; and Ephraim, Manasseh; and they together shall be against Judah. For all this His anger is not turned away, but His hand is stretched out still.

— Manasseh, Ephraim; and Epraim, Manasseh, in a form of deep hatred or civil war in which every man’s hand would be turned against his neighbor;

— and they together shall be against Judah, for the hatred which obtained between Israel and Judah continued in the nation even as late as the siege of Jerusalem by the Romans, when their murderous selfishness reached its climax. For all this his anger is not turned away, but his hand is stretched out still; for if sinners will not heed His warning here in time, his destruction will be upon them throughout eternity;

— which is to be understood of their quarrels, contentions, and wars among themselves, whereby they bit, devoured, and consumed each other, though they were brethren; which explains and confirms what is before said, of no man sparing his brother, and everyone eating the flesh of his own arm. The Targum paraphrases the words thus;

— the Septuagint says “Manasseh” shall eat or devour “Ephraim” and “Ephraim” shall eat or devour “Manasseh” — the Targum paraphrases the words, thus, “they of the house of “Manasseh” with those of the house of “Ephraim” and they of the house of “Ephraim” with those of the house of “Manasseh” shall be joined together as one, to come against them of the house of Judah.”

Isaiah 10

1 “Woe unto them that decree unrighteous decrees, and that write grievousness which they have prescribed — woe unto them that decree unrighteous decrees; against lawgivers and judges, political rulers and governors that made unrighteous laws;

— in tyrannical legislation, laws which were not agreeable to the law of God, nor right reason; and were injurious to the persons and properties of men; and that write grievousness which they have prescribed, making and enforcing laws which bring unbearable oppressions to the poor of the land,

2 to turn aside the needy from judgement and to take away the right from the poor of My people, that widows may be their prey, and that they may rob the fatherless!

— to turn aside the needy, that is, to deprive them of their rights, of the justice due them, were harassed with such long, vexatious and expensive suits; and to take away the right from the poor, willfully and maliciously taking it from the poor or the oppressed;

— that widows may be their prey, and that they may rob the fatherless, the tyrants making themselves possessors of the property of the defenseless. They have reached the very heights of oppression and injustice.

3 And what will ye do in the day of visitation, and in the desolation which shall come from far? To whom will ye flee for help? And where will ye leave your glory?

— and what will ye do in the day of visitation, when God will visit their injustice upon them, and in the desolation, the sudden storm, crash and collapse; and so the Targum says, “what will ye do in the day that your sins shall be visited upon you?”

— which shall come from far? It is here hinted that God would send the enemy who should avenge the poor by destroying their oppressors from a far country. To whom will ye flee for help? this being a reference to Israel’s custom of seeking help from foreign nations. And where will ye leave your glory? that is, the treasures, valuables which they had piled up in practicing injustice and in treading down the poor.

4 Without Me they shall bow down under the prisoners, and they shall fall under the slain.” For all this His anger is not turned away, but His hand is stretched out still.

— without me, rather, nothing remains; are not my people, and do not hearken to me, but that they shall bow down as captives; they would either be bound and carried captive, or else slain with the sword; their lot being even worse than that of other captives;

— and they shall fall under the slain, trodden under foot by others, hewn down in cold blood by their captors. Such is the lot of those who were formerly honorable and powerful, but abused their authority by tyrannical measures;

— for all this his anger is not turned away, but his hand is stretched out still, for it is impossible to escape the punishment of the Lord when once he sets out to pronounce his judgement on the wrongs committed against the poor and defenseless.

5 “Woe to the Assyrian, the rod of Mine anger, and the staff in their hand is Mine indignation!

— O Assyrian, the rod of God’s anger, because they were made use of by God as an instrument to chastise and correct Israel for their sins; and the staff in their hand is mine indignation,

— literally, “Woe to Asshur (which is) the rod of my wrath, and the staff, that in their hand, mine indignation.” The Lord here pronounces a woe upon Assyria; for whereas he wanted to use this nation merely as his instrument in punishing Israel.

6 I will send him against a hypocritical nation, and against the people of My wrath will I give him a charge, to take the spoil and to take the prey, and to tread them down like the mire of the streets.

— God will send the Assyrian against an hypocritical nation, Israel, a nation corrupt and wicked, and against the people of his wrath will God give the Assyrian a charge, bidding them to smite Israel for her sins;

— to take the spoil and to take the prey and to tread them down like the mire of the streets, destroy their power, render them utterly helpless. So much the charge of the Lord to Assyria included, not, indeed, as if the Lord had sent this command by some messenger, but that he places even the heathen nations into his service to carry out his plans, to punish the disobedient;

— Q. if this is prophetic, who then are the Assyrians to punish Isreal? Are they the Germans? If so, how would this play out? If not, then who else are the Assyrians?

7 Yet he meaneth not so, neither doth his heart think so; but it is in his heart to destroy and cut off nations not a few.

— howbeit he, that is, Assyria, meaneth not so, does not hold the same idea that the Lord holds, neither doth his heart think so, but it is in his heart to destroy and cut off nations not a few, that is, Assyria was driven only by the thought of conquest and destruction and therefore was guilty before God, even while carrying out His plans.

— another way of saying, the Assyrian purposes, intentions and thoughts were not as the Lord’s; they did not imagine that they weres only the rod of God’s anger and the staff of his indignation, an instrumant of his wrath. The selfish and blameworthy pride of Assyria is now described; their plans are no less to be condemned though they by them unwittingly fulfill God’s designs.

8 For he saith, ‘Are not my princes altogether kings?

— for he asked, Are not my princes and commanders altogether kings? Assyria was a world-power, and even its provinces had the extent and the might of kingdoms, so that their governors could well rank with kings.

9 Is not Calno as Carchemish? Is not Hamath as Arpad? Is not Samaria as Damascus?

— is not Calno, a large city on the Tigris, as Carchemish, an important commercial center on an island in the Euphrates? Rashi: “as the children of Carchemish are princes and rulers, so are the children of Calno;”

— is not Ramath, an important city and formerly a capital on the Orontes, as Arpad, a city in Syria proper? Is not Samaria as Damascus? Three pairs of cities are named in such a way that boasting Assyria emphasizes the great ease with which its conquests were made.

10 As my hand hath found the kingdoms of the idols and whose graven images excelled them of Jerusalem and of Samaria,

— as the hand of Assyria hath found Israel, the kingdoms of the idols, conquering those upon whom the people of Israel and Judah looked down as idol-worshipers, and whose graven images did excel them of Jerusalem and of Samaria, being more plentiful than they and therefore supposedly better able to defend their cities;

— from the Message Bible:

“Doom to Assyria, weapon of my anger. My wrath is a club in his hands! I send him against a godless nation, against the people I’m angry with. I command him to strip them clean, rob them blind, and then push their faces in the mud and leave them.

“But Assyria has another agenda; he has something else in mind. He’s out to destroy utterly, to stamp out as many nations as he can. Assyria says, ‘Aren’t my commanders all kings? Can’t they do whatever they like? Didn’t I destroy Calno as well as Carchemish? Hamath as well as Arpad? Level Samaria as I did Damascus? I’ve eliminated kingdoms full of gods far more impressive than anything in Jerusalem and Samaria. So what’s to keep me from destroying Jerusalem in the same way I destroyed Samaria and all her god-idols?’”

11 shall I not, as I have done unto Samaria and her idols, so do to Jerusalem and her idols?’”

— shall the Assyrian not, as they has done unto Samaria and her idols, which had been destroyed in the sacking of the city, do so to Jerusalem and her idols? The God of Jerusalem, so the speaker boastfully asserts, would no more be able to protect this city titan the gods of the other cities had succeeded in doing. Cf. Isaiah 36:18-20; Isaiah 37:11-13. This blasphemous boast could not remain unpunished, as the Lord shows.

12 Therefore it shall come to pass when the Lord hath performed His whole work upon Mount Zion and on Jerusalem: “I will punish the fruit of the stout heart of the king of Assyria and the glory of his high looks.

— wherefore it shall come to pass that when the Lord hath performed his whole work upon Mount Zion and on Jerusalem, Assyria being his instrument of chastisement upon those whom he had chosen for his people, and a remnant of whom remained true to him in the general apostasy and now bowed under his chastening hand;

— I will punish the fruit of the stout heart of the king of Assyria, the blasphemous pride which showed itself in his boasting, and the glory of his high looks, literally, “the haughtiness of the loftiness of his eyes,” the description showing the self-complacent nature of his assumed glory;

— the Targum says, “and it shall be, when the Lord hath finished to do all that he hath said in Mount Zion, and in Jerusalem.”

13 For he saith, “‘By the strength of my hand I have done it, and by my wisdom, for I am prudent; and I have removed the bounds of the people and have robbed their treasures, and I have put down the inhabitants like a valiant man.

— for the king of Assyria saith, By the strength of my hand I have done it, and by my wisdom, ascribing his success entirely to his own ability; for I am prudent, always making use of proper understanding;

— and the king of Assyria continued his boasting: I have removed the bounds of the people, changing their boundaries to suit himself, and have robbed their treasures, taking at will everything that they had accumulated, and I have put down the inhabitants like a valiant man, butting down those occupying thrones like a mighty hero or an angry steer.

14 And my hand hath found as a nest the riches of the people, and as one gathereth eggs that are left, have I gathered all the earth; and there was none that moved the wing, or opened the mouth, or peeped.’”

— the king of Assyria continued: my hand hath found as a nest the riches of the people, locating them with an experienced hand; and as one gathereth eggs that are left, forsaken by the mother bird,

— have I gathered all the earth, and there was none that moved the wing, in defense, or opened the mouth, or peeped, in terrified protest. All nations had bowed in dumb resignation under the hand of the mighty Assyrian, and for this he took all credit to himself. But the prophet counters with a reproof of bitter irony:

15 Shall the ax boast itself against him that heweth therewith? Or shall the saw magnify itself against him that shaketh it? As if the rod should shake itself against them that lift it up, or as if the staff should lift up itself, as if it were no wood!

— Isaiah asked: shall the ax boast itself against him that heweth therewith? Or Is the saw able to exalt itself over the one who wields it? It is just as foolish for a tool to boast over against the workman as for the king of Assyria to ascribe to himself all the might which he possesses only by divine permission;

— Isaiah continued: as if the rod should shake itself against them that lift it up, or as if the staff should lift up itself, as if it were no wood, literally, “as if a staff should lift up” (that which is) “not wood,” that is, the person handling it.

— So it was utterly absurd for the king of Assyria, who, although unknown to himself, carried out God’s punishment upon Israel, to ascribe to himself the wisdom and power, the design and success of this campaign. The very evil in the world is used by God to serve his objects. Cf Genesis 50:20. The punishment upon Assyria is then pronounced:

16 Therefore shall the Lord, the Lord of hosts, send among His fat ones leanness; and under His glory He shall kindle a burning like the burning of a fire.

— therefore shall the Lord, the Lord of hosts, send among his fat ones leanness, consuming the mighty ones of Assyria, and under his glory he shall kindle a burning like the burning of a fire, to consume it in a moment, with a mighty crackling and hissing.

17 And the Light of Israel shall be for a fire and his Holy One for a flame; and it shall burn and devour his thorns and his briers in one day,

— and the Light of Israel, the Holy One of Israel himself, shall be for a fire and his Holy One for a flame; and it shall burn and devour his thorns and his briers in one day, the Assyrian nation being devoured in one great destruction,

18 and shall consume the glory of his forest and of his fruitful field, both soul and body; and they shall be as when a standardbearer fainteth.

— and shall consume the glory of his forest and of his fruitful field; the Assyrian army is compared to a “forest” the majesty of his leaders and the wealth of his merchants, both soul and body, in a complete destruction;

— the Targum says, “the glory of the multitude of his army, and their souls with their bodies, it shall consume.”

19 And the rest of the trees of his forest shall be few, that a child may write them.

— and the rest of the trees in his forest, the few that have survived the devastation of the fire, shall be few, that a child may write them, put down the number which he easily counted. Thus the Lord, even in the midst of his enemies, has some few whom he has chosen, who are saved in the general destruction which will come upon the unbelievers.

20 And it shall come to pass in that day that the remnant of Israel, and such as have escaped of the house of Jacob, shall no more again depend upon him that smote them, but shall stand upon the Lord, the Holy One of Israel, in truth.

— and it shall come to pass in that day; here begins a prophecy relating to the house of Israel, concerning things that should befall them in the latter days, that the remnant of Israel, and such as are escaped of the house of Jacob, whom he has chosen from among the nations;

— shall no more again stay among the Assyrian who smote them, placing their confidence in Assyria, the nation to whom the kings of both Israel and Judah turned time and again, but shall stay upon the Lord, the Holy One of Israel, making him alone the full basis of their trust;

— the Targum say “they shall no more lean on the people whom they served; but they shall lean upon the Word of the Lord, the Holy One of Israel.”

21 The remnant shall return, even the remnant of Jacob, unto the mighty God.

— in the latter days, the remnant shall return, even the remnant of the full house of Jacob shall return to the true worship before the Almighty God.

22 For though thy people Israel be as the sand of the sea, yet a remnant of them shall return; the consuming decreed shall overflow with righteousness.

— for though thy people, Israel be as numerous as the sand of the sea, a countless multitude, yet only a remnant of them shall return, unfortunately only a remnant, the great mass being killed by the Sword coming from the South Ezekiel 20:45 to 21:5. For more, see the enemy from the South, see A Sword from the South!

23 For the Lord God of hosts shall cause a consuming, even determined, in the midst of all the land.

— for the Lord God of hosts shall make a consumption, that is, most are killed, even extermined, “and that which is decreed,” in the midst of all the land;

— there is no escaping the wrath of the Lord when once he sets the machineries of destruction are in motion, when he begins to carry out judgement upon Israel and issuing his decree of punishment is merely a preliminary act and the beginning of his Kingdom.

24 Therefore thus saith the Lord God of hosts: “O My people that dwellest in Zion, be not afraid of the Assyrian. He shall smite thee with a rod and shall lift up his staff against thee, after the manner of Egypt.

— therefore, thus saith the Lord God of hosts, in a call full of reassuring comfort, O My people that dwellest in Zion, those that had fled to Jerusalem, dwelling in His merciful presence, be not afraid of the Assyrian, the oppressor typifying all the enemies of the children of Israel;

— he Assyrian shall smite thee with a rod and shall lift up his staff against thee, like an overseer of slaves, after the manner of Egypt, when the children of Israel were in the house of bondage and suffered severely from their oppressors.

25 For yet a very little while and the indignation shall cease, and Mine anger in their destruction.”

— yet for a very little while, and the indignation ceases, God’s people being delivered from the enmity of the godless, and mine anger in their destruction, rather, “My wrath has the object to destroy them,” the enemies of his Chosen, to wear them down to nothing;

— the Targum says, “for yet a very little while, and the curses shall cease from you of the house of Jacob; and mine anger shall be upon the people that work iniquity, to destroy them” that is, the Assyrians.

26 And the Lord of hosts shall stir up a scourge for him according to the slaughter of Midian at the rock of Oreb; and as His rod was upon the sea, so shall He lift it up after the manner of Egypt.

— and the Lord of hosts shall stir up a scourge for the Assyrians, according to the slaughter of Midian at the rock of Oreb, when Gideon’s forces annihilated the army of the Midianites, Judges 7:25;

— and as his rod was upon the sea, namely, when Moses stretched out his hand over the Red Sea and parted it for the safe passage of the children of Israel, Exodus 14:26, so shall he lift it up after the manner of Egypt, lifting Assyria up and dashing it to pieces as he destroyed the forces of Pharaoh.

27 And it shall come to pass in that day, that his burden shall be taken away from off thy shoulder and his yoke from off thy neck, and the yoke shall be destroyed because of the anointing.

— and it shall come to pass in the latter day, that his burden shall be taken away from off thy shoulder and his yoke from off thy neck, the Lord himself taking away the oppression of Assyria, of all the enemies of the house of Jacob, and the yoke shall be destroyed because of the anointing, rather, on account of the fat;

— the picture is that of an ox who becomes so fat and strong in spite of the yoke laid upon him that he breaks the yoke on his neck to pieces. Thus God’s people is to overcome the world by strength from within. Thus the deliverance of his people is described as it begins in and with Immanuel, and as it is completed on the Last Day, the day of redemption.

28 He is come to Aiath, he is passed to Migron; at Michmash he hath laid up his baggage.

— the Assyrian and his army is to come to Aiath, hardly ten miles northeast of Jerusalem, he is passed to Migron, a hamlet still nearer to the capital; at Michmash he hath laid up his carriages, leaving the baggage in order to move forward with greater speed.

29 They are gone over the passage; they have taken up their lodging at Geba. Ramah is afraid; Gibeah of Saul is fled.

— they are gone over the passage, a deep, rough ravine, now known as the Wady-es-Suweinit; they have taken up their lodging at Geba, rather, “Let Geba be our lodging!” halting only for the night; Ramah, the home of Samuel, is afraid; Gibeah of Saul is fled, its inhabitants forsaking their city in terror.

30 Lift up thy voice, O daughter of Gallim; cause it to be heard unto Laish, O poor Anathoth.

— lift up thy voice, crying in consternation over the impending calamity, O daughter of Gallim, the inhabitants of another village in the path of the Assyrian army; cause it to be heard unto Laish, the shrieks of terror echoing far and wide through the country. O poor Anathoth! only three-fourths of an hour distant from Jerusalem and therefore bound to suffer from the enemies.

31 Madmenah is removed; the inhabitants of Gebim gather themselves to flee. — Madmenah is removed, the people forsaking their homes; the inhabitants of Gebim gather themselves to flee.

32 As yet shall he remain at Nob that day; he shall shake his hand against the mount of the daughter of Zion, the hill of Jerusalem.

— as yet shall the Assyrian army remain at Nob that day, a hill to the north of Jerusalem, overlooking the city, which the enemy would reach that very day;

— the Assyrian army shall shake his hand against the mount of the daughter of Zion, the hill of Jerusalem, all ready for the attack which would surely bring ruin to the capital;

— thus Assyria, typifying the army of the ungodly, the enemies of the Kingdom of God, is here pictured as going forward to the attack with an irresistible force, and the doom of the city, the City of Jerusalem, seems to be impending. But here the Lord interferes.

33 Behold, the Lord, the Lord of hosts, shall lop the bough with terror; and the high ones of stature shall be hewn down, and the haughty shall be humbled.

— behold, the Lord, the Lord of hosts, shall lop the bough with terror, cutting them down as branches are felled with an ax;

— and the high ones of stature shall be hewn down, and the haughty shall be humbled, all their plans being foiled at the very moment when they seemed to mature according to calculation.

34 And He shall cut down the thickets of the forest with iron, and Lebanon shall fall by a mighty one.

— the Assyrian army is compared to the forest of Lebanon; and he, the Lord in his avenging wrath, shall cut down the thickets of the forest with iron, with a sharp instrument of destruction, and Lebanon, the name under which all the hostile forces are comprehended;

— the Assyrian army shall fall by a Mighty One, by him who possesses the majesty of the almighty and eternal God, who is both the Defender and the Deliverer of his Kingdom.

China’s J-20 with WS-15 Twin Engines

•July 14, 2023 • Leave a Comment

Footage surfaces of China testing a J-20 with twin WS-15 engines to rival the US

Manufacturer Xi’an Aero-Engine Corporation: WS-15 Twin Engines

Interesting Engineering by Christoper McFadden • July 5, 2023 // Wikipedia

According to social media posts, China has successfully test-flown a J-20 “stealth” fighter with twin WS-15 engines. Over about two decades, these are China’s most advanced fighter jet engines that are Domestically produced. The lack of censorship of the posts has led many military experts to propose that the test flight is probably genuine and has some unofficial confirmation from Beijing.

Footage of the maiden flight first surfaced on June 28 and, if genuine, is seen as a significant step to narrowing the technological gap between China and America. According to the footage, the WS-15 fitted J-20 took off from a test airfield in Chengdu, southwest Sichuan province. The city is also J-20’s developer’s main base, Chengdu Aerospace Corporation.

It is believed that WS-15 “Emei” vector engine is targeting the US F119 engine but has a larger thrust-to-weight ratio than the F119 engine (11.6 tons of WS-15 vs 10.7 tons of F119 mass version).

WS-15 represents the highest level of Chinese aviation engines and is a qualitative breakthrough for China’s aviation industry. The installation of the WS-15 engine on J-20 will give the fighter the ability to compete with the F-22 fighter, and will completely solve the “heart” problem of J-20 since its inception.

It is unclear when the flight occurred; there was no official announcement from the People’s Liberation Army. Military enthusiasts also posted clips of the J-20’s maiden flight with Russian AL-31 engines in 2011 and Chinese WS-10Cs in 2021, comparing them with the most recent test.

“The lack of censorship of social media posts about the latest maiden flight represents quasi-official confirmation of the successful development of the WS-15 turbofan engine,” Zhou Chenming told the South China Morning Post. Chenming is a Beijing-based Yuan Wang military Science and technology think tank researcher.

“With the new WS-15, we can see the J-20 is much more maneuverable and faster in climbs, showing it is almost on a par with the American F119 engine designed for its F-22 and F-35 stealth fighters,” he added.

Also, according to Zhou, the J-20B fighter will be equipped with the WS-15 engine, which will resolve a significant issue with the aircraft’s performance. “After 12 years since the J-20’s maiden flight in 2011, the Chinese air force finally got the engine it had long been waiting for,” he said. “The accomplishment of the sophisticated WS-15 engine means the PLA Air Force will no longer [be at risk of a] ‘heart attack,'” he added.

The WS-15 engine is anticipated to enhance the J-20’s fighting capabilities, as it is more fuel-efficient. For example, they may enable J-20 units to perform longer patrols, remain in air defense duties for extended periods, target Taiwan from its less protected eastern coast, and potentially launch strike missions against Western establishments in Japan without relying heavily on aerial refueling.

The WS-15 is a significant technological leap

According to former PLA instructor Song Zhongping, the WS-15 engine still lacks the endurance of American engines that can surpass 500,000 flight hours.“There is still a gap between WS-15 and the F119 engines,” Song said. “It’s an experimental success for the WS-15, but it’s too early to enter mass production. It still needs tests and improvements,” he added.

With tensions escalating in the Asia-Pacific region due to the United States’ deployment of its fifth-generation F-22 and F-35 fighters, China is determined to develop a stealth aircraft that can rival the best in the world. To date, China has manufactured over 200 J-20 fighters, predominantly powered by Russian AL-31 engines, but with a few using the WS-10C engine as a temporary measure.

“The stranger that is within thee shall get up above thee very high, and thou shalt come down very low.

“He shall lend to thee, and thou shalt not lend to him. He shall be the head, and thou shalt be the tail” Deuteronomy 28:43-44

Isaiah (Ch 7-8)

•July 13, 2023 • Leave a Comment

In general, Isaiah’s prophecy and warning message are for “the house of Israel and the men of Judah.”

God had planted the vineyard indeed which was composed of Israel and Judah; now he would remove all the protection from his people and cause them to be overrun and be destroyed.

“The anger of the Lord shall not return, until He has executed and till He has performed the thoughts of His heart; in the latter days ye shall consider it perfectly” Jeremiah 23:20;

“In latter days you will understand it fully,” that is, it means as a whole, we wouldn’t fully understand these prophecies until we’re living in the latter days; after God had executed his judgement in anger and performed the thoughts of his heart!

Isaiah 7

1 And it came to pass in the days of Ahaz the son of Jotham, the son of Uzziah, king of Judah, that Rezin the king of Syria and Pekah the son of Remaliah, king of Israel, went up toward Jerusalem to war against it, but could not prevail against it.

— and it came to pass in the days of Alias, the son of Jotham, the son of Uzziah, king of Judah, II Kings 15:37; II Kings 16:5-6; II Chronicles 28:5-6, that Rezin, the king of Syria, and Pekah, the son of Remaliah, king of Israel, who had formed an alliance, II Kings 15:37;

— and went up toward Jerusalem to war against the house of Judah, but could not prevail against it. According to the historical accounts this war took place about 743-739 BC with the preliminary advantage entirely on the side of the northern allies;

— for Rezin took the harbor of Elath on the Elanitic Gulf, and Pekah gained a victory over a large army of Judah. Nevertheless, Jerusalem was not taken, very likely because the allies did not even find occasion to lay siege to it; their plans were overthrown.

2 And it was told the house of David, saying, “Syria is confederate with Ephraim.” And his heart was moved, and the heart of his people, as the trees of the wood are moved with the wind.

— and it was told the house of David, the reigning monarch of that line, in this case Ahaz, the princes of the blood, his court and counsellors; saying, Syria is confederate with Ephraim, the ten tribes; depending upon the northern kingdom as a faithful ally, its armies having joined Israel’s forces to strengthen them, or being supported by them.

— and the king’s heart was moved together with the heart of his people, both King Ahaz and all the people of Judah being frightened by the invasion, as the trees of the wood are moved with the wind, their terror being intensified by their feeling of fear.

— Q: would such fear strike the modern states of Judah and the house of Israel today?

3 Then said the Lord unto Isaiah, “Go forth now to meet Ahaz, thou and Shearjashub [that is, The remnant shall return], thy son, at the end of the conduit of the upper pool in the highway of the Fuller’s Field,

— then the Lord said unto Isaiah, Go forth now to meet Alias, thou and Shear-jashub (“A remnant returns”), thy son, at the end of the conduit of the upper pool, one of the reservoirs where the water of the city was stored, Isaiah 36:2,

— in the highway of the fuller’s field, which was also situated west of the city, near the pool, this highway apparently being the main caravan road leading from Jerusalem to Joppa;

4 and say unto him: ‘Take heed, and be quiet. Fear not, neither be fainthearted at the two tails of these smoking firebrands — at the fierce anger of Rezin and Syria, and of the son of Remaliah.

— and say unto him, who was probably engaged in having the fortifications strengthened, Take heed and be quiet, perfectly unconcerned and without worry;

— fear not, neither be faint-hearted, literally, “and thy heart, not be soft with despondency,” for the two tails of these smoking fire-brands, burned-out and quenched stumps of torches, for the fierce anger of Rezin with Syria, with his whole great army, and of the son of Remaliah, as Pekah, king of Israel, is contemptuously called.

5 Because Syria, Ephraim, and the son of Remaliah have taken evil counsel against thee, saying, — a civil war, Ephraim against Judah!

— because Syria, or Aram, with its confederates, Ephraim, and the son of Remaliah, the northern kingdom and its ruler, have taken evil counsel against the house of Judah, saying,

6 “Let us go up against Judah and vex it, and let us make a breach therein for us, and set a king in the midst of it, even the son of Tabeel,”

— let “a confederation of Syria with Ephraim” go up against Judah and vex it, throw it into consternation, fill it with terror, and let the Syria/Ephraim alliance make a breach therein, take the capital, and set the king of Judah in the midst of the battle, even the son of Tabeal, an unknown man, to be the vassal king of Judah, for such was the plan of the alliance:

7 thus saith the Lord God: It shall not stand, neither shall it come to pass.

— thus saith the Lord God, It shall not stand, that is, the counsel the confederates had taken against Judah to vex it, make a breach in it, and set a king of their own liking over Judah; that counsel shall not stand; neither shall it come to pass, since he himself had decided to hinder it.

8 For the head of Syria is Damascus, and the head of Damascus is Rezin; and within threescore and five years shall Ephraim be broken, that it be not a people.

— for the head of Syria, its capital and metropolis, is Damascus, and the head of Damascus is Rezin; and within sixty-five years, Ephraim, the northern kingdom, shall be broken that it be not a people, that it would cease to exist as a nation;

For more into another Captivity: see Ezekiel Timeline – 190/40 Years
For more about a prophecy of Esau or Edom, see Obadiah
For more on the enemy from the South, see A Sword from the South!

9 And the head of Ephraim is Samaria, and the head of Samaria is Remaliah’s son. If ye will not believe, surely ye shall not be established.’”

— and the head of Ephraim, its capital and chief city of Ephraim is Samaria, and the head of Samaria is Remaliah’s son. The meaning of this somewhat enigmatic saying is evidently this, that both Syria and the kingdom of Israel would be confined to the territory now occupied by them, since their schemes of conquest would fail;

— moreover, Ephraim would be destroyed within the next sixty-five years, Shalmanezer of Assyria taking the majority of his people into exile in the year 722 BC and the downfall of the country being completed with the settling of the captives, about 675 BC II Kings 17:24; Ezra 4:2

— if ye will not believe, surely ye shall not be established, that is, if Judah, both its king and its people, would not firmly cling to God’s Word and promise, they would also cease to exist, too; they would be destroyed.

10 Moreover the Lord spoke again unto Ahaz, saying,

— moreover, the Lord, through the prophet Isaiah, spoke again unto Ahaz, who had not answered upon the consoling message of the Lord’s messenger, since he had already made arrangements to get the assistance of Assyria, saying, in an earnest endeavor to have him place his trust in the help of the Lord,

11 “Ask thee a sign of the Lord thy God; ask it either in the depth or in the height above.”

— ask thee a sign of the Lord, thy God, this offer to perform a miracle being intended to confirm the promise just made; ask it either in the depth, in the underworld, in hell, or in the height above, in heaven.

— the Targum says, “ask that a miracle may be done for thee upon earth, or that a sign may be shown thee in heaven” the Lord permitted Ahaz to attach his faith to a condition named by himself, so that every excuse of unbelief would be taken from him.

12 But Ahaz said, “I will not ask, neither will I tempt the Lord.”

— but Ahaz said, I will not ask, neither will I tempt the Lord. He rejected the offer of God the Almighty with a hypocritical pretext; trusting in an earthly ally; this was the very climax of obduration. When unbelief assumes the garments of piety, the effect is much more loathsome than open blasphemy and mockery.

13 And Isaiah said, “Hear ye now, O house of David! Is it a small thing for you to weary men, but will ye weary my God also?

— and Isaiah, through whom the Lord was addressing the apostate king, said, Hear ye now, O house of David, not only the present monarch being addressed, but all his associates as well:

— is it a small thing for you to weary men, making the prophet, who had labored so long and faithfully in trying to win him for the truth, both disgusted and weary, but will ye weary my God also? so that he also becomes filled with weariness and turns from the reprobate people in disgust and delivers them into the destruction they so deliberately sought.

14 Therefore the Lord Himself shall give you a sign: Behold, a virgin shall conceive and bear a Son, and shall call His name Immanuel.

— in a significant revelation of his almighty power, the Lord himself shall give you a sign, cause a miracle to happen which would have abiding significance. Behold, an exclamation calling attention to the extraordinary prophecy now following, a virgin, literally, “the virgin,” that certain virgin whom the Lord had even now selected for this purpose;

— not merely an unwed woman of marriageable age as the Masoretic text says Isaiah 7:14; but an undefiled maiden, Matthew 1:23-25;

— the Targum says, “Therefore the Lord Himself shall give you a sign: Behold, a virgin shall conceive, and bear a son, and she shall call His name Immanuel.”

— the Septuagint says, “Therefore the Lord himself shall give you a sign; behold, a virgin shall conceive in the womb, and shall bring forth a son, and thou shalt call his name Emmanuel.”

— this is an example of the lying pen of the scribes in Jeremiah 8:8:

“How can you say, ‘We are wise, and the law of the Lord is with us’? But behold, the lying pen of the scribes has made it into a lie.’”

— shall conceive, without the carnal knowledge of man, and bear a son, the event being represented as happening now, in the everlasting present of the eternal God, and shall call His name Immanuel, which is correctly interpreted by Matthew as meaning, “God with us.”

— this name characterizes the person, the essence, and the work of the Messiah. The son of the virgin, conceived and born a true human being, yet without sin, is at the same time true, almighty, eternal God. It is the great mystery of godliness: God manifest in the flesh, the Messiah, the true Savior, Creator, Protector and Redeemer of all men;

— and finally, it is a sign of present deliverance to Judah from the confederacy of the two kings of Syria (representing the Gentiles) and Israel (representing the ten-tribes house of Israel); and of future safety, since it was not possible that this kingdom should cease to be one until the Messiah has come, who was and is to spring from Judah, and be of the house of David; wherefore by how much the longer off was his birth, by so much the longer was their safety.

15 Butter and honey shall He eat, that He may know to refuse the evil and choose the good.

— butter, the thick curdled milk, which is a favorite in the Orient, and honey shall the Messiah eat, that he may know to refuse the evil and choose the good, such would be his food beginning with the age of discretion and throughout his life, partaking, as a true human being, of the food of a desolate country.

16 For before the Child shall know to refuse the evil and choose the good, the land that thou abhorrest shall be forsaken of both her kings.

— for before the Child shall know to refuse the evil and choose the good, before he would reach the age of adolescence, the land that thou abhorrest shall be forsaken of both her kings, rather, “desolate will be the land, of the face of whose two kings thou hast a horror,” the judgement of the Lord having been carried out upon it.

17 The Lord shall bring upon thee and upon thy people and upon thy father’s house days that have not come since the day that Ephraim departed from Judah: even the king of Assyria.”

— the Lord shall bring upon thee; these words are directed to Ahaz to show that though he and his kingdom would be safe from the two kings that conspired against him,

— yet evils should come upon him from another quarter, even from the Assyrians he sent to for help, and in whom he trusted; in which the Lord himself would have a hand, and permit them in his providence, in order to chastise him for his unbelief, stubbornness and ingratitude in refusing the sign offered him;

— even the king of Assyria, this kingdom being introduced here as the representative of the great world powers which finally overthrew upon “thy father’s house” that is, Israel (and certain parts of Judah II Kings 18:13); but Judah was spared a hundred years over; and her disintegration began soon after with the captivity of Babylon and continued for centuries.

18 And it shall come to pass in that day that the Lord shall hiss for the fly that is in the uttermost part of the rivers of Egypt and for the bee that is in the land of Assyria.

— and it shall come to pass in that day, at the time when he would send his judgement, first upon Israel then Judah; that the Lord shall hiss for the fly that is in the uttermost part of the rivers of Egypt, the various canals of the Nile;

— and for the bee that is in the land of Assyria; that is, the Assyrian army, so called because the country abounded with bees; and because of the number of their armies, their military order and discipline, and their hurtful and mischievous nature;

— the Targum paraphrases the whole thus, “and it shall be at that time that the Lord shall call to a people, bands of armies, of mighty men, who are numerous as flies, and shall bring them from the ends of the land of Egypt; and to mighty armies, who are powerful as bees, and shall bring them from the uttermost parts of the land of Assyria,”

— and with what swiftness and readiness those numerous and powerful armies should come; and the allusion is to the calling of bees out of their hives into the fields, and from thence into their hives again, by tinkling of brass, or by some musical sound, in one way or another.

19 And they shall come, and shall rest all of them in the desolate valleys and in the holes of the rocks, and upon all thorns and upon all bushes.

— and they shall come and shall rest, all of them as a scourge to his people in the desolate valleys, rather, in the valleys of the declivities, and in the holes of the rocks, in the clefts of the mountains, and upon all thorns and upon all bushes, in all the rich meadow-lands, with the object of devouring and destroying everything in sight;

— the Targum of the whole verse is, “and they shall all of them come and dwell in the streets of the cities, and in the clifts of the rocks, and in all deserts full of sedges, and in all houses of praise,”

— the sense is, that they should be in all cities, towns, and villages, whether fortified or not, and in all houses of high and low, rich and poor, in cottages and in palaces; there would be no place free from them, nor no escaping out of their hands; all caught in a snare: Ezekiel 12:13, My net also will I spread upon him, and he shall be taken in My snare.

20 In the same day shall the Lord shave with a hired razor (namely, by those beyond the river, by the king of Assyria) the head and the hair of the feet, and it shall also consume the beard.

— in the same day shall the Lord shave with a razor that is hired, through an army which he placed in his service, to carry out his will, namely, by them beyond the river, by the king of Assyria, the head, and the hair of the feet; and it shall also consume the beard, the land being depopulated and the entire body of the nation destroyed by the heathen power summoned by the Lord;

— the Targum says, “in that time the Lord shall slay them as one is slain by a sharp sword, by clubs, and by saws, by those beyond the river, and by the king of Assyria; the king, and his army, and even his rulers, together shall he destroy.”

21 And it shall come to pass in that day that a man shall nourish a young cow and two sheep;

— and it shall come to pass in that day that a man shall nourish a young cow and two sheep; this seems to denote both the scarcity of men and cattle, through the ravages of the army of the Chaldeans; that there should not be large herds and flocks, only a single cow, and two or three sheep; and yet men should be so few, and families so thin, that these would be sufficient to support them comfortably.

22 and it shall come to pass, for the abundance of milk that they shall give, that he shall eat butter, for butter and honey shall every one eat that is left in the land.

— and it shall come to pass for the abundance of milk that they shall give; the cow and the two sheep, having large pastures, and few cattle to feed upon them, those few would give such abundance of milk, that the owner of them would make butter of it, and live upon it, having no occasion to eat milk; and there being few or none to sell it to;

— he shall eat butter; for butter and honey, which was abundant in the wild state, shall everyone eat that is left in the land, signifying that though they would be few, they would enjoy a plenty of food as their small flocks and herds would furnish them with;

— the Targum interprets this of the righteous that shall be left in the land; but it is rather to be extended unto all, righteous and unrighteous.

23 And it shall come to pass in that day in every place where there were a thousand vines worth a thousand silverlings, that it shall be even for briers and thorns.

— and it shall come to pass in that day, at the time when God’s judgement would be carried out, that every place shall be, it shall even be for briers and thorns for want of persons to stock the ground and cultivate it.

24 With arrows and with bows shall men come thither, because all the land shall become briers and thorns.

— with arrows and with bows shall men come thither, for fear of wild beasts, serpents, and scorpions to hunt wild beasts in the former orchards, because all the land shall become briers and thorns;

— Q: is this a prophecy or an historic account? Seems like it is a preamble to another prophecy since it was stated, “In latter days you will understand it fully!”

25 And on all hills that shall be dug with the mattock, there shall not be a coming thither for fear of briers and thorns, but it shall be for the sending forth of oxen and for the treading of lesser cattle.

— and on all hills that shall be digged with the mattock, which ordinarily were hoed and cultivated, there shall not come thither the fear of briers and thorns, that is, there shall be now no fences made of briers and thorns which deter cattle from entering into fields and vineyards thus fenced;

— but it shall be for the setting forth of oxen, and for the treading of lesser cattle; there being no fence of briers and thorns to keep them out, cattle both of the greater and lesser sort should get into the corn, and feed upon it, and make such places desolate, where much pains were taken to cultivate them;

— the Targum says, “it shall be for a place of lying down of oxen, and for a place of dwelling of flocks of sheep.”

Isaiah 8

1 Moreover the Lord said unto me, “Take thee a great scroll, and write in it with a man’s pen concerning Mahershalalhashbaz.”

— moreover the Lord said unto Isaiah, ”Take thee a great roll,” evidently this is another prophecy, a large writing-tablet of the kind usually employed, and write in it with a man’s pen, the stylus making impressions on the wax covering the tablet in such a way that the ordinary man could read the script;

— concerning Mahershalal-hash-baz (“Make speed to the spoil Hasten to the prey”). The inscription, as made by Isaiah, was purposely enigmatic, the purpose being to arouse the interest and curiosity of the people, to make them feel that the announcement contained in these mysterious words was very important;

— the Targum says, “write in it a clear writing;” that is, very plain, explicit and legible.

2 And I took unto me faithful witnesses to attest: Uriah the priest and Zechariah the son of Jeberechiah.

— and Isaiah took unto himself faithful witnesses to record concerning the spoiling of Syria and Israel; this the Lord himself choosing them through the prophet to be present and to testify to Isaiah’s preparing the tablet, Uriah, the priest, II Kings 16:10, and Zechariah, the son of Jeberechiah;

— these men could later, when the prophecy was fulfilled, vouch for the fact that Isaiah had written concerning the future. But in close connection with this event there was another.

3 And I went unto the prophetess, and she conceived and bore a son. Then said the Lord to me, “Call his name Mahershalalhashbaz.

— and I went unto the prophetess, his own wife, so called not because she prophesied but because she was the wife of a prophet; and she conceived and bare a son;

— then said the Lord to Isaiah, Call his name Maher-shalal-hash-baz, the same mysterious words which had been written on the tablet almost a year before, the word signifying either “Make speed to the spoil; Hasten to the prey,” or “The spoil hastens Robbery hastens forward.”

Nothing is known about this prophetess and scholars are not in agreement concerning the role she played in Isaiah’s ministry. Some scholars believe that she was called a prophetess because she was married to the prophet Isaiah. Others believe that this mysterious woman was a prophet in her own right.

4 For before the child shall have knowledge to cry ‘My father,’ and ‘My mother,’ the riches of Damascus and the spoil of Samaria shall be taken away to the king of Assyria.”

— for before the child shall have knowledge to cry, “My father,” and “My mother,” that is, before the passing of another year;

— the riches of Damascus (Syria) and the spoil of Samaria (Israel; II Kings 17:6) shall be taken away before Assyria, so that all their wealth would be borne as a trophy before their king. This happened about the year 739 BC; Syria being entirely overthrown, together with that part of the northern kingdom which was east of the Jordan and the beginning of Israel’s destruction.

5 The Lord spoke also unto me again, saying, — the Lord spoke unto Isaiah again, in a series of prophecies whose final object was rich comfort to the true believers in Judah, saying,

6 “Inasmuch as this people refuseth the waters of Shiloah that flow softly, and rejoice in Rezin and Remaliah’s son,

— forasmuch as this people refuseth the waters of Shiloah, the same with Siloam, the spring and tiny brook which sprang up at the foot of the Temple-mount and with another spring, the Gihon, fed the pool Siloam;

— that go softly, with none of the boisterousness of a large stream, such as the Euphrates, and rejoice in Rezin and Remaliah’s son, the latter statement referring chiefly to the people of the northern kingdom with their trust in the strength of men and in the power of huge armies;

— the Targum paraphrases the words thus, “because this people loathed the kingdom of the house of David which ruled them quietly, as the waters of Shiloah which flow softly.”

7 now therefore, behold, the Lord bringeth up upon them the waters of the river, strong and many, even the king of Assyria and all his glory; and he shall come up over all his channels and go over all his banks.

— now, therefore, behold, the Lord bringeth up upon the Euphrates, usual for mighty kings, kingdoms, and armies to be signified by such waters, for their multitude and strength; typical of an entire heathen power bent upon the destruction of Israel;

— strong and many, even the king of Assyria and all his power; he shall come up over all his channels and go over all his banks, like a mighty river overflowing at the time of the spring freshets;

— the Targum says, “therefore behold the Lord shall bring and cause to ascend upon them, the army of the people, who are many as the waters of a river, strong and mighty, the king of Assyria, and his army; and he shall come up upon all his rivers and shall overflow all his banks.”

8 And he shall pass through Judah; he shall overflow and go over, he shall reach even to the neck. And the stretching out of his wings shall fill the breadth of thy land, O Immanuel.”

— and, he shall pass through Judah, penetrating to its remotest ends; that is, to Jerusalem: the whole land is compared to a body, of which Jerusalem was the head;

— the Assyrian army, comparable to the waters of a great river, overflowed the whole land, took all the fenced cities of Judah, and came up even to Jerusalem, so that the whole was in great danger of being drowned and destroyed; threatening Judah’s very life;

— and stretching out of his wings, as the streams overflow the main channel of the river on either side, shall fill the breadth of thy land, O Immanuel, Judea, called Immanuel’s land, because the Messiah would be born there;

— thus the judgement would begin in Israel and progress southward to encompass Judah as well, threatening its existence. Therefore the end of the sentence is a call for help addressed to Immanuel, the Messiah, not to forsake his people, but to remember them in his redemption.

9 Associate yourselves, O ye people, yet ye shall be broken in pieces! And give ear, all ye of far countries. Gird yourselves, and ye shall be broken in pieces; gird yourselves, and ye shall be broken in pieces!

— associate yourselves, O ye people, both of Syria and Israel, whose two kings were confederate against Judah; and ye shall be broken in pieces, for all enemies directing their attacks against the people of God will finally be destroyed;

— and give ear, all ye of far countries, the nations inhabiting distant parts of the earth; gird yourselves, in preparing for battle, and ye shall be broken in pieces. The double imperative in the Hebrew and the repetition of the command makes it all the more impressive; it places the majesty of God in contrast to the feeble endeavors of men to overthrow His power.

10 Take counsel together, and it shall come to nought; speak the word, and it shall not stand, for God is with us.

— take counsel together, against the Lord and against his people, Psalms 2:2, and it shall come to naught; speak the word, in discussing the attack, and it shall not stand, it will most certainly be frustrated; for God is with us;

— with Immanuel on their side, the children of God have a refuge against all enemies. Even if all the powers of this world combine to attack his kingdom, they are bound to suffer defeat.

11 For the Lord spoke thus to me with a strong hand, and instructed me that I should not walk in the way of this people, saying,

— for the Lord spoke thus to Isaiah with a strong hand, literally, “while his hand became strong,” while his Spirit came upon the prophet with power, and instructed Isaiah that he should not walk in the way of this people, saying, namely, in warning the prophet and those who adhered to his people against the great mass of reprobates in Israel and Judah,

12 “Say ye not, ‘A confederacy,’ to all those to whom this people shall say, ‘A confederacy’; neither fear ye their fear, nor be afraid.

— say ye not, “A confederacy,” to all them to whom this people shall say, “A confederacy,” literally, “Do not call conspiracy all that this people calls conspiracy,” the prophet and his disciples should not be filled with apprehension on account of the conspiracy and confederation of Syria with the northern kingdom;

— neither fear ye their fear nor be afraid, let not the same fear possess you as does them, on account of Syria and Israel combining together against Judah; nor be afraid of their two kings as they were; since there was nothing to fear from them.

13 Sanctify the Lord of hosts Himself; and let Him be your fear, and let Him be your dread.

— sanctify the Lord of hosts himself, giving him the honor, and let him be your fear and let him be your dread, that is, the object of fear and dread; not of a servile fear and dread, but of a holy reverence and godly fear; standing in awe of him.

14 And He shall be for you a sanctuary, but for a stone of stumbling and for a rock of offense to both the houses of Israel, for a trap and for a snare to the inhabitants of Jerusalem.

— and the Lord of hosts shall be for a sanctuary, a safe, sheltering, holy asylum to all believers; but for a stone of stumbling and for a rock of offense to both the houses of Israel, causing them to fall, for a gin, a trap set in the way, and for a snare to the inhabitants of Jerusalem, namely, to those who do not truly fear him.

— although Isaiah 8:14 refers to “both houses of Israel” or the “two houses of Israel” it implies the two houses of Jacob, the full twelve tribes. But more often the names of the two houses are seperated, namely the 10-tribes “house of Israel” and the 2-tribes “house of Judah.”

15 And many among them shall stumble and fall and be broken, and be snared and be taken.”

— and many among them, all those who persist in their enmity toward the Lord, shall stumble, by their own fault, and fall, and be broken, and be snared, and be taken; and so die in captivity for their sins and even to perish eternally. The allusion is to birds being taken in a snare or trap or with bird lime and therein or thereby held and detained.

16 Bind up the testimony, seal the law among my disciples.

— bind up the testimony, so the Lord says to Immanuel, the Messiah, or directly to Isaiah, seal the Law among my disciples, so that the Word of the Lord is sealed and kept safe through the power of the Savior exerted through the Lord’s message; which is the testimony from the Son of God.

17 And I will wait upon the Lord, who hideth His face from the house of Jacob, and I will look for Him.

— and Isaiah will wait upon the Lord, so Immanuel or the prophet calls out in cheerful confidence, that hideth his face from the house of Jacob, by rejecting the great mass of unbelievers among the people, and Isaiah will look for him.

18 Behold, I and the children whom the Lord hath given me are for signs and for wonders in Israel from the Lord of hosts, who dwelleth in Mount Zion.

— behold, the Messiah and the children whom the Lord hath given him, all those who have accepted the God of Israel in true faith, who belong to the elect of the Lord, are for signs and for wonders in Israel, placed before the eyes of all men of the whole world, as a remarkable evidence of God’s love;

— from the Lord of hosts, which dwelleth in Mount Zion; the Son and Mediator, Yeshua, through his Word, as proclaimed by the mouth of his servants, gains those whom the Father has given him and will, on the Last Day, present this entire host to the Father in the Temple of heaven. Cf Hebrews 2:13.

19 And when they shall say unto you, “Seek unto those who have familiar spirits and wizards, who peep and who mutter,” should not a people seek unto their God? For the living, to the dead?

— and when the unbelieving people shall say unto you, in endeavoring to coax the faithful away from the truth of the revealed Word, Seek unto them that have familiar spirits, those asserting that they possess the ability of interviewing departed souls;

— and unto wizards that peep and that mutter, that is, to those given to sorcery and the magic world, said of the murmuring noises made in imitation of the shades in the realm of death and of the whispering of magical formulas which they claimed to have received from disembodied spirits, just as the modern tribe of spiritists does: shall not be God’s people;

— so the Lord asks, seek unto their God? turning to him for counsel and assistance in every emergency in life, for the living to the dead? How can men be so foolish as to seek help from the dead? as the spiritists insist that they are quoting the spirits of the departed. Over against this blasphemous foolishness the Lord places his urgent summons:

20 To the law and to the testimony! If they speak not according to this word, it is because there is no light in them.

— to the Law and to the testimony! Turn to the Word and the promises of the Lord alone; search the Scriptures, trust in his Message, in the glorious assurance of salvation contained therein; make the clear exposition of his Word the one guide of their lives!

— if they, the unbelieving majority, speak not according to this word, if they do not join in this call and invitation nor heed its summons, it is because there is no light in them, of the punishment that should be inflicted on them for their neglect of the prophecies of the Old Testament and their rejection of the Messiah.

21 And they shall pass through it sorely beset and hungry; and it shall come to pass that, when they shall be hungry, they shall fret themselves and curse their king and their God, and look upward;

— and they, the unbelievers, shall pass through it, walking about blindly in the land, hardly bestead, oppressed both from within and without, and hungry, being hungry often and earnestly desirous of the coming of their vainly expected Messiah, as a Saviour to them; in the very depths of misery because they couldn’t find him;

— and it shall come to pass that when these unbelievers shall be hungry, in the midst of tribulation besetting them on every hand, they shall fret themselves, be filled with a helpless rage, and curse their King and their God, blaspheming the Lord and his Son, the true Messiah, who is the King of Israel, and God manifest in the flesh; whom the unbelieving pretenders called accursed and blasphemed.

22 and they shall look unto the earth and behold trouble and darkness, dimness of anguish, and they shall be driven to darkness.

— and those people in distress, upwards and downwards, they shall look unto the earth, seeking alleviation and deliverance from their affliction, and behold trouble and darkness, dimness of anguish, adversity and miseries of all kinds, not a ray of relief and salvation penetrating the night of their suffering;

— and these unbelievers shall be driven to darkness, cast out into utter darkness. Such is the punishment of God upon the wicked, upon those who reject the Messiah, even here on earth; how much more terrible, then, will the condemnation of eternity be into which the present punishment will merge!

Isaiah (Ch 5-6)

•July 12, 2023 • Leave a Comment

In general, Isaiah’s prophecy and warning message are for “the house of Israel and the men of Judah.” God had planted the vineyard indeed which was composed of Israel and Judah; now he would remove all the protection from his people and cause them to be overrun and be destroyed:

“I will take away the hedge thereof, and it shall be eaten up; and break down the wall thereof, and it shall be trodden down.”

Answering his call, Isaiah said, “Here I am; send me” (Isaiah 6:8); we learn that this that this was the beginning of his mission, and this prophecy was written later.

Hence understanding the timing of the message of the wordings in Isaiah are more subjective than either the books of Ezekiel or Revelation.

Isaiah 5

1 Now will I sing to my Well-beloved a song of my Beloved concerning His vineyard: my Well-beloved hath a vineyard on a very fruitful hill.

— now will Prophet Isaiah sing to his well-beloved a song of his God the Father, singing to Yehovah, the Lord of hosts, expressing the thoughts of the Lord with all his heart and soul,

— touching his vineyard, that of his Kingdom at the time of the prophet. His well-beloved hath a vineyard in a very fruitful hill, literally, “on the horn, or summit, of a son of oil,” the vineyard being situated on a hill and having most fertile soil;

— the Targum, whose origin in the Aramaic language could be traced to Ezra, paraphrases the words thus, “the prophet said, I will sing now to Israel, who is like unto a vineyard, the seed of Abraham, my beloved, a song of my beloved, concerning his vineyard. My people, my beloved Israel, I gave to them an inheritance in a high mountain, in a fat land.”

2 And He fenced it, and gathered out the stones thereof, and planted it with the choicest vine; and built a tower in the midst of it, and also made a wine press therein. And He looked for it to bring forth grapes, and it brought forth wild grapes.

— and he fenced it, rather, spaded or hoed it thoroughly, and gathered out the stones thereof, which hindered the proper cultivation of the ground, and planted it with the choicest vine, a very fine Oriental variety of grape, called sorek, and built a tower in the midst of it, this being interpreted as a watchtower; but the Targum says, “and I built my sanctuary in the midst of them:”

— and also made a winepress therein, the lower trough into which the grape-juice flowed from the winepress proper; and he looked that it should bring forth grapes, the fruit of the excellent vine which he had planted there, but it brought forth wild grapes: bad grapes; corrupt, rotten, stinking ones, the sour product of the wild vine or of a similar plant;

— that is, God had planted the vineyard indeed which was composed of Israel and Judah; he would now remove all of the protection from his people and cause them to be overrun and be destroyed.

3 “And now, O inhabitants of Jerusalem and men of Judah: Judge, I pray you, between Me and My vineyard.

— and now, O inhabitants of Jerusalem and men of Judah, to whom the prophet is specifically addressing himself, appealing to them to be judges in this difficult situation: Judge, I pray you, between me and my vineyard, making their decision on the basis of the evidences presented to them, which were visible to even the casual onlooker.

4 What could have been done more to My vineyard than I have not done in it? Why, when I looked for it to bring forth good grapes, brought it forth wild grapes?

— what could have been done more to my vineyard that I have not done? The Targum asks, “what good have I said to do more to my people, which I have not done to them? and what is this I have said, that they should do good works, and they have done evil works?”

— wherefore, when I looked that it should bring forth grapes, but it brought forth wild grapes? Surely if the Lord now abandoned this vineyard, the people themselves must admit that they had fully deserved such treatment, that they had but themselves to blame for their destruction, as the Lord states.

5 “And now, I will tell you what I will do to My vineyard: I will take away the hedge thereof, and it shall be eaten up; and break down the wall thereof, and it shall be trodden down.

— and now God will tell you what he will do to his vineyard, the Judge himself announcing judgement and punishment which he had decided upon:

— I will take away the hedge thereof, one of thorns and briers being the usual protection of vineyards of the nation, and it shall be eaten up, and break down the wall thereof, as a second means of keeping out marauders, and it shall be trodden down, the emphatic statement of the original being “for a treading down”

6 And I will lay it waste; it shall not be pruned nor dug, but there shall come up briers and thorns. I will also command the clouds that they rain no rain upon it.”

— and God will lay it waste, for a complete ruin; it shall not be pruned, to remove the superfluous shoots, nor digged, to loosen the ground for the admission of air to the roots;

— but there shall come up briers and thorns, making the growth of vines of the right and welcome kind impossible; God will also command the clouds that they rain no rain upon it; hence the land would turn into a desert.

7 For the vineyard of the Lord of hosts is the house of Israel, and the men of Judah, His pleasant plant. And He looked for judgment, but behold, oppression; for righteousness, but behold, a cry.

— for the vineyard of the Lord of hosts is the house of Israel and the men of Judah, his pleasant plant, literally, “the plant of his pleasure” and he looked for justice and judgement would be executed in the land in all respects; that the people would do what is right and good;

— but behold oppression resulted, the infringement of rights by graft and other forms of corruption and wickedness; for righteousness, that is, an outward dealing according to the demands of a righteous conduct, but behold a cry, namely, that of the people who suffer wrong and duffered for such oppression.

8 Woe unto them that join house to house, that lay field to field, till there be no place, that they may be placed alone in the midst of the earth!

— woe unto them that join house to house, the insatiable desire of men to own more and more is the direct and certain result of a gross materialism in the heart of men, in a greed for wealth which is never satisfied, that lay field to field, their covetousness causing them to add one piece of property to another;

— till there be no place, no room for any one else, that they, literally, “ye” for the prophet here turns directly to both the houses of Israel and Judah, may be placed alone in the midst of the earth, thus violating the statutes both concerning the inheritance of real estate and the year of jubilee, Numbers 27:9-11; Leviticus 25:10-13.

9 In mine ears said the Lord of hosts: “In truth many houses shall be desolate, even the great and fair, without inhabitant.

— in mine ears said the Lord of hosts, the cry of the sins of covetousness and ambition before mentioned; the great Ruler of the universe himself making it known to his prophet,

— of a truth many houses shall be desolate, even great and fair, the beautiful homes of the rich, such as the houses of the king, of the princes, and nobles, judges, counsellors, without inhabitant, as a punishment upon their greed.

10 Yea, ten acres of vineyard shall yield but one bath, and a homer of seed shall yield but an ephah.”

— yea, ten acres of vineyard shall yield one hath, for their fields shall be barren and unfruitful; and the seed of an homer, about eight bushels, shall yield an ephah;

— the Targum makes this barrenness to be the punishment of their sin, in not paying tithes paraphrasing the words thus, “for because of the sin of not giving tithes, the place of ten acres of vineyard shall produce one bath.”

Remember: the Targum is another source of the Bible. Started by Ezra for those returning from Babylon and for these returnees they could only understand in Aramaic; hence the Targum is as if Ezra is speaking to them in ancient times and to us from the verses quoted.

11 Woe unto them that rise up early in the morning, that they may pursue strong drink; that continue until night, till wine inflame them!

— woe unto them that rise up early in the morning that they may follow, eagerly pursue, strong drink, a kind of brandy prepared from dates, apples, pomegranates, honey and barley;

— that continue until night, protracting their session of excessive indulgence until the cool of the evening and beyond, till wine inflame them, putting them into a condition where they are ready for all the works of darkness.

12 And the harp and the viol, and the taboret and pipe, and wine are in their feasts; but they regard not the work of the Lord, neither consider the operation of His hands.

— and the harp, or zither and the viol, a guitar-like instrument, the tabret, the tambourine and pipe, a kind of flute and wine are in their feasts, so that they lived jovially and merrily, of these their banquets consist, this is all they have in mind in planning and executing their drinking-bouts;

— but they regard not the work of the Lord, meaning the work of the law as the Targum says; they were deaf to the message of Yehovah the Almighty in the law, in nature, in history, especially in the preaching and warnings of his prophets, neither consider the operation of his hands, in preparing the punishment of all unrighteousness and wickedness for all the guilty.

13 Therefore my people are gone into captivity, because they have no knowledge; and their honorable men are famished, and their multitude dried up with thirst.

— therefore my people, as the Lord still affectionately calls them, are gone into captivity, the visitation of the Assyrian captivity for the house of Israel being pictured as already taken place, because they have no knowledge, or as some render it, “because they knew not the Lord” not only it caught them unaware but because they had hardened their hearts against all understanding;

— and their honorable men are famished, literally, “become starvelings,” people suffering hunger, and their multitude dried up with thirst, a vivid description of Israel as it was driven into exile. Such is ever the consequence when the greed and luxury-craving people of this world deliberately exclude the understanding of spiritual things from their hearts.

14 Therefore hell hath enlarged herself, and opened her mouth beyond measure; and their glory and their multitude and their pomp, and he that rejoiceth, shall descend into it.

— therefore hell, that is, the grave, to receive the dead who die from famine and thirst; signifying that the number of the dead would be so great, that the common burying places would not be sufficient to hold them hath enlarged herself and opened her mouth without measure, to receive the great number of victims;

— and their glory, the splendor of their wickedness and their multitude and their pomp, the tumult and noise of their drunken shouting, and he that rejoiceth, those finding their enjoyment in the excesses of this world shall descend into it. Then all the laughter and shouting of the children of this world will be changed to cries of woe, weeping and gnashing of teeth.

15 And the lowly man shall be brought down, and the mighty man shall be humbled, and the eyes of the lofty shall be humbled.

— and the mean man shall be brought down, and the mighty man shall be humbled, laid low in the dust, and be equal to the poor; for in the grave, princes and peasants are alike; men of every rank and station being included in the Lord’s condemnation, and the eyes of the lofty shall be humbled, so that they are no longer lifted up in pride.

16 But the Lord of hosts shall be exalted in judgement, and God who is holy shall be sanctified in righteousness.

— but the Lord of hosts, the Father, he who exerts unlimited authority over the world and all its fortunes, shall be exalted in judgement, the very overthrow of the wicked redounding to his glory, and God that is holy shall be sanctified in righteousness, give evidence of his holiness in exercising justice upon the ungodly.

17 Then shall the lambs feed according to their manner, and the waste places of the fat ones shall strangers eat.

— then shall the lambs feed after their manner, that is, the people of God, the disciples of Christ, as on their usual pasturage, and the waste places of the fat ones shall strangers eat, the nomad tribes of the desert again occupying the land which had been held by similar people in ancient days. Thus the land of Judea and Samaria would become a monument of God’s justice.

18 Woe unto them that draw along iniquity with cords of vanity, and sin as it were with a cart rope;

— woe unto them that draw iniquity with cords of vanity, their first excuses to themselves being like hair-strings, but their increasing callousness finally causing them boldly to draw their guilt to them as with heavy cords;

— and sin, as it were, with a cart-rope, they hitch it to them like draft-horses dragging a heavy wagon, laying themselves to the traces with all their might, utterly ignoring the thought of a day of vengeance;

— thus the Targum interprets it of such that begin with lesser sins, and increase to more ungodliness; paraphrasing it thus, “woe to them that begin to sin a little, and they go on and increase until that they are strong, and “their” sins “are” as a cart rope”

19 who say, “Let Him make speed and hasten His work, that we may see it; and let the counsel of the Holy One of Israel draw nigh and come, that we may know it.”

— that say, Let him make speed and hasten his work that we may see it, that is, the threatened retribution, and let the counsel of the Holy One of Israel draw nigh and come that we may know it!

— their blasphemous mockery will surely draw down upon them the punishment of the Lord. And so far as the mockers of our day are concerned, the time will come when they, overcome with terror at the revelation of God’s judgement upon them, will call upon the mountains to fall upon them and to the hills to cover them.

20 Woe unto them that call evil good, and good evil; that count darkness as light, and light as darkness; that put bitter for sweet, and sweet for bitter!

— woe unto them that call evil good and good evil, or that call evil men good, and good men evil; thus reversing all principles of true morality; that is, that excuse the one and reproach the other; that put darkness for light and light for darkness, particularly in palliating the wickedness of sin, in representing avarice, luxury, the lust of the flesh as harmless; and pervert the order which God hath appointed;

— it started with the ten tribes preferring the worship at Dan and Bethel, before that at Jerusalem; and today, they prefer worshipping

(a) Astarte, the queen of heaven; from whom Easter is derived; and

(b) the palm tree, Mithra, the Persian Sun-god now proliferates during Christmas; with decorated with lights;

— in preference to God’s commandments in their celebration of the Passover, Pentecost and Tabernacles, which are dismissed as Jewish legalism (more at the end);

— that put bitter for sweet, by condemning the godly, the children of God as enemies of mankind, and sweet for bitter, by glossing over transgression and thus leading men into further destruction.

21 Woe unto them that are wise in their own eyes, and prudent in their own sight!

— woe unto them that are wise in their own eyes, arrogant in their self-conceit, prudent in their own sight, such people being beyond the necessity of learning, their lack of humility causing them to reject all instruction that is brought to their notice, especially the message from the prophets of the Lord of hosts.

22 Woe unto them that are mighty to drink wine, and men of strength to mingle strong drink,

— woe unto them that are mighty to drink wine, and men of strength to mingle strong drink, champions of dissolute living, selling justice in order to obtain the means to indulge in the service of mammon and luxury;

— the Targum interprets it, “men of riches” one who can afford to drink wine and strong drink; which carries the sense not to the strength of their bodies, but of their purses;

23 who justify the wicked for a reward, and take away the righteousness of the righteous from him!

— speaking of judges and civil magistrates, which justify the wicked for reward, openly seeking bribes and in fulfilling the promises made on the strength of such gifts, take away the righteousness of the righteous from him, deciding against him in court and thus frustrating the ends of justice;

— note that all the sins which are here condemned with such harsh words are found in our day and age as in the days of Isaiah.

24 Therefore as the fire devoureth the stubble, and the flame consumeth the chaff, so their root shall be rottenness, and their blossom shall go up as dust; because they have cast away the law of the Lord of hosts, and despised the word of the Holy One of Israel.

— therefore, as the fire devoureth the stubble, and the flame consumeth the chaff, in a sudden and thorough destruction, so their root, the supposed firm hold of these transgressors, shall be as rottenness, moldy and decayed;

— and their blossom, their outward prosperous appearance, shall go up as dust, flying away like small particles, because they have cast away the Law of the Lord of hosts, in a deliberate, blasphemous rejection, and despised the Word of the Holy One in Israel as in Leviticus 23 to keep his commandment to celebrate the Feasts of Passover, Pentecost and Tabernacles.

25 Therefore is the anger of the Lord kindled against His people, and He hath stretched forth His hand against them, and hath smitten them; and the hills did tremble, and their carcasses were torn in the midst of the streets. For all this, His anger is not turned away, but His hand is stretched out still.

— therefore is the anger of the Lord kindled against his people, and he hath stretched forth his hand against them and hath smitten them, the scene again being painted before the eyes of the people, in order to urge them to repentance;

— and the hills did tremble, under the blow delivered by the Almighty as from a mighty earthquake, and their carcasses were torn in the midst of the streets, lying there as dung, even as it had happened before, II Chronicles 28:6. For all this, although the punishment of the Lord has repeatedly gone forth, his anger is not turned away, but his hand is stretched out still;

— so great was the apostasy in Israel cerebrating Astarte and Mithra that the wrath of the Lord was not yet appeased, especially since the nation showed no signs of any repentance; it will be a shaking of every nation before the wrath of God’s Judgement.

26 And He will lift up an ensign to the nations from afar, and will hiss unto them from the end of the earth; and behold, they shall come with speed swiftly.

— and e, the Lord of hosts in delivering the last great blow, will lift up an ensign to the nations from far, as a signal for them to attack and punish Israel;

— and will hiss unto them from the end of the earth, the figure being taken from the work of the bee-keeper, who coaxes the bees from their hives by a hissing sound; and, behold, they shall come with speed swiftly, most eager to carry out the Lord’s will upon the house of Israel, like Shalmaneser and Nebuchadnezzar did as the Lord’s horsewhips;

— as the Targum paraphrases it, “and behold, a king with his army shall come swiftly, as light clouds.”

27 None shall be weary nor stumble among them; none shall slumber nor sleep; neither shall the girdle of their loins be loosed, nor the latchet of their shoes be broken;

— none shall be weary nor stumble among them; none shall slumber nor sleep, neither shall the girdle of their loins be loosed, to retard their movements; they should make such haste, they should not stumble at any thing by the way, nor rush one against another,

— nor the latchet of their shoes be broken, all this being descriptive of their tireless activity, their unwearied zeal, and their readiness for battle;

28 whose arrows are sharp, and all their bows bent, their horses’ hoofs shall be counted like flint, and their wheels like a whirlwind.

— whose arrows are sharp and all their bows bent, ready to shoot their arrows upon any occasionready to send the arrows to their mark;

— their horses’ hoofs shall be counted like flint, a most important attribute for a campaign of war carried to such distances, and their wheels like a whirlwind, for their rolling resembled the sound of an advancing tempest;

— the Targum says, “and his wheels swift as a tempest.”

29 Their roaring shall be like a lion; they shall roar like young lions; yea, they shall roar and lay hold of the prey, and shall carry it away safe, and none shall deliver it.

— their roaring shall be like a lion, a fearful battle-cry, they shall roar like young lions, eager for their prey;

— yea, they shall roar and lay hold of the prey, Israel becoming an easy victim, and shall carry it away safe, and none shall deliver it, no one being strong enough to come to Israel’s aid in this emergency laid upon it by the Lord.

30 And in that day they shall roar against them like the roaring of the sea; and if one look unto the land, behold darkness and sorrow; and the light is darkened in the heavens thereof.

— and in that day they shall roar against them like the roaring of the sea, the surf breaking on the precipitous shore with a fearful thunder;

— and if one look unto the land, seeking a firm foothold, behold darkness and sorrow, and the light is darkened in the heavens thereof, literally, “darkness distress and light night in the clouds of heaven above,” that is, tribulation and relief would change off quickly in the fate of Israel;

— but the final result would be the blackest night, shutting out all light. That, in brief, is the outline of Israel’s history until the exile, not only the conquest of Nebuchadnezzar, but that of the Romans in the year 70 AD as well.

~~~

Parallel Scriptures in Malachi 2:

3 Behold, I will corrupt your seed and spread dung upon your faces, even the dung of your solemn feasts; and one shall take you away with it.

— even the dung of your solemn feasts, that of the excesses of such pagan feasts (1) Astarte, the queen of heaven; from whom Easter is derived; Jeremiah 7 and Jeremiah 44; (2) Mithra, the sun-god, the palm tree, now proliferates during Christmas; with decorated with lights, tinsel, red and green ribbon, poinsettias and other crowning glory; Jeremiah 10:3-5;

— (3) heavenly bodies, especially the Sun, hence professing Christians have shifted the Sabbath from Saturday to Sunday by outlawing the keeping of the Sabbath. — thus saith the Lord: “Learn not the way of the heathens. . .” Jeremiah 10:2; His wrath and subsequent judgement of throwing dungs onto our faces is the central theme of Jeremiah’s message against idolatrous worship!

— and one shall take you away with it, treating them as though they were themselves dung, to be thrown out in disgraceful heaps; with the dung spread upon them; they looking like a heap of dung, being covered with it, and had in no more account than that;

— the Targum says, “I will make manifest the shame of your sins upon your faces; and will cause to cease the magnificence of your feasts.”

Isaiah 6

1 In the year that King Uzziah died, I saw also the Lord sitting upon a throne, high and lifted up, and His train filled the temple.

— in the year 758 BC when King Uzziah died, that is, in the last year of this king’s successful reign, II Kings 15:1-7; II Chronicles 26, Isaiah saw the Lord, the Almighty, sitting upon a throne, high and lifted up, the prophetic vision, not face to face, permitting the prophet to see the revelation of God,

— for God dwells in an inaccessible light, in a manner which uncovered the divine glory to his inner mind, and his train (the “train” is the skirts, borders or lower parts of the garments) filled the Temple, that is, his kingly robe with its majestic train, fitting emblem of the divine glory, covered and filled the heavenly Sanctuary; the Targum says, “and the Temple was filled with the splendour of his glory.”

2 Above it stood the seraphims; each one had six wings: with two he covered his face, and with two he covered his feet, and with two he flew.

— above the Temple stood the seraphim, ministers of the Lord serving as guardians of the throne. Each one had six wings, in accordance with their nature as heavenly beings;

— with twain he covered his face, for even the seraphim cannot endure the sight of the essential holiness of God, and with twain he covered his feet, for even the angels, with a proper feeling of humility and modesty, prefer to keep their forms covered before the eyes of the Most Holy, and with twain he did fly, floating about the throne of the Lord.

3 And one cried unto another and said, “Holy, holy, holy is the Lord of hosts; the whole earth is full of His glory.”

— and one cried unto another, in a wonderful antiphonal chorus, and said, Holy, holy, holy, is the Lord of hosts, thrice holy not only on account of the supreme excellence of his essential holiness, but false shepherds had taken this opportunity to propagate the false Trinity doctrine of the Godhead;

— the whole earth is full of his glory, literally, “filling the whole earth is his glory” for all men on earth will see the revelation of his divine majesty, all his works, in creation, redemption, sanctification, will serve to magnify him as the supreme and only God. Cf Revelation 4:8.

4 And the posts of the door moved at the voice of him that cried, and the house was filled with smoke.

— and the posts of the door of the Temple, the foundations of the sills, or thresholds, the heavenly Temple with its portals down to the lowest foundation;

— moved at the voice of him that cried, the powerful sound of the entire chorus, and the Temple was filled with smoke, as from the incense of all the prayers of the saints, uniting with the angels above to give praise and adoration to the great Lord of heaven, Revelation 5:8; Revelation 8:3-4.

5 Then said I, “Woe is me! For I am undone, because I am a man of unclean lips and I dwell in the midst of a people of unclean lips; for mine eyes have seen the King, the Lord of hosts.”

— then said Isaiah, overcome with awe and terror at the tremendous impressiveness of the scene, Woe is me! for I am undone, lost, threatened with death and destruction,

— because I am a man of unclean lips, the feeling of his own sinfulness coming over him all the more strongly in view of the perfect holiness which he had just seen, and I dwell in the midst of a people of unclean lips, descendant and member of a generation of sinners;

— for mine eyes have seen the King, the Lord of hosts, between whom and man is not only the gulf separating the Creator from his creatures, but the greater abyss between the holy God and the world of sinners. Cf Exodus 33:20.

6 Then flew one of the seraphims unto me, having a live coal in his hand, which he had taken with the tongs from off the altar. — then flew one of the seraphim unto Isaiah, having a live coal in his hand, which he had taken with the tongs from off the altar, the altar of incense evidently being referred to;

7 And he laid it upon my mouth and said, “Lo, this hath touched thy lips; and thine iniquity is taken away, and thy sin purged.”

— and he laid it upon Isaiah’s mouth, he caused the glowing coal to come into contact with the prophet’s lips, and said, Lo, this hath touched thy lips; and thine iniquity is taken away and thy sin purged, which was abominable in his sight; a burden to him, and the cause of his distress; even all his iniquity, all atoned for;

— the act of the angel evidently had a symbolical meaning, first of all with reference to the atonement made in and through the person of the Messiah, Jesus Christ, the work of redemption carried out in accordance with God’s counsel;

— not only, however, is the prophet, sinful man as he was, assured of the redemption and grace of God, but the Lord also imparts special strength to him and fits him to be the instrument of his inspiration.

8 Also I heard the voice of the Lord saying, “Whom shall I send, and who will go for Us?” Then said I, “Here am I. Send me!”

— also Isaiah heard the voice of the Lord, of the All-powerful, the great Ruler of the universe, saying, Whom shall I send? the call being for volunteers to proclaim the atonement set forth in the vision just vouchsafed the prophet.

— and who will go for us? Then Isaiah said, ‘Here am I; send me.’ The prophet, in the spirit of voluntary service wrought by the Lord, a principal requisite for the proper and effective ministry of the Word, is ready to undertake the task.

9 And He said, “Go, and tell this people: “‘Hear ye indeed, but understand not; and see ye indeed, but perceive not.’

— and God said, Go and tell your people, to which he no longer refers as his people, but as strangers, in the third person, Hear ye indeed, constantly within reach of the Word of God, but understand not; the great works of God by which he reveals himself to mankind, but they perceive not, not really grasping their significance nor applying them to their own condition.

10 Make the heart of this people fat, and make their ears heavy, and shut their eyes; lest they see with their eyes, and hear with their ears, and understand with their heart, and convert and be healed.”

— make the heart of this people fat, insensitive to impressions for good, so that feeling, reason, and will become callous, cold or heartless, and make their ears heavy, the hearing of the mind becoming impaired beyond the possibility of understanding;

— and shut their eyes, namely, those of the spirit, lest they see with their eyes, and hear with their ears, and understand with their heart, and convert, that is, be converted, and be healed. Note that the members or organs spoken of are given in inverted order in the second part of the sentence, to increase its impressiveness.

— It is the judicial hardening, the judgement of obduration, which is here described; it is not that God works obduration, but he surrenders the godless to their evil intent; he withdraws from their hearts with his spirit of understanding.

11 Then said I, “Lord, how long?” And He answered, “Until the cities be wasted without inhabitant, and the houses without man, and the land be utterly desolate,

— then Isaiah asked, Lord, how long? that is, how long would this hardening continue?

— and the Lord answered, Until the cities (Detroits, Chicago, New York, London, Paris) be wasted, altogether desolate, without inhabitant, and the houses without man, without a protector, and the land be utterly desolate, literally, “made desolate a desert,”

12 and the Lord have removed men far away, and there be a great forsaking in the midst of the land.

— and the Lord have removed men far away; not to nearby Babylon, but to the ends of the earth, into the most distant countries, by having them led away into exile, and there be a great forsaking in the midst of the land; and dispersing them among several nations of the world.

13 “But yet in it shall be a tenth, and it shall return and shall be eaten, as a teil tree and as an oak whose substance is in them when they cast their leaves: so the holy seed shall be the substance thereof.”

— but yet in it shall be a tenth, and it shall return and shall be eaten, that is, it shall be burnt again; it was burnt a first time by Nebuchadnezzar king of Babylon, and his army, Jeremiah 52:13 and a second time by Titus Vespasian, to which this prophecy refers; “And if there is yet in it a tenth, it will once more become subject to devouring,”

— and as an oak, whose substance is in them, a mere stump being left, when they cast their leaves, when they are felled, so the holy seed shall be the substance thereof, the stump or stem.

— Thus the obduration upon Israel would continue until the last wrath would come upon Israel, resulting in its destruction; the “holy seed” understand the Messiah; and yet, after the trunk would be hewn down, the stump which remained would bring forth new shoots, a people, the Kingdom of God, consecrated to God. As in Israel, so in all the nations of the world the Lord has his holy seed, people who by his grace obey God’s Word and are saved.

And finally, after the Final Judgement, these are the true elect—all have the common traits of keeping God’s Commandments—that shall be saved:

“And the dragon was wroth with the woman, and he went to make war with the remnant of her seed, who keep the commandments of God, and have the testimony of Jesus Christ” Revelation 12:17

“Here is the patience of the saints: here are they that keep the commandments of God, and the faith of Jesus” Revelation 14:12

“Blessed are they that do His commandments, that they may have right to the Tree of Life, and may enter in through the gates into the city” Revelation 22:14

NATO’s ‘supreme fool’ Jens Stoltenberg

•July 11, 2023 • Leave a Comment

NATO’s provocative lurch eastward and the ‘supreme fool’ Jens Stoltenberg

When judgement was due, Nebuchadnezzar lost his mind, total; and he was made to dwell among the beasts in the wild; however he regained his sanity after eating grass for seven years.

Now, as another judgement is due, the West has already lost half their sanity; although still humans, they’re behaving like supreme fools!

NATO’s provocative lurch eastward and ‘supreme fool’ Jens Stoltenberg

Pearls and Irratations by Paul Keating • July 10, 2023 // The Guardian • July 9, 2023

NATO’s continued existence after and at the end of the Cold War has already denied peaceful unity to the broader Europe, the promise of which the end of the Cold War held open.

And besides, the Europeans have been fighting each other for the better part of three hundred years, including giving the rest of us two World Wars in the last hundred.

“Of all the people on the international stage the supreme fool among them is Jens Stoltenberg, the current secretary-general of Nato.”

Exporting that malicious poison to Asia would be akin to Asia welcoming the plague upon itself. With all of Asia’s recent development amid its long and latent poverty, that promise would be compromised by having anything to do with the militarism of Europe – and militarism egged on by the United States.

Of all the people on the international stage the supreme fool among them is Jens Stoltenberg, the current Secretary-General of NATO.

Stoltenberg by instinct and by policy, is simply an accident on its way to happen.

In February he was drawing parallels between Russia’s assault on Ukraine and China saying, ‘we should not make the same mistake with China.’ That is, that China should be superintended by the West and strategically circumscribed.

Supreme Foolish NATO aiming to encircle China from US Bases

Stoltenberg, in his jaundiced view, overlooks the fact that China represents twenty per cent of humanity and now possesses the largest economy in the world. And has no record of attacking other states, unlike the United States, whose bidding Stoltenberg is happy to do.

‘NATO is the real troublemaker’ – China

Stoltenberg conducts himself as an American agent more than he performs as a leader and spokesperson for European security. Whatever his views on and from Europe, Stoltenberg does not represent the second largest European state, France, which the timely statement from the Élysée over the weekend makes clear.

In August, 2021, the British HMS Queen Elizabeth ignored Beijing’s warnings and danced around the South China Sea. On its way back and without any enemy pursuing, a F-35B fighter jet crashed mysteriously into the Mediterranean!
Sputnik: Image Reveals Upside-Down F-35B Resting on Mediterranean Seafloor

Emmanuel Macron is doing the world a service putting a spike into Stoltenberg’s wheel – reminding all of us that NATO is a military organisation, not a civil one and an organisation focused on Europe and the Atlantic.

“Ephraim shall be desolate in the day of rebuke; among the tribes of Israel have I made known that which shall surely be” Hosea 5:9

I, the Lord, will punish and wipe out Israel. This is my solemn promise to every tribe of Israel. CEV Translation Hosea 5:9

America: A Failed State?

•July 10, 2023 • Leave a Comment

Global Research by Chaitanya Davé • July 4, 2023

The definition of a failed state according to some experts is: A failed state is a political body that has disintegrated to a point where basic conditions and responsibilities of a sovereign government no longer function properly.

Another characteristic of a failed state includes a central government so weak or ineffective that it has an inability to raise taxes or other support and has little practical control over much of its territory…(this does not apply to the USA) and hence there is a non-provision of public services.

According to Robert Longley:

“A failed state is a government that has become incapable of providing the basic functions and responsibilities of a sovereign nation, such as military defense, law enforcement, justice, education, or economic stability.

Common characteristics of failed states include ongoing violence, corruption, crime, poverty, illiteracy, and crumbling infrastructure. Even if a state is functioning properly, it can fail if it loses credibility and the trust of the people.”

Examples of these failed states are: Syria, Somalia, Myanmar, Chad, Iraq, Yemen, Democratic Republic of Congo, Central African Republic, Yugoslavia, Lebanon, Afghanistan, and Sudan. But these are very poor countries. It is understandable that many of the above characteristics can occur in these states. But can you imagine that most of these characteristics also apply to the richest country in the world?

Think about the United States. Except for the defense—in reality weapons of mass destruction– almost all these features also apply to the United States. America meets more than 90% of the criteria for a “Failed State.” Following statistics justify this claim:

Murders: Between 1990 and 2019, there were 531,349 murders in the United States. One of the highest in the world in a “developed” country.

Rapes: In 2019, there were 406,970 victims of rape and sexual assault in the country. According to Statista Research Department, on average, more than 91,000 rape cases per year have occurred since 2015 in the United States. The number of rapes per 100,000 citizens, USA is no. 14 amongst the world’s countries. But for a developed nation, the USA is no. 4 after Sweden, Australia and Belgium as per the World Population Review report of 2021.

Opioid Crisis: In late 1990s, pharmaceutical companies reassured the medical community that patients would not become addicted to prescription opioid pain relievers, and healthcare providers recklessly began to prescribe them to innocent people. Soon opioid overdose began to increase.

According to NIH, nearly 50,000 people in the United States died from opioid-involved overdoses in 2019. Since 1999, nearly 841,000 people have died from drug overdose. In short, while our government was sleeping, hundreds of thousands of Americans were dying from opioid drugs aggressively pushed by a few pharmaceutical companies such as Johnson and Johnson and Purdue Pharma. While people were dying, these pharma company executives were raking in millions of dollars.

No. of prisoners: According to World Population Review, the United States has the highest incarceration rate in the world. About 25% of the world’s prison population lives in the United States, the “leader of the free world.” It holds about 2.19 million prisoners as of 2019 which comes to 437 prisoners per 100,000 people as of 2019. It costs the state about $69,355 per inmate. Blacks are 5.8 times in greater numbers than whites, which shows racist aspect of the system.

Death Row inmates: There were 1,529 people executed from 1976 through 2020. In early 2021, the federal government executed three people.

Innocents Released from Death Row or Prison: According to the Innocence Project, 18 prisoners have been proven innocent and exonerated by DNA testing in the United States after serving many years on death row. They were convicted in 11 states and served a combined 229 years in prison—including 202 years on death row—for crimes they did not commit. There are prisoners in Guantanamo Bay held for more than 17 year and not even tried. This is the kind of justice we have in the United States. This shows how unfair and screwed up is our criminal justice system.

Political Prisoners: There are many political prisoners–too many to mention here–being held in US jails for being political activists. In most cases, they are held in trumped up charges, doubtful conviction etc. based on their race. Most famous one is Julian Assange, an Australian journalist accused of revealing “classified state secrets.”

Basically, he is being made an example by the US government that whoever releases dirty secrets of the US military or government will face long terms in US jail to deter future whistle blowers. Assange faces 75 years in US prison if extradited to the USA from British jail.

Another example is Edward Snowden who is forced to flee to Russia for releasing dirty US secrets. There are many other prisoners such as Leonard Peltier, Mumia Abu Jamal, Ricardo Palmera and many more. They are convicted of crimes without enough or doubtful evidence and are languishing in US jails for many years. This is what “The leader of the free world does at home.”

No. of poor: According to the US Census Bureau’s 2019 Current Population Report, 34 million Americans are considered impoverished-10.5% of the current population. This is the richest country in the world. The poverty rate for American children was 14.4%. For blacks, it is 18.8% and for female headed households, it was 24.3%.

As per World Population Review Report of 2021, while India with world’s 2nd largest population has the poverty rate of 21.9% and no. 22nd, United States, the richest country in the world, the poverty rate is 17.8%, and it is no. 2nd, after United Kingdom (poverty rate-18.6%) amongst the so-called developed countries.

No. of people without Health Insurance: While most European countries have universal health insurance coverage, in 2021, the United States had 9.6% of its population or more than 26 to 30 million—without health insurance while there were 4 million children without the health insurance as per statistica.com.

Instead of Nation Building, numerous US Bases Circling China

America’s Unnecessary and Disastrous Wars: The US has been at war 225 out of 243 years since 1776 according to TheNews.com. According to the World Future Fund, America has been in 19 wars since World War-II: The Korean War, the Vietnam War, wars in Iraq and Afghanistan are some of them.

The Iraq war alone has taken more than a million lives at a cost of more than $5 trillion as per some reports. The total death toll of people killed in all these wars put together is over 12 million. The number of injured is many times this number. Trillions of dollars were squandered in these immoral and unnecessary wars.

The latest war in Afghanistan which has lasted 20 years or more, where the US is finally pulling out, has killed some 47,000 people and it cost the US some $2 trillion. Were these wars necessary? Only the most ignorant will say “yes.”

Use of Chemical Weapons: The United States sprayed 21 million gallons of Agent Orange, an herbicide—deadliest of poison—in Vietnam during the Vietnam War. More than 500,000 civilians were injured permanently. Even their children are being born deformed or without limbs today.

US Military Bases: According to Politico Magazine, the United States still maintains 800 military bases in more than 70 countries and territories abroad while, in contrast, Britain, France and Russia have about 30 bases combined. Maintaining bases and troops overseas cost $85 to $100 billion annually in 2014. That cost is much higher today. Why should we have military bases abroad? What a colossal waste of money while millions don’t have enough food to eat and are in poverty in America itself?

Illegal Interventions in other countries: While the number of foreign interventions stood at 188 till 2017, the leader of the “free world” was found involved in 117 “partisan electoral interventions” between 1946 and 2000 or about 1 of every 9 ballot exercises held since World War-II.

Since World War-II, the United States has sabotaged or destroyed more than 50 democratic movements around the world while supporting compliant dictators on many occasions. The US has a long history of rigging polls, supporting military coups, channeling funds, and spreading political propaganda in various countries.

Amazingly, after these horrific wars, and mass killings of humanity in other countries, there never is discussion on major news media about these blunders. Everything is back to business as usual; everything is conveniently forgotten.

Flawed Constitution: Unlike what majority of Americans are led to believe blindly from childhood in the holiness and greatness of the US Constitution, it has major flaws and is undemocratic. Additionally, it allows legal bribery of political donations to candidates for Presidents, Senators and Congressmen (including state elections candidates) by the rich in the number of billions of dollars during elections.

No wonder, our elected officials listen to their paymasters and legislate laws mainly in favor of their donors. Also, our flawed constitution allows unelected Supreme Court judges to be appointed for life. What a shame!

Broken Political System: American political system is broken. Though there are two parties, they both are corporate parties with their allegiance to American corporate elites, not the American people. Hence most of the laws are enacted favoring the corporate elites and the super-rich or oligarchs.

No. of Uneducated: According to the US Department of Education, 54% of US adults 16-74 years old—about 130 million people—lack proficiency in literacy, reading below the equivalent of a sixth-grade level. As per Barbara Bush Foundation for Family Literacy, this low level of adult literacy could be costing the country $2.2 trillion a year. According to the National Center for Educational Statistics (NCES), 21% of adults in the United States (about 43 million) fall into the illiterate/functionally illiterate category as of April 29, 2020.

No. of Blacks Killed by Police: As per Statista.com, the trend of fatal police shootings in the United States seems to be increasing, with a total of 371 civilians having been shot, of which 71 were black in the first five months of 2021. Year 2020 saw 1021 fatal police shootings while in 2019, there were 999 fatal shootings.

The rate of shootings of blacks was much higher than any other ethnicity showing the racist nature of police brutality. All these figures clearly show that not only the police in America are trigger-happy idiots but they are also racist. In 21st century, the United States is still a very racist country.

Gun Violence: According to teamenough.org/gun-violence-statistics: Every year, 115,551 people in America are shot in murders, assaults, suicides or suicide attempts, unintentional shootings, or by police intervention. Every day, more than 106 people die from gun violence in America. Out of that, 39 are murdered, 64 kill themselves, 1 is killed unintentionally and 1 dies but intent is unknown.

On average, yearly, 38,826 people die from gun violence while 76,725 people survive gun injuries. Every year, 7957 children and teens are shot, 1663 children and teens die from gun violence while 864 are injured. As reported recently by ABC News, as of July 2nd, 2023, there were 338 mass shootings in America. So far, 21000 people died from gun violence which comes to 115 people per day.

The numbers are mind boggling. This can happen only in a wild, wild country that America has become now a days. No other country has such a horrible record. Despite these horrific numbers, gun laws are not tightened enough. Wasted interests such as Gun Lobby-National Rifle Association—prevail because of its corrupting influence—legal bribery of political donations– on our politicians.

As reported by ABC news, so far, more than 13,900 people have been killed by gun violence. But do we have stricter gun laws? No. As per theguardian.com, as of May 7, there were 202 mass shootings in the country. United States has become a “Wild, Wild West” country now.

No. of Billionaires: As per Forbes Magazine, the United States has the highest number of billionaires in the world, numbering 724 as of 2021. China has 626, India has 140 while Germany has 136. The US billionaires’ net worth is staggering $4.4 Trillion.

According to Americansfortaxfairness.org, the total wealth of US billionaires grew by $1.3 trillion during the roughly first seven months of the coronavirus pandemic—a 44% spike in wealth. This increase in wealth is more than it would cost to send a stimulus check of $3900 to every one of the 330 million Americans.

Six Media Giants Control all the News: As per techstartups.com reports, today, 6 media giants control a whopping 90% of what we read, watch, or listen to while giving an illusion of choice and objectivity. By constantly giving Americans the controlled “news,” these media giants, using Noam Chomsky’s phrase, manufacture “consent.”

Majority of us Americans are led to believe that America is doing so much good to the world, bringing democracy and freedom to the world, helping other nations, and maintaining peace around the world. Also, its capitalist economic system is the greatest and the only system that works. Nothing could be farther from the truth. There never is the discussion of other economic systems such as socialism or social democracy.

These media giants are: GE owning Comcast, NBC, Universal Pictures, Focus Features, News Corp owning Fox News, Wall Street Journal and New York Post, Disney controlling ABC, ESPN, PIXAR, MIRAMAX and Marvel Studios, VIACOM owning MTV, NICK Jr, BET, CMT and Paramount Pictures, Time Warner owning CNN, HBO, TIME, Warner Bros, and CBS controlling ShowTime, Smithsonian channel, NFL.COM, Jeopardy and 60 Minutes.

Their total revenue in 2010 was $ 275.9 billion. These media giants are given free reign over America’s airwaves belonging to the American people. All of them have an agenda of controlling what Every American sees, hears, reads, or listens to. Some 232 media executives control the information diet of 325 to 330 million Americans.

In 1983, 90% of American media was owned by 50 companies. By 2011, the same 90% was controlled by only 6 companies. They have consolidated their power.

Who Controls America? Have you ever wondered who really controls America? The answer is Oligarchs, Media Giants, Giant Corporate CEOs, and Wall Street Bankers. Together they wield enormous power over our corrupt politicians who do their bidding and enact laws that always benefit these superrich.

The country has one dollar one vote ‘democracy’, not one citizen one vote. As billionaire Warren Buffet has rightly said, “My class (superrich) is waging a war against the 99%, and they are winning.”

Looking at all the above, it should be clear to any open-minded person that America has huge problems and is creating massive problems in other countries by its foolish wars. Its latest crime is the “proxy war” it has created between Russia and Ukraine. It should be worrisome to everyone how long such dire conditions can last?

How long such massive waste of money in global wars can American economy sustain? For how long American parents will tolerate their sons and daughters being sent to such unnecessary wars to kill and be killed? How long do we Americans tolerate such bad decisions by our “elected” politicians that are taking this country closer and closer to a disaster and bankruptcy?

All indications are there for those who can discern without bias that America is failing to protect its own people. It has become a failed state.

American Empire is in rapid decline. It is just a matter of time.

Unless America drastically changes its national and foreign policies, American Empire will certainly deteriorate and decline further and further until it meets the same fate as the Roman, the British and other empires of history.

Isaiah (Ch 3-4)

•July 9, 2023 • Leave a Comment

The prophecy of Isaiah starts with Judah and Jerusalem but soon it includes many prophecies concerning the house of Israel and other nations.

In both during the Chaldean and Roman times Jerusalem perished in the midst of just such terrible calamities as are threatened with the curses in Leviticus 26 and Deuteronomy 28; and here it is reinstating those curses.

Isaiah 3

1 For behold, the Lord, the Lord of hosts, doth take away from Jerusalem and from Judah the stay and the staff, the whole store of bread and the whole store of water,

— a famine is coming as the Lord takes away the whole store of bread and the whole store of water from Jerusalem and from Judah;

2 the mighty man and the man of war, the judge and the prophet, and the prudent and the ancient,

— also, the Lord takes away men fit to be generals of armies; removed by death before this time, including other staff: wise men, mighty men and honourable men;

3 the captain of fifty and the honorable man, and the counselor and the skilled artificer and the eloquent orator.

— again, more staff and counselors taken away; an eloquent orator is one skilful in enchanting serpents, even then these are taken away;

4 “And I will give children to be their princes, and babes shall rule over them.

— and only given children and babes to be our leaders, commentators, newsreaders, etc; a reference to the incompetence, weakness and ignorance of the people that will be elevated to places of authority as the decline of Israel continues;

— one example is like Donald Trump is a bully who never grew up! Or another like Boris Johnson behaves like a child who’s been caught out by adults:

“He deliberately misled the media and public over the allegations, his appalling insensitivity revealed by having all his lackeys give the same rather silly answer in response to all questions;”

“In the past week Boris Johnson has behaved like a child caught out by adults, avoiding retribution by treating it as a bit of a laugh until forced to admit that his behaviour was completely unacceptable;” again, speaking of Boris Johnson by an observer, Lesley Riddoch.

5 And the people shall be oppressed, everyone by another and everyone by his neighbour; the child shall behave himself proudly against the elder, and the base against the honorable.”

— the arrogant rejection of authority and the utter disregard of God’s law concerning respect for the aged; all respect for the God-given rights of others having vanished; the child shall behave himself proudly against the ancient, without the slightest regard for his superiors,

— and the base against the honorable, not only by ignoring all distinction of rank, but by setting aside the government instituted by God. In other words, tyranny is followed by mob-rule, and this, in turn, by anarchy so that everything is in a turmoil, every semblance of governmental control has vanished;

6 When a man shall take hold of his brother in the house of his father, saying, “Thou hast clothing; be thou our ruler, and let this ruin be under thy hand,”

— one of the same kindred and family; or one of their brethren, not one that is most qualified, that might rule over them — nepotism and corruption — thou hast clothing, having saved at least a decent suit of clothes in the general overthrow, be thou our ruler and let this ruin;

7 in that day he shall swear, saying, “I will not be a healer, for in my house is neither bread nor clothing: Make me not a ruler of the people!”

— in that day shall he refusing to take an obligation upon responsibilities, swear, saying, calling out loudly in protest, I will not be an healer, in trying to save the wreck;

— make me not a ruler of the people; this shows that the state of the nation must be very bad indeed, that men, who are naturally ambitious of power and honour, should refuse government when offered to them; the Targum says, “I am not fit to be a head or governor.”

8 For Jerusalem is ruined, and Judah is fallen, because their tongue and their doings are against the Lord, to provoke the eyes of His glory.

— for Jerusalem is ruined, and Judah is fallen, outward and inward decay is evident, because their tongue and their doings are against the Lord, their apostasy and blasphemy have reached the limit, to provoke the eyes of his glory, the glorious appearance of his holy essence, for they challenge the wrath of the Lord by deliberately planning and executing evil.

9 The show of their countenance doth witness against them, and they declare their sin as Sodom; they hide it not. Woe unto their soul! For they have rewarded evil unto themselves.

— for they have rewarded evil unto themselves, they are bound to bring punishment upon themselves. With a few strokes the prophet draws a picture of moral filth, which fills the reader with loathing of such depths of wickedness.

10 Say ye to the righteous that it shall be well with them, for they shall eat the fruits of their doings.

— say ye to the righteous, to the few who are still found in the midst of the general decay, that it shall be well with him; for they shall eat of the fruit of their doings, their good works, the fruit of their faith, do follow them.

11 Woe unto the wicked! It shall be ill with him, for the reward of his hands shall be given him.

— woe unto the wicked! it shall be ill with him, his will be a lamentable fate; for the reward of his hands, that which he earned by his evil deeds, shall be given him. The godless will have no one to blame but themselves when everlasting destruction comes upon them.

12 As for My people, children are their oppressors, and women rule over them! O My people, they that lead thee cause thee to err, and destroy the way of thy paths.

— children, incompetent and ruthless youngsters are their oppressors, and women, subject to whims and moods, rule over them. O my people, they which lead thee cause thee to err, the leaders becoming misleading, and destroy the way of thy paths, devouring it by their false, erroneous preaching, so that the way of divine truth is no longer visible.

13 The Lord standeth up to plead and standeth to judge the people.

— the Lord stands up to plead, to take up the case of the world, and stands to judge the people and nations of the world, to convict them of their wickedness.

14 The Lord will enter into judgement with the elders of His people and the princes thereof: “For ye have eaten up the vineyard, and the spoil of the poor is in your houses.

— the Lord will enter into judgement with the ancients of his people, who were supposed to be their leaders, and the princes thereof, to whose guidance he had entrusted Israel; for ye have eaten up the vineyard, crushing the Kingdom of God; the spoil of the poor, of whom the Kingdom largely consists, is in your houses, due to the persecution of the rulers.

15 What mean ye that ye beat My people to pieces and grind the faces of the poor?” saith the Lord God of hosts.

— what mean ye that ye beat my people to pieces, crushing them with the most severe tyranny, and grind the faces of the poor in trampling them under foot, saith the Lord God of hosts;

— that is a special sign of the time preceding the Last Days: oppression and persecution of the Kingdom of God and for this the Lord will punish the wicked in full measure. However, it is not only the princes and rulers of the people who have brought God’s judgement upon themselves, but also the women of the land.

16 Moreover the Lord saith: “Because the daughters of Zion are haughty, and walk with stretched forth necks and wanton eyes, walking and mincing as they go, and making a tinkling with their feet,

— the daughters of Zion are haughty and walk with stretched-forth necks, proudly thrown back, and wanton eyes, winking in feigned innocence;

— but with hidden invitation, walking and mincing, with affected, tripping steps, as they go and making a tinkling with their feet, the ankle-chains, which brought about the mincing steps, also producing a delicate ringing,

17 therefore the Lord will smite with a scab the crown of the head of the daughters of Zion, and the Lord will uncover their secret parts.”

— the Lord will smite with a scab the crown of the head of the daughters of Zion, where long hair now is decorated handsomely, will be found nothing but loathsome uncleanness, and the Lord will discover their secret parts, exposing them to shame and disgrace before the whole world.

18 In that day the Lord will take away the bravery of their tinkling ornaments about their feet, and their hair nets and their round ornaments like the moon,

— the Targum renders it, “the ornament of the shoes”; these were put about the place where the shoes were tied; and in the Talmud the word is explained by קורדיקייה, “shoes” which the gloss interprets of wooden shoes: the ornament of their clothing; as if this was the general name for the particulars that follow:

— in the form of the moon; they were no other than bracelets, necklaces or golden chains and the word in the Talmud is rendered עונקייה, “chains.”

19 the chains and the bracelets and the spangled ornaments, — the chains, the ear-pendants and the bracelets or chains worn on wrist or arm and the mufflers, fluttering veils,

20 the bonnets and the ornaments of the legs, and the headbands and the tablets and the earrings,

— the bonnets, turban-shaped diadems, and the ornaments of the legs, the step-chains connecting the ankle-bracelets, and the head-bands, beautiful girdles, and the tablets, perfume capsules, the favorite odor being musk and the earrings, small amulets with verses of magic,

21 the rings and nose jewels, — the rings on their finger and nose jewels; the same with the jewels on the forehead or nose,

22 the changeable suits of apparel and the mantles and the shawls and the crisping pins,

— the changeable suits of apparel, the finest street dresses and the mantles, roomy tunics with sleeves and the wimples, costly shawls, and the crisping pins, beautifully worked hand-bags or boxes,

23 the mirrors and the fine linen, and the hoods and the veils. — looking glasses by which they dressed themselves,

24 And it shall come to pass that instead of sweet smell there shall be stench; and instead of a girdle, a rent; and instead of wellset hair, baldness; and instead of a sash, a girding of sackcloth; and branding instead of beauty.

— and it shall come to pass that instead of sweet smell, the delicate perfume of balsam, there shall be stink and instead of a girdle a rent, nothing but a rope to hold the garments together

25 Thy men shall fall by the sword, and thy mighty in the war. — thy men shall fall by the sword, the defenders of Jerusalem a prey of war and thy mighty in the war.

26 And her gates shall lament and mourn; and she, being desolate, shall sit upon the ground.

— and her gates where the chief men of the city were wont to discuss the welfare of the city, shall lament and mourn, because the seats of the men are empty; and she, the daughter of Zion, the city itself, being desolate, shall sit upon the ground, a picture of desolation.

Isaiah 4

1 And in that day seven women shall take hold of one man, saying, “We will eat our own bread and wear our own apparel; only let us be called by thy name to take away our reproach.”

— and in that day, due to the fact that many men have fallen in battle, seven women shall take hold of one man, in an unnatural denial of womanly modesty, saying, We will eat our own bread and wear our own apparel, not depending upon him for support;

— only let us be called by thy name, that they might be known as his wives, to take away our reproach, for it was considered a disgrace not to be married and bear children. Such are the scenes which preceded the fall of Jerusalem as in the days of Vespasian and Titus, and similar scenes will precede the end of the world.

2 In that day shall the Branch of the Lord be beautiful and glorious; and the fruit of the earth shall be excellent and comely for those who have escaped of Israel.

— the Targum paraphrases the words thus, “at that time shall the Messiah of the Lord be for joy and glory.”

3 And it shall come to pass that he that is left in Zion and he that remaineth in Jerusalem shall be called holy — even every one who is written among the living in Jerusalem

— and it shall come to pass that he that is left in Zion and he that remains in Jerusalem, the elect of the Lord, shall be called holy, consecrated to the Lord and serving him in a holy life, even every one that is written among the living in Jerusalem, those who are appointed by God unto eternal life, Acts 13:48, whether they be of Jews or Gentiles,

4 when the Lord shall have washed away the filth of the daughters of Zion, and shall have purged the blood of Jerusalem from her midst by the spirit of judgment and by the spirit of burning.

— when the Lord shall have washed away the filth of the daughters of Zion, namely, the moral uncleanness and sinfulness which no amount of outward ornament can cover before his eyes;

— and shall have purged the blood of Jerusalem, the outstanding acts of wickedness and guilt, from the midst thereof by the spirit of God rebuking the evil and destroying all wickedness by a thorough winnowing and sifting, for conversion is entirely and alone his work.

5 And the Lord will create upon every dwelling place of Mount Zion, and upon her assemblies, a cloud and smoke by day and the shining of a flaming fire by night; for upon all the glory shall be a defense.

— and the Lord will create upon every dwelling-place of Mount Zion and upon her assemblies, wherever there are congregations of believers, a cloud and smoke by day and the shining of a flaming fire by night;

— these being the vehicle and sign of the merciful presence of Yehovah in the midst of his people; for upon all the glory, in every place of glory where believers are assembled in his name, shall be a defense, a covering, or canopy, the Lord himself, as the King of kings, having his throne in every congregation and causing it, by the gifts of his mercy, to be a glory, a place where his glory shines forth.

6 And there shall be a tabernacle for shade in the daytime from the heat, and for a place of refuge and for a covert from storm and from rain. — and there shall be a tabernacle for a shadow in the daytime from the heat, the Messiah himself dwelling in their midst;

— and for a place of refuge and for a refuge where one may hide in safety from storm and from rain; for the Messiah is the Protector of his Kingdom against the manifold dangers with which it is surrounded. In this way the Branch of the Lord serves for glory to his elect, and the believers cheerfully trust themselves to his keeping.

Wanted in Hong Kong

•July 8, 2023 • Leave a Comment

‘Dozens of Hong Kong residents’ on police national security ‘wanted’ list who escaped to the West ‘will be pursued for life’

South China Morning Post • July 4, 2023 // Yahoo • July 4, 2023 // HKFP July 3, 2023

Dozens of Hongkongers have been placed on a police wanted list for alleged violations of the national security law, including people who were involved in crowdfunding drives, the Post has learned.

The news on Tuesday came a day after police offered rewards of HK$1 million (US$127,700) a head for information leading to the arrest and prosecution of eight opposition figures.

HK Police offered HK$1 million (US$127,700) per head for information leading to the arrest and prosecution to any of these fugitives residing overseas

A government source said city residents suspected of offences under the national security law included people who had jumped bail and fled overseas after they were arrested by police.

The Hong Kong Police Force’s national security department on Monday said that earlier, the city court had approved the issuance of arrest warrants for eight persons including lawmakers Nathan Law, Ted Hui and Dennis Kwok, lawyer Kevin Yam, unionist Mung Siu-tat and activists Finn Lau, Anna Kwok and Elmer Yuen, the clown who had done much entertainment online. They were accused of breaching the Beijing-imposed National Security Law by committing offenses such as collusion with foreign powers and inciting secession.

Elmer Yuen, 74, who was behind a plan to form a “Hong Kong Parliament”

Yuen, 74, who is the father-in-law of pro-establishment legislator Eunice Yung, was said to have urged foreign countries to impose sanctions on Hong Kong officials and members of the Judiciary on various online platforms between July 2020 and May 2023. He was also among the activists behind a plan to form a “Hong Kong Parliament” last year, which promoted Hongkongers’ right to self-determination. Such acts amounted to subverting the state power and foreign collusion, police said.

Local authorities in Hong Kong vowed on Tuesday to “do whatever they can” to crack down on the activities endangering national security as a local court approved the issuance of arrest warrants for eight people including infamous anti-China rioters Nathan Law Kwun-chung and Ted Hui Chi-fung.

The police in the Hong Kong Special Administrative Region (HKSAR) are offering HK$1 million ($127,627) in rewards for each of the wanted persons, which is valid until July 2, 2024. It also called on the eight persons to come back to the HKSAR and turn themselves in, so as to get reduced sentences.

Hong Kong Secretary for Security Chris Tang doubled down on the crackdown against the eight activists, saying authorities are seeking to cut access to their finances including freezing and confiscating their assets. Investigations will be conducted to find those who support them financially in Hong Kong and overseas, Tang said.

Hong Kong national security police announcing arrest warrants for eight overseas activists at a press conference on July 3, 2023

Police on Monday acknowledged they will not be able to arrest the eight if they remain overseas.

Eunice Yung, a pro-Beijing lawmaker and the daughter-in-law of Yuen, supported the police move and said she cut ties with Yuen last August.

“All his acts have nothing to do with me,” she said on Facebook.

Isaiah (Ch 1-2)

•July 8, 2023 • Leave a Comment

Isaiah stands first of all the major prophets according to the Jewish chronology, Isaiah, Jeremiah, Ezekiel, Daniel and the twelve. Though the order of the prophets, Isaiah appeared during the reign of Hezekiah and therefore was well before Jeremiah and Ezekiel. Here, the order of the chapters in this book of Isaiah is no indication of the chronological order.

The Scriptures are often shrouded in cryptic languages; and as usual a prophecy of Isaiah will start with the house of Judah and Jerusalem then spread to the house of Israel and soon it includes many other nations surrounding the region. Our challenge is to decrypt them.

Isaiah 1

1 The vision of Isaiah the son of Amoz, which he saw concerning Judah and Jerusalem in the days of Uzziah, Jotham, Ahaz, and Hezekiah, kings of Judah. — Rabbi Rashi: we have a tradition from our ancestors that Amoz and Amaziah, king of Judah, were brothers;

— we learn from Isaiah 6:8 where he said, “Here I am; send me” that this was the beginning of Isaiah’s mission, and this prophecy in chapter 1 and other were written afterwards. Hence the order of the chapters is no indication of the chronological order in this book of Isaiah;

— the whole prophecy of Isaiah starts with Judah and Jerusalem but soon it includes many prophecies concerning the house of Israel and many other nations and cities;

— the days of Uzziah . . . and Hezekiah, kings of Judah; this occured from 740 BC to 686 BC; and perhaps he had delivered his warning message to the northern house of Israel;

2 Hear, O heavens, and give ear, O earth! For the Lord hath spoken: “I have nourished and brought up children, and they have rebelled against Me. — God have nourished and brought up children; meaning the children of Israel; “my people, the house of Israel, whom I have called children,”

— and they have rebelled against their Lord and King; for the house of Israel were under a theocracy; God, who was their Father, was their King, and they rebelled against him by breaking his laws, which rebellion is aggravated by its being not only of subjects against their King, but of children against their father; the law concerning a rebellious son, see in Deuteronomy 21:18;

— Q: is Isaiah the son of Amoz born of the northern house of Israel or of the southern house of Judah? his interaction was mostly with Hezekiah and other kings of Judah; hence most commentators assumed he was from Judah.

3 The ox knoweth his owner and the ass his master’s crib; but Israel doth not know, My people doth not consider.”

— the ox knoweth his owner, knows his voice when he calls him; and follows him where he leads him, whether to plough in the field or feed in the meadows;

— and the ass his masters crib, or “manger” where he is fed and to which he goes when he wants food and at the usual times; but the house of Israel doth not know his Maker and Owner, his King, Lord, and Master, his Father;

— the number of different words used to describe the sins of Israel are rebellion (Isaiah 1:2), ignorance, lack of consideration (Isaiah 1:3), sin, iniquity, evil-doing, corruption, forsaking God, estrangement from God, backsliding (Isaiah 1:4), revolt, transgression, disobedience, sickness, (Isaiah 1:5) and unsoundness (Isaiah 1:6).

4 Ah, sinful nation, a people laden with iniquity, a seed of evildoers, children that are corrupters! They have forsaken the Lord, they have provoked the Holy One of Israel unto anger, they have gone away backward.

— a seed of evil doers; this is said both of their fathers and of themselves; they were planted the right seed but they had degenerated, becoming a wicked generation;

— they have provoked the Holy One of Israel to anger; by their numerous sins, both of omission and commission;

— as a result the wounds and bruises of Israel mentioned here should not be viewed as resulting from the hostile attacks of her enemies but as the result of the stripes of punishment laid upon Israel by the hand of God.

5 Why should ye be stricken anymore? Ye will revolt more and more. The whole head is sick, and the whole heart faint.

— ye revolt more and more or apostatize more and more; and grow more obdurate and resolute in it.

6 From the sole of the foot even unto the head, there is no soundness in it, but wounds and bruises and putrefying sores; they have not been closed, neither bound up, neither mollified with ointment.

— from the sole of the foot even unto the head, every member of the body politic was afflicted in one way or another or sadly infected with the disease of sin; see Psalms 28:3;

— the Targum, whose origin in the Aramaic language could be traced to Ezra, says, “from the rest of the people, even unto the princes, there is none among them who is perfect in my fear.”

7 Your country is desolate, your cities are burned with fire; your land, strangers devour it in your presence, and it is desolate, as overthrown by strangers.

— this must be speaking of the endtime; and second, was applying the issues or strangers and migrants more to the house of Israel than to the house of Judah;

— if “your country is desolate, your cities are burned with fire” then it is worthwhile to consider some other parallel Scriptures elsewhere; and one is found in Ezekiel:

So who are the strangers that will desolate the house of Israel, identified here as the United States? Many believe Russia was and some still believe it is the main threat of the United States. Others, like warmonger John Mearsheimer of the University of Chicago, give incredible speeches around the world saying China is the main enemy.

And Mearsheimer brilliantly emphasizes the United States are protected by fish to the left and fish to the right, but foolishly negates to address America’s broken border in the South; and that the Scriptures say that America’s main “enemy” comes from the unprotected and porous South:

Ezekiel 20:45 Moreover the word of the Lord came unto me, saying,
46 “Son of man, set thy face toward the South, and drop thy word toward the South, and prophesy against the forest of the Southland.
47 And say to the forest of the South: ‘Hear the word of the Lord. Thus saith the Lord God: Behold, I will kindle a fire in thee, and it shall devour every green tree in thee and every dry tree. The flaming flame shall not be quenched, and all faces from the South to the North shall be burned therein.
48 And all flesh shall see that I, the Lord, have kindled it; it shall not be quenched.’”
49 Then said I, “Ah, Lord God! They say of me, ‘Doth he not speak parables?’”
Ezekiel 21:1 And the word of the Lord came unto me, saying,
2 “Son of man, set thy face toward Jerusalem, and drop thy word toward the holy places, and prophesy against the land of Israel;
3 and say to the land of Israel, ‘Thus saith the Lord: Behold, I am against thee, and will draw forth My Sword out of his sheath and will cut off from thee the righteous and the wicked.
4 Seeing then that I will cut off from thee the righteous and the wicked, therefore shall My Sword go forth out of his sheath against all flesh from the South to the North,
5 that all flesh may know that I, the Lord, have drawn forth My Sword out of his sheath. It shall not return any more.’ (Ezekiel 20:45-21:5)

“Prophesy against the land of Israel,” these Scriptures above are shrouded in cryptic languages and so the Qs are: how would such scenarios be played out? The current Russia/Ukraine and China/Taiwan arises are just two major distractions, but more importantly, who are these enemies the Prophet Ezekiel identifies coming from the SOUTH, and how would God says he will kindle a fire and “all the remnant of the people shall despoil thee?”

For more about the South, a prophecy of Esau or Edom, see Obadiah

For more on the enemy from the South, see A Sword from the South!

For more into another Captivity: see Ezekiel Timeline – 190/40 Years

One Report by McKinsey says of the 60 millions Latinos in the US that had migrated from the South; they often live in ‘deserts’ where adequate housing, groceries are hard to find. “Nearly 9 in 10 of the Latino residents in such communities lived in five states: California, Florida, New Jersey, New York and Texas.”

McKinsey: Latinos are projected to make up 22.4 percent of the US labor force by 2030 and more than 30 percent by 2060 (Latinos population to 111.2 million by ’60); is this analysis wrong? Am I mistaken? Do feel free to present your opinion; thanks.

8 And the daughter of Zion is left as a cottage in a vineyard, as a shed in a garden of cucumbers, as a besieged city.

— this is speaking of the house of Judah, a much small house, compares to the 10-tribes house of Israel, just as a small cottage left in the vineyard as Isaiah saw it.

9 Unless the Lord of hosts had left unto us a very small remnant, we should have been as Sodom, and we should have been like unto Gomorrah.

— some in the north from the house of Israel who had escaped the general desolation, came to the south of the house of Judah and found refuge and protection behind the walls of Jerusalem, which had yet to fall.

10 Hear the word of the Lord, ye rulers of Sodom; give ear unto the law of our God, ye people of Gomorrah:

— this is a warning of what they will be like if they continue with the rebellion and abominations as Sodom and Gomorrah; unless repented off, they would face the same fire and brimstone.

11 “To what purpose is the multitude of your sacrifices unto Me?” saith the Lord. “I am full of the burnt offerings of rams and the fat of fed beasts; and I delight not in the blood of bullocks, or of lambs or of hegoats.

— more important is their altitude, their gratitude, their humanity, their repentance if any, which is well below expectation.

12 When you come to appear before Me, who hath required this from your hand, to tread My courts? — the Sanhedrin in Jerusalem is the highest court which the Most High has set on this earth;

— and the tenets of the Sanhedrin in setting the calendar were ignored; king Jeroboam took the law upon himself and worshipped on the Feast days a month later;

— and he established Bethel and Dan as places to offer sacrifice, against God’s expressed will to be in Jerusalem;

— for his rebellion, Jeroboam was greatly punished: his dynasty would end badly. “His family was eventually wiped out.”

13 Bring no more vain oblations; incense is an abomination unto Me. The new moons and Sabbaths, the calling of assemblies, I cannot endure. It is iniquity, even the solemn meeting.

— Jeroboam’s new moon and sabbaths were an abomination to God; it was outright malicious and rebellious, hence God couldn’t endure and so send them, the house of Israel, off into captivity;

— these assemblies called were the holy convocations on the seventh day Sabbath, at the feasts of Passover, Pentecost, at the blowing of the Trumpets, on the day of Atonement and Tabernacles: Leviticus 23.

14 Your new moons and your appointed feasts My soul hateth; they are a trouble unto Me, I am weary of bearing them. — again, this new moon and their appointed feasts are repeated to show how God hates them;

— God was and is referring to the house of Israel; their appointed feasts a month late, and at Dan and Bethel, instead of in Jerusalem, where he ordains it to be the holy place;

— and they maliciously change the day of worship from Sabbaths to Sundays (more on this at the end).

15 And when ye spread forth your hands, I will hide Mine eyes from you; yea, when ye make many prayers, I will not hear; your hands are full of blood.

— and even when they spread forth their hands in a gesture which is a caricature for prayer, God would hide his face from them, for they were full of rebellions, and their hands are full of violence and injustice before God.

16 Wash you, make you clean, put away the evil of your doings from before Mine eyes. Cease to do evil,

— put away the evil of their doings from before God; the exhortation is not barely to put away their doings, but the evil of them, and that not from themselves, but from the eyes of God, from the eyes of his justice.

— the US is rotting from within, plagued by innumerable domestic problems like no other nation:

deep, chronic political division and turmoil (January 6, 2021); crushing national debt; crumbling infrastructure; unaffordable health care; rampant homelessness; rampant gun violence and mass shootings; systemic racism (“I can’t breathe”); mass incarceration; opioid epidemic increasing poverty and food insecurity; declining public education.

17 learn to do well. Seek judgement, relieve the oppressed; judge the fatherless, plead for the widow. — learn to do well, not just mere knowing, but the doing being emphasised;

— seek justice, doing that which is right, relieve the oppressed, aiding them in obtaining justice;

— plead for the orphans, widows and fatherless, and those deprived of their any protection; in today’s world, it should include the homeless and the refugees.

18 “Come now, and let us reason together,” saith the Lord. “Though your sins be as scarlet, they shall be as white as snow; though they be red like crimson, they shall be as wool.

— though your sins be as scarlet, blood-red with guilt, they shall be white as snow; though they be red like crimson, the color apparently fast and fixed beyond the possibility of fading, they shall be as wool;

— though laden with guilt, God’s people are not condemned to everlasting damnation, but are given and imputed to them perfect righteousness upon repentance.

19 If ye be willing and obedient, ye shall eat the good of the land; — being obedient to God’s commandments and not rebel against them, they would continue with the full enjoyment and blessings of the land.

20 but if ye refuse and rebel, ye shall be devoured with the sword”; for the mouth of the Lord hath spoken it. — with God’s judgement, his wrath and vengeance, the sword shall be drawn against them;

— for the mouth of the Lord hath spoken it; and he will surely make it good for the maintaining of his own honour.

21 How the faithful city has become a harlot! It was full of judgement; righteousness lodged in it, but now murderers.

— how is the faithful city become a harlot! the city of Jerusalem, in which were the Temple, and the pure worship of God, and was in the tribe of Judah, which ruled with God, and was very faithful;

— and probably speaking of Samaria, when the ten tribes revolted, and fell in with the sin of Jeroboam it became like a treacherous wife to her husband;

— and it could be prophetic like modern cities today: New York, Chicago, London, Paris; all are filled with murderous blood.

22 Thy silver has become dross, thy wine mixed with water. — thy silver is become dross:

— meaning either that such persons, who had the appearance of goodness, looked like genuine silver, were now reprobate as the wicked of the earth are like dross;

— thy wine, the leaders and nobles, mixed with water, that is, the judges and rulers of the city had turned from integrity and sincerity to moral impurity.

23 Thy princes are rebellious, and companions of thieves; every one loveth bribes, and followeth after rewards. They judge not the fatherless, neither doth the cause of the widow come unto them.

— thy princes are rebellious, obstinately opposing God and his covenant, and becoming companions of thieves, thinking only of ways and means to satisfy their greed;

— everyone loveth gifts, and followeth after rewards;

— the Targum, whose origin in the Aramaic language could be traced to Ezra, paraphrases it, “everyone says to his neighbour, do me a favour in my cause, I will return ‘it’ to thee in thy cause;” and so justice is perverted.

24 Therefore saith the Lord, the Lord of hosts, the Mighty One of Israel: “Ah, I will ease Me of Mine adversaries, and avenge Me of Mine enemies.

— therefore, saith the Lord, the Lord of hosts, the mighty One of Israel; all these names and titles, which are expressive of the majesty, power and authority, are to give greater solemnity and weight to what follows; and to show that he is able to accomplish what he determines and threatens to do;

— I will ease me of mine adversaries, and avenge me of mine enemies; thus God, speaking after the manner of men, represents himself as feeling satisfaction in executing justice upon obstinate and incorrigible offenders.

25 And I will turn My hand against thee, and wholly purge away thy dross, and take away all thy tin.

— and I will turn my hand upon thee, namely, against Samaria, the faithless, sinful city that Jeroboam had established with the house of Israel; and purely purge away thy dross, melting it out with lye, removing the obstinate and wicked leaders; and take away all thy tin, the lead mixed with the precious metal, the ungodly in high and low places;

— and the northern house of Israel was carried away in stages during the time of Hezekiah when Isaiah was prophesying;

— and the house of Israel was forgotten, all the noise of the tin is gone, forgotten, until the endtime when God will restore them.

26 I will restore thy judges as at the first, and thy counselors as at the beginning. Afterward thou shalt be called the City of Righteousness, the Faithful City.”

— this is flashing forward into the Millennium when the seventy judges of the Sanhedrin and other counsellors will be fully restored in Jerusalem;

— and building of the Ezekiel Jerusalem; and after the Millennium, the New Jerusalem.

27 Zion shall be redeemed with judgement, and her converts with righteousness.

— Zion shall be redeemed through justice; since there will be people who practice the right kind of justice; and they shall be redeemed from their iniquities.

28 And the destruction of the transgressors and of the sinners shall be together, and they that forsake the Lord shall be consumed.

— and the destruction of the transgressors and of the sinners shall be together; of the beast and false prophet, of the followers of antichrist, the man of sin, all are transgressors of the law of God; these sinners will all be consumed together.

29 For ye shall be ashamed of the oaks which ye have desired, and ye shall be confounded for the gardens that ye have chosen.

— for they shall be ashamed of the oaks which ye have desired; they will be brought to shame on account of the groves where they practiced idolatry and ye shall be confounded for the gardens that ye have chosen where idolatry and other vices held full sway.

30 For ye shall be as an oak whose leaf fadeth, and as a garden that hath no water.

— for ye shall be as an oak whose leaf fadeth, dying for want of nourishment; and as a garden that hath no water, whose flowers and fruits are bound to die.

31 And the strong shall be as tow, and the maker of it as a spark; and they shall both burn together, and none shall quench them.

— and the strong shall be as tow, that is, the well-to-do will be as a lamp-wick; and the maker of it as a spark, rather, his work as a spark, for the idol causes a consuming fire, which devours the idolaters themselves; and they shall both burn together, and none shall quench them;

— when the final Judgement comes and the fate of men has been decided, then the verdict of condemnation will strike the ungodly, and their worm will not die, neither will their fire be quenched, and they will be an abomination to all flesh.

~~~~

“Your new moons and your appointed feasts My soul hateth” (verse 14) or Your new months and your appointed feasts My soul hateth.

Your New Moons / New Months

— Months of the Year Names: January (derived from the Latin Januarius) is to honor their Roman gods Janus; and March, named for Mars, is the Roman mighty god of war; February is derived from the Februa festival or its eponymous februa (“purifications, expiatory offerings”); March is named after Mars, the Roman god of war. April relates to what the Romans called the month Aprilis; from a word meaning “to open” and further back from Aphrodite, the Greek name for the goddess of love. May – named for Maia, is the Roman goddess of spring and growth;

— June is a name attributed to Juno, the female mighty wife of Jupiter in Roman mythology. She is also called the “Queen of Heaven” and “Queen of Mighty Ones.” July is to honor Julius Caesar; the Roman Senate named it “Julius” in honor of Roman emperor Julius Caesar. August honor Julius Caesar’s successor, the emperor Augustus; and the months September, October, November, and December are archaic adjectives derived from the ordinal numbers 7 to 10;

Your Feast Days

Hosea 1:11 I will also cause all her mirth to cease, her feast days, her new moons, and her Sabbaths, and all her solemn feasts. — her feast days; to avoid themselves being “judaizing” these “Christians” adopt new understandings and practices:

(a) Christmas, which honor the Mithraism – a form of nature worship based on the Sun-Goddess Mithra who on the darkest night of the year (December 20/21), gives birth to “Light” causing each day thereafter to grow longer until the Summer solstice; and

(b) Easters, a celebration of Ishtar, the Assyrian and Babylonian goddess of fertility and sex. Her symbols (like the egg and bunny) were and still are fertility and sex symbols; and to those who actually think eggs and bunnies have something to do with the resurrection; and

Today, to avoid “judaizing” in their faith, more than 98.5 percent of Christians are honouring the Sun by observing Sunday worship. They have “their backs toward the temple of the Lord and their faces toward the east; and they worshipped the SUN toward the east; whose Godly judgement is to be stoned to death – ’till they die.

Also, following the SUN-worshipping Samaritans, most Church of God Communities are showing their contempt for God by having their “wavesheaf offering” and Pentecost on a Sunday; always on a Sunday. And these are supposedly in God’s Sanctuary, but God says He is a jealous God, so these pretentious Christians could be spewed out of His mouth! A death penalty Deuteronomy 17:3-5 – ’till they die!

Isaiah 2

1 The word that Isaiah the son of Amoz saw concerning Judah and Jerusalem: — the Targum paraphrases the words as, “the word of prophecy, which Isaiah, the son of Amoz, prophesied.”

2 And it shall come to pass in the last days that the mountain of the Lord’S house shall be established on the top of the mountains, and shall be exalted above the hills, and all nations shall flow unto it.

— in the last days; the days when the Messiah commences his work at the top of the mountains; on a mountain that is the head of all the mountains in the importance of mountains; and all nations shall stream into it; will gather and stream to it like rivers.

3 And many people shall go and say, “Come ye, and let us go up to the mountain of the Lord, to the house of the God of Jacob; and He will teach us of His ways, and we will walk in His paths.” For out of Zion shall go forth the law, and the word of the Lord from Jerusalem.

— and many people shall go and say, this is a prophecy of the numerous conversions among the nations in the latter day as also said in Zechariah 8:20;

— and he will teach us of his ways: that is, the Lord the God of Jacob; he is the teacher and there is none teacheth like him; and happy are they who are taught by God;

— for out of Zion shall go forth the law and the word of the Lord from Jerusalem; by which is meant the law, not to be mistaken as faith, of the Messiah, Isaiah 42:4 for the law; called the “word of the Lord;”

— this began to be preached first in Jerusalem and from there it went forth into the world; and in Zion, in the Kingdom of God, it is now preached and will be more fully in the latter day; and so is an encouraging reason to engage persons to go up and hear it.

4 And He shall judge among the nations, and shall rebuke many people; and they shall beat their swords into plowshares, and their spears into pruning hooks; nation shall not lift up sword against nation, neither shall they learn war anymore.

— and he shall judge among the nations and shall rebuke many people; stating his decisions, performing the functions as King and Judge in governing the people under his spiritual rule;

— for example, today we are honouring the host of heaven with a pagan-named week and a paganised monthly calendar; and more than 98.5 percent of Christians are honouring the Sun by observing Sunday worship. They have “their backs toward the temple of the Lord and their faces toward the east; and they worshipped the SUN toward the east; whose Godly penalty is to be “cut off” to death (Deuteronomy 17:3-5) – ’till they die’;

— and they, under the influence of the Lord’s Spirits, shall beat their swords into plowshares, the broad knives fastened to the shaft of the plow by Oriental farmers, and their spears into pruning-hooks, that is, with which they prune their vineyards;

— nation shall not lift up sword against nation, neither shall they learn war any more, for under the government of the Prince of Peace, there is nothing but peace, unity and love. It is a wonderful description of the Messianic kingdom and its beauties which is here given.

5 O house of Jacob, come ye and let us walk in the light of the Lord. — O house of Jacob, the children of Israel, though specifically the inhabitants of Judah and Jerusalem being addressed above, it also includes the other 10 tribes of Israel.

6 For Thou hast forsaken Thy people, the house of Jacob, because they are replenished from the East, and are soothsayers like the Philistines; and they please themselves with the children of strangers.

— the house of Jacob are filled with divination from the east; the general meaning seems to be, that their land was full of idolatrous manners from eastern nations: the Ammonites, Chaldeans and Persians, and perhaps also they had encouraged these heathen to settle among them, that they might learn their customs.

7 Their land also is full of silver and gold, neither is there any end of their treasures; their land is also full of horses, neither is there any end of their chariots. — this heaping up of material wealth is contrary to divine inspiration.

8 Their land also is full of idols; they worship the work of their own hands, that which their own fingers have made.

— their land is also full of idols; of the goddess Semirami, later transformed into the Virgin Mary, and of saints departed, whose images are set up to be worshipped in all their churches and in private houses;

— which their own fingers have made:, idols of gold, silver and brass; wood and stone.

9 And the lowly man boweth down, and the great man humbleth himself; therefore forgive them not. — and the great man, the nobles and leaders among the people, humbleth himself, is humbled by God;

— therefore forgive them not; their sins of soothsaying, covetousness and idolatry; and such that worship the beast and his image shall not be forgiven, but drink of the wine of divine wrath and be tormented with fire for ever and ever.

10 Enter into the rock, and hide thee in the dust, for fear of the Lord and for the glory of His majesty. — enter into the rock, as people hide before a cruel enemy, and hide themselves in rocks and caves of the earth in the wilderness;

— so for fear of the Lord, lest he should pour out his wrath and judgement upon them and be a consuming fire to them; for this is to be understood not of a filial reverence of God, but of a servile fear of punishment; and these words are sarcastically said, suggesting that rocks and mountains will be no protection or security for them.

11 The lofty looks of man shall be humbled, and the haughtiness of men shall be bowed down; and the Lord alone shall be exalted in that day.

— the lofty looks of man shall be humbled, every gesture indicating pride will be beaten down and the haughtiness of men shall be humbled like dust and the Lord alone shall be exalted in that day, standing secure in the perfection of His essence.

12 For the day of the Lord of hosts shall be upon every one that is proud and lofty, and upon every one that is lifted up—and he shall be brought low”

— here “the day of the Lord” is the same as “the Lord’s day” in Revelation 1:10 “I was in the Spirit on the Lord’s Day,” – it is a period (or timeframe of a single day or of many years, depending on context as each case is different) a day of God’s Judgement!

— every one that is proud and lofty and upon every one that is lifted up, the day being, as it were, kept in reserve by the Lord, shall be brought low in the Day of Judgement.

13 and upon all the cedars of Lebanon that are high and lifted up, and upon all the oaks of Bashan; — and upon all the cedars of Lebanon that are high and lifted up, pictures and emblems of the proud sinners.

14 and upon all the high mountains, and upon all the hills that are lifted up; — high mountains and hills, to signify big countries and small ones; or to signify states and cities.

15 and upon every high tower, and upon every fortified wall; — high towers and fenced walls, those who excelled in ingenuity, wisdom and strength.

16 and upon all the ships of Tarshish, and upon all pleasant sights. — those who excelled in shipping and merchandising, bringing beautiful works of art from far-away land, creating self-esteem and wealth.

17 And the loftiness of man shall be bowed down, and the haughtiness of men shall be made low; and the Lord alone shall be exalted in that day,

— and the loftiness of man shall be bowed down, since all the objects of man’s pride will be destroyed, and the haughtiness of men shall be made low; and the Lord alone shall be exalted in that day, the highest and most glorious in the majesty of His essence;

— also, those atheists or followers of antichrist, who have boasted of their wisdom and knowledge, of their number, power, greatness and authority, of their wealth and riches, and of their merits and works of supererogation; their pride will now be stained, and all their glory laid in the dust.

18 and the idols He shall utterly abolish. — literally, “they will be changed,” they will vanish away, their vanity will be apparent before all men.

19 And they shall go into the holes of the rocks, and into the caves of the earth, for fear of the Lord and for the glory of His majesty, when He ariseth to shake terribly the earth.

— and they, the idolaters, shall go into the holes of the rocks and into the caves of the earth, in cellars or cisterns dug into the ground, for fear of the Lord and for the glory of His majesty, when he ariseth to shake terribly the earth;

— or shake the earth terribly; up and down, down and up; and sideways; imagine how many will die with those rushing Fukushima waves!!!

20 In that day a man shall cast away his idols of silver and his idols of gold (which he made each one for himself to worship) to the moles and to the bats,

— in that day, under the influence of a repentant spirit they could have come too late, a man shall cast his idols of silver and his idols of gold, which they made for himself to worship, to the moles (a species of rodents that dig into the earth) and to the bats, into the first convenient crevice, in an effort to rid himself of their incriminating presence.

21 to go into the clefts of the rocks, and into the tops of the ragged rocks, for fear of the Lord and for the glory of His majesty, when He ariseth to shake terribly the earth.

— to go into the clefts of the rocks, and into the tops of the ragged rocks, his terror driving him to seek safety anywhere and everywhere, for fear of the Lord, namely, dread of the inevitable punishment, and for the glory of his majesty, when he ariseth to shake terribly the earth, to spread terror throughout the world, for his wrath will find his enemies in the most remote corners and hiding-places of the earth.

— or shake the earth terribly, again; up and down, down and up; and sideways; imagine how many will die with those rushing Fukushima waves! Nar, it would be hundred times more terrifying than those Fukushima waves!!!

22 Cease ye from man, whose breath is in his nostrils; for of what account is he? — cease ye from man, whose breath is in his nostrils,

— all men are admonished not to place their trust in man, weak and powerless as he is in all that he undertakes, dependent upon a breath which quickly disappears;

— for wherein is he to be accounted of? All human props may and will be taken away in the twinkling of an eye. It is time to trust in the Lord and not to put confidence in man, especially in view of the soon coming Day of Judgement, or the Lord’s Day, or the Day of the Lord, which will show the vanity of man’s pride and of all his accomplishments.

Covid Is Genocide – Dr David Martin

•July 7, 2023 • Leave a Comment

Covid Is Genocide – A Biological Warfare Crime – Dr David Martin Speaks To The European Parliament

Dr David Martin Speaks To The European Parliament

A video shared on social media has claimed that the mRNA coronavirus vaccine is not actually a vaccine, but a “device” designed to make people sick. Is this true or false. You decide!

China Counterpunchs with Gallium and Germanium

•July 6, 2023 • Leave a Comment

China curbs a ‘potential bargaining chip’ to counter US-led semiconductor ban, say experts.

Totally Replacing Rare Metal Imports From China Could Take ‘Generations’

South China Morning Post • July 4, 2023 // Sputnik International • July 5, 2023

Beijing’s decision to impose export controls on critical raw materials, gallium and germanium, used in manufacturing semiconductors, communication equipment and solar panels could complicate the US-led efforts to shift critical supply chains away from China, experts said on Monday, as it seeks to gain leverage in negotiations with Washington over access to core technology.

Pauken criticized the Biden administration’s China policy as “childish.”

“If China chooses to weaponise these supply chains, it will greatly complicate the calculus in the US, EU and Asia in terms of reducing dependence on China,” an effort that is just beginning, said Paul Triolo, a senior associate at the Center for Strategic and International Studies, a think tank in Washington.

He added that it would take “considerable time and investment to recreate even a portion of critical mineral supply chains,” stressing that Beijing “almost certainly sees these controls as a potential bargaining chip, which it could use to attempt to convince the US and Western governments to roll back elements of recent export controls on semiconductors and semiconductor manufacturing equipment.”

Starting on August 1, exports of gallium, germanium and several other industrial compounds will be subject to restrictions in order to “safeguard national security and interests,” China’s Ministry of Commerce and Administration of Customs announced on Monday. Exporters will be required to have approval from the State Council, China’s cabinet, for the listed items.

China produces more than 94 % of the world’s raw gallium

China is by far the world’s biggest gallium producer and a leading global producer and exporter of germanium— accounting for 94% of gallium supply and 83% of germanium, according to a European Union study on critical raw materials this year.

The measure is the latest development in the global battle to control chipmaking technology, which is vital for everything from smartphones and self-driving cars to advanced computing and weapons manufacturing.

Beijing’s move comes just days after the Dutch government announced new restrictions on exports of some semiconductor equipment, drawing an angry response from Beijing, according to Reuters. The new rules mean that ASML (ASML), Europe’s largest tech firm, will need to apply for export licenses for products used to make microchips.

Japan and the United States have also taken steps to limit Chinese companies’ access to chips and chipmaking equipment. Italy last month imposed several curbs on Pirelli’s biggest shareholder, Sinochem, to block the Chinese government’s access to sensitive chip technology.

The US Commerce and Treasury departments did not respond to requests for comment.
Calling the measure retaliation for the United States’ October 2022 ban on the export of some cutting-edge semiconductor technology to China, experts said that although Beijing’s curbs “will likely have an impact on a large number of countries,” Washington was “the main target.”

Replacing Rare Metal Imports Could Take ‘Generations’

The US media noted at the time that Washington’s move would thwart “China’s technological ambitions,” bragging that the global semiconductor industry was “almost entirely” dependent on the US and its allies.

Now the American newspapers are admitting China has played “a trump card in the chip war.”

“I find it rather laughable that [the Biden administration] actually thought that they’re going to win this tech war,” Thomas W. Pauken II, the author of US vs China: From Trade War to Reciprocal Deal, and a consultant on Asia-Pacific affairs, told Sputnik.

“You don’t have access to the rare earth, you don’t have access to the supply chains in order to produce these electronics – you’re totally destroyed, you’re devastated, the US knew about this. They knew how much they were reliant on the rare earths. They knew how much they had to rely on China in order to reshore their factories. And instead of trying to find ways to cooperate, they just decided to go ahead and just do these no nasty, terrible attacks against China and then just somehow think they’re going to score a victory here.”

Why Didn’t Team Biden See This Coming?

The People’s Republic boasts 63% of the world’s rare earth mining, 85% of processing, and 92% of magnet production. As per the 2022 US Geological Survey, between 2017 and 2020 the United States imported a whopping 78% of its rare earth metals from China, followed by Estonia (6%), Malaysia (5%) and Japan (4%).

Back in 2019, the Asian giant warned the Trump administration about including rare earths in Beijing’s technology-export restrictions, as Washington stepped up pressure on Chinese telecom firm Huawei.

Donald Trump’s successor, Joe Biden, continued to raise the stakes in a technological tit-for-tat with China by implementing the CHIPS and Science Act in August 2022 and introducing semiconductor restrictions last October. In December 2022, US policy-makers were lively discussing possible bans on TikTok, a Chinese short-form video hosting service.

Speaking to Sputnik at the time, Pauken projected that Biden’s China strategy would eventually backfire on Washington.

“If the US moves forward on decoupling, they’re only hurting themselves, because most of the supply chains on the high-tech side originate from China,” the Asia-Pacific consultant warned last December.

Given that 94% of the world’s gallium and 83% of germanium is produced in China, the US may find itself in a heap of trouble in the aftermath of Beijing’s export ban, according to the expert.

On Wednesday, former vice-minister of commerce Wei Jianguo spoke to state media China Daily and said Beijing has plenty of tools for countermeasures if the Biden administration continues to ramp up technology restrictions. He said the decision to restrict the export of gallium and germanium would “cause panic in certain countries, but also exert heavy pain in them.”

Wei said: “This is just the beginning of China’s countermeasures, and China’s toolbox has many more types of measures available. If the high-tech restrictions on China become tougher in the future, China’s countermeasures will also escalate.”

Totally Replacing Rare Metal Imports From China Could Take ‘Generations’

Nahum (Ch 1-3)

•July 6, 2023 • Leave a Comment

The prophecy of Nahum chiefly relates to the Assyrian empire and its chief city, Nineveh, of their destruction. God used Assyria as a rod of his anger to punish Israel but finally this rod itself had to be punished for its own haughtiness and malice.

Some references over Assyria are yet to be fulfilled. The king of Assyria will come towards Israel and Egypt again in a day to come will find his end in Palestine. Psalms 83.

The period in which Nahum prophesied may approximately before the destruction of Nineveh in the year 606 BC but after the dissolution of the northern kingdom through the Assyrian hosts and after some serious visitation which struck the southern kingdom.

Nahum 1

1 The burden of Nineveh. The book of the vision of Nahum the Elkoshite. — the burden of Nineveh; a burden is a heavy message of weighty importance, heavy in the sense that it produces sorrow or grief.

—Jonah was earlier sent to this city to warn it with ruin for its sins; at that time the king and all his people humbled themselves and repented and the threatened destruction was averted; but they soon relapsed to their former iniquities, and that Nahum prophesied after Jonah a considerable time, perhaps a hundred to a hundred and fifty years later;

— this prophecy is called a burden; it was taken up by Nahum the prophet at the command of the Lord, and was sent by him to Nineveh; and that ‘burden’ was a hard, heavy and grievous prophecy to that city, predicting its utter ruin and desolation.

2 God is jealous, and the Lord avengeth; the Lord avengeth and is furious. The Lord will take vengeance on His adversaries, and He reserveth wrath for His enemies.

— God is jealous of his own honour and glory and for his own worship and ordinances; and will not give his glory to another, nor to graven images;

— the Lord is furious and avenges; or is “master of wrath” full of it or has it at his command; he can restrain it and let it out as he pleases, which man cannot do. The Lord’s avenging is repeated for its certainty and confirmation; yea, it is a third time observed; which some Jewish writers think has respect to the three times the king of Assyria carried the people of Israel captive and for which the Lord would avenge on Israel’s behalf, by punishing him, too:

— the Targum explains it, “that hate his people;” vengeance belongs to the Lord, and he will repay it sooner or later;

— and he reserves wrath for his enemies; and them for that; if not in this world, yet in the world to come; he lays it up among his treasures and brings it forth at his pleasure. The word “wrath” is not in the text; it is not said what he reserves for the enemies of himself and church; it is inconceivable and inexpressible.

3 The Lord is slow to anger and great in power, and will not at all acquit the wicked. The Lord hath His way in the whirlwind and in the storm, and the clouds are the dust of His feet.

— the Lord is slow to anger, long-suffering and patient against wickedness of long standing; his almighty strength becoming evident when he does strike and will not at all acquit the wicked;

— the Lord hath his way in the whirlwind and in the storm, which are but instruments and exhibitions of his power, and the clouds are the dust of his feet, they are insignificant before him and he uses them as he pleases;

— a parallel Scripture in Isaiah says: “Behold the day of the Lord cometh cruel, both with wrath and fierce anger to lay the land desolate. And he shall destroy the sinners thereof out of it … Therefore I will shake the heavens, and the earth shall move out of her place in the wrath of the Lord of hosts and in the day of his fierce anger” (Isaiah 13:9,13).

4 He rebuketh the sea and maketh it dry, and drieth up all the rivers; Bashan languisheth and Carmel, and the flower of Lebanon languisheth.

— when he rebukes the seas they becomes dry as when he caused the Red Sea to part before the children of Israel, Exodus 14:15, and dries up all the rivers, since they all are subject to his directions; Bashan, the rich pasture-land east of Jordan, languishes; and Carmel, the wooded slopes of the mountain overlooking the Mediterranean and the flower of Lebanon, otherwise a symbol of rich fertility, languishes, namely, when he withholds the moisture or bids the river go dry;

— and drieth up all the rivers; that is, he can do it if he will; he divided the waters of Jordan, through the midst of which the Israelites passed on dry ground; and will dry up the river Euphrates to make way for the kings of the east; and as for Tigris, on the banks of which the city of Nineveh stood;

— “Bashan … Carmel … Lebanon …” these names are associated with the richest and most-favoured dwelling places of antiquity; and they were mentioned here to show that no place on earth is beyond the judgement of God when the sins of its inhabitants require judgement and punishment. The Tigris valley, where Nineveh lay, was another of the garden spots of the earth; but today it’s a desolation!

5 The mountains quake at Him, and the hills melt, and the earth is burned at His presence, yea, the world and all that dwell therein.

— the mountains quake before him, or in front of him; as at Mount Sinai, when the Lord descended on it, Exodus 19:18. Mountains figuratively signify large countries; hills are smaller countries;

— and the hills melt before him as at the time of terrible earthquakes, and the earth is burned at his presence, yea, the world and all that dwell therein, both men and any irrational brutes.

6 Who can stand before His indignation? And who can abide in the fierceness of His anger? His fury is poured out like fire, and the rocks are thrown down by Him.

— who can stand before his indignation? before his wrath when it burns freely. And who can abide in the fierceness of his anger? Cf Jeremiah 10:10.

— his fury is poured out like fire in a torrent consuming everything before it, Deuteronomy 4:24, and the rocks are thrown down by him. Cf Jeremiah 23:29. But this wrath of God may or may not strike those who keep his commandments and put their trust in him.

7 The Lord is good, a stronghold in the day of trouble; and He knoweth them that trust in Him. — the Lord is good, even in the midst of his judgements, a strong refuge in the day of trouble,

— a safe place when distress and misery come upon believers; and he knows them that trust in him; he has that intimate knowledge of them, that peculiar insight into their needs which guarantees them his help.

8 But with an overrunning flood He will make an utter end of the place thereof, and darkness shall pursue His enemies.

— but with an overrunning flood, a deluge which carries everything before it; he will make an utter end of Nineveh, so that Nineveh would cease to be a city and its very site be used for altogether different purposes, and darkness shall pursue his enemies into complete desolation.

9 What do ye contrive against the Lord? He will make an utter end; affliction shall not rise up the second time.

— what do ye imagine against the Lord? O ye Ninevites or Assyrians; do you think you can frustrate the designs of the Lord, resist his power, and hinder him from executing what he has threatened to do?

— he will make an utter end; affliction shall not rise up the second time, for the one blow on the part of the Lord would be sufficient so that the affliction which Judah suffered on the part of Assyria would not arise twice.

— Q: if so, our understand of Psalm 83 would need to be studied further otherwise it is faulty, because Assyria did rise again in Psalm 83!

10 For while they are folded together as thorns and while they are drunken as drunkards, they shall be devoured as stubble fully dry. — for though the Assyrians are folded together as thorns, braided together or entangled;

— and while they are drunken as drunkards, though they are drowned in their carousing in their wine, so that it might seem that fire would not be able to reach them or to affect them seriously, they shall be devoured as being fully dried up.

11 There is one that comes out of thee, that imagineth evil against the Lord, a wicked counselor. — there is one come out of thee, namely, Sennacherib or one of the other rulers who invaded Judah,

— that imagined evil against the Lord, meditating and speaking in this sense, a wicked counselor, one who advised worthlessness, things that were foolish and brought no results. Cf Isaiah 36:14-20.

— or as the Targum says: formed a scheme to invade the land of Judea; take the fenced cities and seize upon Jerusalem and carry the king, princes and all the people captive as Shalmaneser his father had carried away the ten tribes.

12 Thus saith the Lord: “Though they be quiet and likewise many, yet thus shall they be cut down when he shall pass through. Though I have afflicted thee, I will afflict thee no more;

— thus saith the Lord, Though they be quiet and likewise many, no matter how tranquilly secure and how numerous they are, yet thus shall they be cut down;

— suddenly disappearing as though mowed down, when he shall pass through, rather, and he passes away, namely, the daring invader who had meditated evil against Yehovah. Though God have afflicted them, bending Judah down to the ground, he will afflict them no more, this being a source of consolation to the Lord’s people.

13 for now will I break his yoke from off thee, and will burst thy bonds asunder.”

14 And the Lord hath given a commandment concerning thee, that no more of thy name be sown: “Out of the house of thy gods will I cut off the graven image and the molten image. I will make thy grave, for thou art vile.”

— and the Lord hath given a commandment that no more of their name be remembered, that the dynasty of the Assyrian kings should become extinct;

— out of the house of thy gods will God cut off their graven image and the molten image, their goddess Ishtar, and others in whom the Assyrians placed their trust; God would make their graves for thou art vile, morally unworthy, no longer fit to live and to be in power. Thus the destruction of the power of Assyria was clearly set forth, in outlines that could not be misunderstood;

— thus the Targum says, “there will I put [thee into] thy grave.”

15 Behold upon the mountains the feet of Him that bringeth good tidings, that publisheth peace! O Judah, keep thy solemn feasts, perform thy vows; for the wicked shall no more pass through thee; he is utterly cut off.

— behold upon the mountains the feet of him that brought good tidings of the messenger of joy hastening forward to bring the good news, that publishes peace, announcing to Judah the overthrow of the enemies;

— O Judah, keep thy solemn feasts, resuming their celebration of the Passover, Pentecost and Tabernacles especially at this time, when the deliverance of the Lord’s people from violence and oppression constituted a further incentive for joy and thanksgiving, perform thy vows, those made in anticipation of this deliverance; for the wicked Assyrians shall no more pass through thee, they were utterly cut off.

Nahum 2

1 He that dasheth in pieces has come up before thy face. Man the defenses! Watch the way! Make thy loins strong! Fortify thy power mightily!

— “He that dasheth in pieces …” is the Lord of hosts; the instrument by which his will would be executed upon Nineveh was Babylon. The fourfold warning of “keep… watch … make strong … fortify” is irony. Who can stand against the Almighty? What human strength could avail against the Lord?

2 For the Lord hath turned away the excellency of Jacob, as the excellency of Israel; for the emptiers have emptied them out and marred their vine branches.

— for the Lord hath turned away the excellency of Jacob; “Jacob” is used here, not Judah; and Jacob necessarily included all of Israel, northern and southern; Yehovah being on the side of the invading army, making them captives before he restored them back their glory as when the covenant nation was at the height of its glory;

— for the invaders have emptied them out, or “plunderers have plundered them” and marred their vine-branches;

— the Targum interprets it of their renowned cities; these and towns and villages, being to the land as branches to the vine; and which had been ransacked and pillaged by the Assyrians outrageously destroying the land and outraging its inhabitants, so that the Lord felt obliged to avenge this indignity.

3 The shield of his mighty men is made red, the valiant men are in scarlet; the chariots shall be with flaming torches in the day of his preparation, and the fir trees shall be terribly shaken.

— the shield of his mighty men, of the heroes commissioned by the Lord to execute his judgement, is made red; red, either with the blood of the slain or thus coloured on purpose to inject terror to their enemies; or this may express the lustre of them, which being gilded or made of gold or brass in the rays of the sun glittered, and looked of a fiery red; all shining for the battle;

— the valiant men are in scarlet; their shield are red as are their cloaks; clothed in scarlet; partly to show their greatness and nobleness and partly to strike their enemies with terror and to hide their blood should they be wounded and so keep up their own spirits and not encourage their enemies:

— the chariots shall be with flaming torches in the day of his preparation, blazing with their iron equipments and the fir-trees shall be terribly shaken, the spears made of cypresses are brandished.

4 The chariots shall rage in the streets, they shall jostle one against another in the broad ways; they shall seem like torches, they shall run like the lightning.

— the chariots shall rage in the streets of Nineveh as they are driven furiously in the attack, they shall jostle one against another like madmen in their broadways, running to and fro in the market-places of Nineveh, all confused by the attack of the enemy;

— they shall seem like torches as the light struck the steel ornaments of the chariots; because of their numbers and the haste they shall make, they shall run like the lightnings, namely, as lightning plays in blinding flashes.

5 He shall muster his worthies; they shall stumble in their walk; they shall make haste to the wall thereof, and the defense shall be prepared.

— the Assyrian king shall recount his worthies; remembering and counting on his nobles and the troops; but they shall stumble in their charge; being many and in haste to obey the orders of their commander, all became confused and uncertain in their effort to reach the point where the attack is launched against the city;

— they shall make haste to the wall thereof but the defense shall be readied. The entire paragraph pictures the haste and confusion which takes hold upon the citizens and the soldiers of a city which has been too secure and now finds itself surrounded by a host of enemies.

6 The gates of the rivers shall be opened, and the palace shall be dissolved. — the gates of the city which lay nearest to the river Tigris shall be opened,

— the reference being to some natural or artificial inundation of the city which helped in its destruction, and the palace shall be flooded, its inhabitants being overcome with terror and losing all semblance of careful thinking and planning.

7 And Huzzab shall be led away captive, she shall be brought up; and her maids shall lead her as with the voice of doves, beating upon their breasts.

— and the queen of Assyria, Huzzab, perhaps a reference to the patron goddess of Assyria, Ishtar; shall be led away captive as the Targum says, literally, “It is determined,” by God; “she is made bare,” namely, Nineveh, “like a ravished woman, and carried away.”

— or the king himself may be intended as Huzzab, who may be represented as a woman for his effeminacy; she shall be brought up, and her maids shall lead her, the inhabitants of the city being so regarded, as with the voice of doves, with mournful cries;

— she shall be brought up; the queen or the king, out of the palace or private retirement, where they were in peace and safety; or Nineveh and its inhabitants out of their secure state and condition:

— as with the voice of doves, tabering upon their breasts; mourning like doves, inwardly and secretly, not daring to express their sorrow more publicly because of their enemies; but knocking and beating upon their breasts, as men do upon tabrets or drums, thereby expressing the inward grief of their minds;

8 But Nineveh is of old like a pool of water; yet they shall flee away. “Stand, stand!” shall they cry, but none shall look back.

— but Nineveh is liked an old pool of water; this was a very ancient city, built by Nimrod, as some say; or rather by Ashur, as appears from Genesis 10:10

— and it was like fish pool, full of people as it was in the times of Jonah, an expression of her great population and prosperity; yet they shall flee away, her great population leaving her to her fate. Stand, stand! shall they cry, in an attempt to stop the heedless rush; but none shall look back, refusing to return to the ravished city.

9 Take ye the spoil of silver, take the spoil of gold; for there is no end of the store and glory of all the pleasant furnishings.

— the looting by Assyria is taking place: take ye the spoil of silver, take the spoil of gold! For there is none end of the store and glory out of all the pleasant furniture, of the various rich treasures with which the palaces of the city of Nineveh were filled;

— no people who ever lived on earth knew any more about looting than the Assyrians; and now it was their turn to be the looted! What a fat city Assyria was! It was the grand central warehouse of looted treasures of the whole ancient world; that there was nothing else like it on earth; and yet all that wealth was carried away, leaving nothing but a mound of ruins forever!

10 She is empty and void and waste; and the heart melteth, and the knees smite together; and much pain is in all loins, and the faces of them all gather blackness.

— the city of Nineveh, now empty, void and in waste, literally, “emptiness and being emptied out and desolation!” and the heart melted in utter discouragement;

— and the knees smite together in the terror which cannot control itself and much pain is in all loins, Isaiah 21:3, and the faces of them all gather blackness, all of them pale with fear. Thus the mighty city would be destroyed with all its rich treasures;

— and the faces of them all gather blackness; like a pot, as the Targum adds; being in great distress and disconsolation, which make men appear in a dismal hue, and their countenances look very dark and gloomy; see Joel 2:6;

— the story of the Assyrians or the city of Nineveh is not just a manifestation of a people or a city but a manifestation of any nation or tribe before God’s Omniscience and Omnipotence.

11 Where is the dwelling of the lions and the feeding place of the young lions, where the lion, even the old lion, walked, and the lion’s whelp, and none made them afraid?

— of the kings of Assyria, comparable to lions for their strength, courage, and cruelty, tyranny and oppression; such as Pul, Tiglathpileser, Shalmaneser, and Sennacherib. So the Targum says “where are the habitations of kings?”

— “Where is the den … etc,” the city of Nineveh, long a center of terror for the whole world, where was it when the blow fell? Where were the powers dreaded all over the earth? Where was the mighty king? Where was the rapacious army, red with the blood of all peoples? Where was it? Where is it now? Where has it ever been since “the day of the wrath of the Lord?”

— Q: if the Assyrians or Nineveh will never rise again our understand of Psalm 83 would be questionable, or is it?

12 The lion tore in pieces enough for his whelps and strangled for his lionesses, and filled his holes with prey and his dens with rapine.

— the lion did tear in pieces enough for his whelps as much as his young ones desired and strangled for his lionesses and filled his holes, the dens occupied by him, with prey and his dens with ravin, his lurking-places with spoil. Even so the kings of Assyria heaped up treasures taken from every part of the world for the use of the inhabitants of Nineveh.

13 “Behold, I am against thee,” saith the Lord of hosts, “and I will burn her chariots in the smoke, and the sword shall devour thy young lions; and I will cut off thy prey from the earth, and the voice of thy messengers shall no more be heard.”

— behold, I, the Lord is against thee, against Nineveh and the whole Assyrian empire for such rapine, violence and oppression, saith the Lord of hosts, the ruler of the heavenly armies, and God will burn her chariots in the smoke, so that all her war material goes up in smoke, and the sword shall devour thy young lions, the mighty men of the city;

— and God will cut off thy prey from the earth, and the voice of thy messengers shall no more be heard as they boasted of the might and prowess of Assyria and Nineveh. God has ways of subduing even the mightiest enemies, no matter how mightily they rise up in their own conceit;

— Q: if so, could Psalm 83 be historic? And if so, is this the correct understanding?

Nahum 3

1 Woe to the bloody city! It is all full of lies and robbery; the prey departeth not. — woe to the bloody city, Nineveh, in which many murders were daily committed;

— or “O city of blood, of blood-guiltiness!” It is a city full of lies and robbery, so that deceit, violence and extortion were the order of the day; the prey departs not, robbery goes on without ceasing; like the cities of Paris, London, Los Angeles, New York or Chicago today!

— or the real CIA as  Mike Pompeo, Donald Trump’s Secretary of State, admitted:

“I was the CIA director. We lied, we cheated, we stole,” former CIA director and now Secretary of State Mike Pompeo said on April 15, 2019 at a forum at Texas A&M University, TX. “It was like – we had entire training courses. It reminds you of the glory of the American experiment.”

— the prey departeth not; Gill: they go on in making a prey of their neighbours, in pillaging and plundering their substance; they repent not of such evil practices, nor desist from them; or because of the above sins they shall fall a prey to the enemy, who will not cease plundering them till he has utterly stripped them of all they have; and who is represented in the next verse Nahum 3:2 as just at hand.

2 The noise of a whip and the noise of the rattling of the wheels, and of the prancing horses and of the jumping chariots! — the noise of a whip, its sharp crack heard as the horses are urged forward in battle,

— or of a horseman or chariot driver whipping his horses to make speed to Nineveh, and the noise of the rattling of the wheels and of the prancing horses and of the jumping chariots, bounding along over the ground as the horses broke into a gallop.

3 The horseman lifteth up both the bright sword and the glittering spear, and there is a multitude of slain and a great number of carcasses. And there is no end of their corpses—they stumble upon their corpses”

— the Ninevites in fleeing and endeavouring to make their escape from the Chaldeans pursuing them; the horseman mounting, rather, “horsemen rearing,” as they directed their mounts to charge, both the bright sword and the glittering spear, or “the name of the sword and the lightning of the lance”

— and there is a multitude of slain or of wounded and a great number of carcasses, a wall of corpses heaped up; they, the invading enemies, stumble upon their corpses, unable to pick their way forward because the entire battlefield is strewn with the dead;

4 because of the multitude of the whoredoms of the well-favoured harlot, the mistress of witchcraft, that selleth nations through her whoredom, and families through her witchcraft.

— because of the multitude of whoredoms, meaning Nineveh; which as it was an ancient city, was a well built one; full of stately and beautiful buildings, the seat of the kings of Assyria, and the metropolis of the nation, and abounded with wealth and riches; the acts of idolatry and wickedness;

— of the well-favoured harlot, the mistress of witchcrafts, idolatry and witchcraft being the special marks of the heathen character, that seduced nations through her whoredoms, with her hypocritical friendship and feigned interest, and families, smaller tribes, through her witchcrafts,

— namely, by her political schemes and intrigues, enslaved whole kingdoms and brought them under her power and dominion, to be her vassals; but the Lord will plunge Nineveh into a shameful destruction.

5 “Behold, I am against thee,” saith the Lord of hosts, “and I will uncover thy skirts upon thy face; and I will show the nations thy nakedness and the kingdoms thy shame.

— behold, I am against Nineveh, saith the Lord of hosts, and I will uncover thy skirts and throw them up so high that they would reach over her face, and I will show the nations thy nakedness as that of a lewd woman, and the kingdoms thy shame, in bringing the utmost disgrace upon Nineveh and the kingdom of Assyria;

— Q; is God intending this “uncover thy skirts” for the house of Israel at a latter day, too? False landing on the moon? The Covid-19 origin, still covering up where Congress had asked WH to disclose declassify information? Why are there so many bio-labs all over the world? What were they scheming to achieve?

6 And I will cast abominable filth upon thee and make thee vile, and will set thee as a gazingstock. — and I will cast abominable filth upon thee, as an expression of the utmost disgust and loathing,

— and make thee vile, an object of disgrace, and will set thee as a gazing-stock, upon which men would look with contempt and derision.

7 And it shall come to pass that all they that look upon thee shall flee from thee and say, ‘Nineveh is laid waste! Who will bemoan her?’ From whence shall I seek comforters for thee?”

— and it shall come to pass that all they that look upon thee shall flee from thee, with a feeling of deepest revulsion, and say, Nineveh is laid waste; who will bemoan her?

— whence shall I seek comforters for thee? so the prophet interjects his question. No one would have the slightest sympathy with the stricken city because she had so thoroughly deserved her judgement and its subsequent punishment.

8 Art thou better than populous No, that was situated among the rivers, that had the waters round about it, whose rampart was the sea and her wall was from the sea?

— art thou better than populous No, that is, No-Amon, Thebes, the capital of Upper Egypt, that was situate among the rivers, that had the waters round about it, namely, in the great irrigation canals, whose rampart was the sea, and her wall was from the sea? the great expanse of the Nile;

— No-Amon, Thebes, signifies the mansion or palace of Ham, or Hamon; the Egyptians, as Herodotus says, call Jupiter by the name of Ammon; thus the Targum interprets it of Alexandria the Great, a city so called long after this, when it was rebuilt by Alexander the Great;

9 Ethiopia and Egypt were her strength, and it was infinite; Put and Lubim were thy helpers. — Ethiopia and Egypt were her strength; that is, the strength, support, protection, and defence of No, whether Alexandria, or Thebes or Memphis:

— Egypt was for these cities were in it, and subject to it; or if this was a free city, as some think, yet in alliance with Egypt and under its protection; and in like connection it was with Ethiopia, a country that lay near to it; and yet, though it was strengthened by such powerful neighbours and allies, it was not secure from the devastation of the enemy.

10 Yet was she carried away; she went into captivity. Her young children also were dashed in pieces at the top of all the streets; and they cast lots for her honorable men, and all her great men were bound in chains.

— yet, in spite of all her own power and the strength of her allies, was she carried away, she went into captivity, after a conquest by either Sennacherib or Sargon; her young children also were dashed in pieces at the top, that is, at the corners, of all the streets; and they cast lots for her honorable men, the conquerors dividing them among themselves by lot, as slaves, and all her great men were bound in chains.

11 Thou also shalt be drunken; thou shalt be hid; thou also shalt seek strength because of the enemy. — thou also, namely, Nineveh, shalt be drunken, upon receiving the cup of God’s fury in judgement;

— thou shall be hid, covered over, as though she had never existed; thou also shalt seek strength because of the enemy, protection or refuge before the advancing enemy, without being able to find it;

— thou shalt be hid; as Nineveh is at this day, “hid” from the sight of men, not to be seen any more; so the Targum says, “thou shall be swallowed up or destroyed.”

12 All thy strongholds shall be like fig trees with the first ripe figs: if they be shaken, they shall even fall into the mouth of the eater.

— all thy strongholds, the fortresses and castles of the Assyrian country, shall be like fig-trees with the first-ripe figs, considered a special delicacy; if they be shaken, they shall even fall into the mouth of the hunter, they would readily be taken or consumed by the invading enemy.

13 Behold, thy people in the midst of thee are women; the gates of thy land shall be set wide open unto thine enemies; the fire shall devour thy bars.

— behold, thy people in the midst of thee are women: weak and feeble, fearful and timorous; frightened at the first approach of the enemy; without strength and courage for the battle;

— the gates of thy land shall be set wide open, the Lord making the land easy of access to the invaders, unto thine enemies; the fire shall devour thy bars, those which held the great gates of the city shut.

14 Draw thee waters for the siege! Fortify thy strongholds! Go into clay and tread the mortar; make strong the brickkiln!

— draw thee waters for the siege; before the siege has begun, fetch water from the river, wells, or fountains outside the city, that needed for a long period of siege of the enemies; fortify thy strongholds, strengthening the forts; go into clay, for making bricks and tread the mortar in order to fashion bricks for the bulwarks; make strong the brickkiln, in order to burn the bricks.

15 There shall the fire devour thee; the sword shall cut thee off; it shall eat thee up like the cankerworm. Make thyself many as the cankerworm, make thyself many as the locusts.

— there shall the fire devouring thee, either the fire of divine wrath; or the fire of the enemy in the very midst of these preparations; the sword shall cut thee off, it shall eat thee up like the cankerworm, as locusts destroy; make thyself many as the cankerworm, like devouring insects; make thyself many as the locusts;

— the thought is this: the fire and the sword, like locusts devouring everything before them, would consume Nineveh, even though the city with its masses of houses and inhabitants, in swarms and innumerable, would in turn, resemble a swarm of locusts.

16 Thou hast multiplied thy merchants above the stars of heaven. The cankerworm despoileth, and fleeth away.

— thou hast multiplied thy merchants above the stars of heaven, the number of its people engaged in commercial pursuits of every kind being very great; the cankerworm spoileth, literally, “the licking locusts enter to plunder,” and fled in haste, or be suddenly stripped of their power or riches; the military might of Assyria being powerless before the armies of the invaders.

17 Thy crowned ones are as the locusts, and thy captains as the great grasshoppers, which camp in the hedges in the cold day; but when the sun ariseth they flee away, and their place is not known where they are.

— thy crowned, the vassal princes are as the locusts, and thy captains, the commanders of her armies as the great grasshoppers, or “locusts of locusts” which camp in the hedges in the cold day, too chilled to use their wings;

— but when the sun ariseth, they flee away, and their place is not known where they are. In a similar way the Assyrian army would vanish from sight; it would not be in evidence to withstand the invaders.

18 Thy shepherds slumber, O king of Assyria; thy nobles shall dwell in the dust; thy people are scattered upon the mountains, and no man gathereth them.

— thy shepherds slumber, O king of Assyria, that is, the mighty ones, the leaders of the people, were resting in a false security; thy nobles shall dwell in the dust, rather, “thy powerful ones are lying still” not making a move to defend their country;

— thy people is scattered upon the mountains, and no man gathereth them, like sheep without a shepherd, which being frightened by beasts of prey, run here and there, and there is none to get them together, and bring them back again; no one assumes the leadership over them, and so their identity as an Assyrian nation is lost.

19 There is no healing of thy bruise; thy wound is grievous. All that hear the report of thee shall clap the hands over thee. For upon whom hath not thy wickedness passed continually?

— there is no healing of thy bruise, the ruin of it was irreparable and irrecoverable; of the fracture which the Lord had inflicted; thy wound is grievous, the stroke or ruin being deadly;

— all that hear the bruit, the report, of thee shall clap the hands over thee, in a gesture of joy over the downfall of the oppressor; for upon whom hath not thy wickedness passed continually? The Lord indeed used Assyria as his scourge,

— but he, at the same time, wanted Assyria to acknowledge his sovereignty. When Nineveh and the entire country, therefore, persisted in their wickedness, his punishment came upon them with crushing force;

— but another Q arises: Is this exposition speaking of the house of Israel instead of the Assyrian empire?

Selah!

Canada Day, CRIMSON!

•July 5, 2023 • Leave a Comment

Canada Day 2023: America’s Insidious Plan to Invade Canada and Bomb Montreal, Vancouver, Halifax and Quebec City (1930-39)

Global Research by Prof Michel Chossudovsky • June 30, 2023

Canada Day 2023: We must reflect on our history. Most Canadians are unaware of the fact that the United States of America had formulated in 1924 a carefully designed plan to invade Canada and bomb Montreal, Quebec City, Halifax and Vancouver.

What has been deliberately omitted from our history books in schools, colleges and universities is that our American neighbour had envisaged a detailed plan to invade Canada. The use of “poison gas” was part of that project. 

War Plan Red was officially approved by the US War Department in May 1930.

The 1928 draft stated that “it should be made quite clear to Canada that in a war she would suffer grievously.”

And guess who was in charge of planning the bombing raids against Canadian cities:  

General Douglas MacArthur who during World War II was put in charge of waging the Pacific War and coordinating the extensive bombing of Japanese cities (1941-1945). 

The war plan was explicitly geared towards the conquest of Canada.

“The US Army’s mission, [written in capital letters], was “ULTIMATELY, TO GAIN COMPLETE CONTROL OF CRIMSON [Canada].”

Canada’s Global and Mail has twisted realities upside down. The Red War Plan to Attack CRIMSON was casually presented as a peacemaking endeavor. It was a plan to rightfully defend the US:

First approved in 1930, Joint Army and Navy Basic War Plan – Red was drawn up to defend the United States in the event of war with Britain.

It was one of a series of such contingency plans produced in the late 1920s. Canada, identified as Crimson, would be invaded to prevent the Britons from using it as a staging ground to attack the United States. (Globe and Mail, December 31, 2005, emphasis added)

The war plan directed against Canada initially formulated in 1924 was entitled “Joint Army and Navy Basic War Plan — Red.” It was approved by the US War Department under the presidency of Herbert Hoover in 1930. It was updated in 1934 and 1935 during the presidency of Franklin D. Roosevelt. It was withdrawn in 1939 (but not abolished) following the outbreak of the Second World War.

Acccording to Floyd Rudmin: 

“Though ostensibly for war against Britain Plan RED is almost devoid of plans to fight the British. The Plan is focused on the conquest of Canada, which was color- coded CRIMSON. The US Army’s mission, written in capital letters, was “ULTIMATELY, TO GAIN COMPLETE CONTROL OF CRIMSON.” The 1924 draft declared that US “intentions are to hold in perpetuity all CRIMSON and RED territory gained… The Dominion government [of Canada] will be abolished.”

The strategic bombing of Halifax, Montreal and Quebec City were envisaged under Plan RED. Moreover, the US Army had been instructed (in capital letters),

“TO MAKE ALL NECESSARY PREPARATIONS FOR THE USE OF CHEMICAL WARFARE FROM THE OUTBREAK OF WAR. THE USE OF CHEMICAL WARFARE, INCLUDING THE USE OF TOXIC AGENTS, FROM THE INCEPTION OF HOSTILITIES, IS AUTHORIZED…” (quoted by Floyd Rudmin, op cit).

In a bitter irony, General Douglas MacArthur who led US forces in The Pacific during World War II, not to mention the conduct of the carpet bombing raids against North Korea (1950-1953) was actively involved in the planning of war directed against Canada.

“In March 1935, General Douglas MacArthur proposed an amendment making Vancouver a priority [bombing] target comparable to Halifax and Montreal” (Ibid)

Today, Canada’s sovereignty as a Nation State is threatened by the Justin Trudeau government which is firmly aligned with Joe Biden’s military agenda, acting as a de facto US proxy.

For more details and Annex I to III, see Global Research by Prof Michel Chossudovsky

Donald Trump is a bully who never grew up

•July 4, 2023 • Leave a Comment

“Donald Trump is a bully who never grew up, throws tantrums to get what he wants,” writes Robert L Montgomery. This could also be said of John McEnroe, that famed tennis star, who frequently galvanized the tennis world with his antics and tantrums when he thought he had unjustly lost a point or an advantage.

And again, that could be said of the United States as a nation, who again frequently behaves like a bully, a sore loser at times, angry and frustrated, throwing sanctions left and right to various nations far and wide that seem not to follow its orders; or taking actions not conducive to its will. And this show continues . . .

Citizen Times by Rev Robert L Montgomery, PhD • July 2, 2023 ~ YahooNews

Most of us are not psychologists, but we can easily recognize when a spoiled child is having a tantrum. Often, they will sit on the floor and kick.

As they grow up, they always want their own way and pout or cry if they don’t get it. Many become bullies as older children and even as adults. I cannot help but be reminded of such persons by the behavior of Donald J Trump.

Isaiah 56:9 Come, all you beasts of the field;
eat greedily, all you beasts of the forest.

10 Israel’s watchmen are blind,
they are all oblivious;
they are all mute dogs,
they cannot bark;
they are dreamers lying around,
loving to slumber.

11 Like ravenous dogs,
they are never satisfied.
They are shepherds with no discernment;
they all turn to their own way,
each one seeking his own gain:

12 “Come, let me get the wine,
let us imbibe the strong drink,
and tomorrow will be like today,
only far better!” Isaiah 56

There are two main issues with spoiled persons. One is their desire for something and the second is power to get what is wanted.

When people want something, there are ways to get it that are usually acceptable and even sometimes admired, such as hard work so that the work will be rewarded with fulfillment of the desire.

We are constantly seeking to make this possible in our democracy. However, a spoiled person may use unacceptable and wrong means to gain what is desired. We saw that Donald Trump was greatly disappointed when he did not win the 2020 election and he immediately lied, saying that he had won.

This encouraged his followers to believe the same thing even though many courts rejected “the Big Lie” of massive fraud. Numerous false stories were made up about the election. But it did not stop there.

Because Trump did not have the power to overturn the election, that did not stop him and his followers from trying to do just that as we clearly heard and saw on TV on Jan 6, 2021.

A frustrated spoiled child sits on the floor and kicks, as we have seen, and the former President and his followers did the adult equivalent of that as they tried to do the anti-democratic thing by exercising coercive force on the nation to get their way. They said they wanted to “take back the country” as if the country we all live in had somehow been taken away from them.

A major question in all societies is who should exercise power? Democracies have an orderly means for settling the matter of who should exercise power. It is through the whole process of trying to persuade the electorate by speeches and writings that are then followed by elections.

The speeches and writings are backed by political parties that present different policies and programs for the future. They represent different governing philosophies and vie for approval from the electorate.

The competition should remain within legal boundaries, but the law protecting the Capital or the Seat of Power was clearly broken by Trump and his followers, acting like spoiled children. I have been wanting to say that for a long time. 

No society, including American society, has been perfect, but democracy provides a way to continually improve society. This will never be evenly done, but we can constantly correct cases where the desire of some, especially those who are used to “getting their way,” becomes harmful.

Also, through democracy we have a way to balance power between those contending for power. This is the purpose of elections as well as courts of law. We will always have spoiled people, who probably learned to be that way in early life, often a privileged life.

Parents can play a part in the correction of such people, but so can teachers. Beyond these, there is the “school of hard knocks,” which seems built in to much of life. It can also be part of the judgement that comes with bad behavior.

Our democracy is meant to enable the life of most people to proceed so that the proper use of our desires and power is encouraged and rewarded. At the same time, for those who have desires that bring harm to others and use unlawful means to obtain those desires will be hindered and blocked.

This applies to all of life, including to government and to economic affairs, where power and its social effects can be very harmful to many.

Democracy is the government devised by the founders to create a society in which law prevails among equals. That is why we say “No one is above the Law” and not only say it, but attempt to carry this principle.

This requires both courage and effort from as many people as possible in our society, We also welcome as many nations as possible to join us in the movement for freedom and democracy.

“O Ephraim, what shall I do unto thee? O Judah, what shall I do unto thee? For your goodness is as a morning cloud, and as the early dew it goeth away” Hosea 6:4

“Woe to the crown of pride, to the drunkards of Ephraim, whose glorious beauty is a fading flower, which is on the head of the fat valleys of them that are overcome with wine!” Isaiah 28:1

“Ephraim shall be desolate in the day of rebuke; among the tribes of Israel have I made known that which shall surely be” Hosea 5:9

Joel (Ch 1-3)

•July 4, 2023 • Leave a Comment

The Prophecy of Joel describes a dreadful calamity upon the people of the Jews by locusts, caterpillars and drought. Rashi thought Joel was a contemporary with Elisha and say he prophesied in the days of Jehoram the son of Ahab, when the seven years’ famine called for came upon the land.

And it seems indeed as if Joel prophesied after the ten tribes were carried captive, which was in the sixth year of Hezekiah’s reign, since no mention was made of Israel but with respect to future times, only of Judah and Jerusalem.

Joel 1

1 The word of the Lord that came to Joel the son of Pethuel. — the name Joel signifies “Yehovah is God,” or “whose God is Yehovah.”

— Rashi: to Joel, son of Pethuel: the son of Samuel the prophet who persuaded God with his prayer (פִתָּה לְאֵל). Some say that this prophecy was said in those seven years in which Elisha said: “For the Lord has decreed a famine etc.” and they took place during the days of Jehoram son of Ahab.

2 Hear this, ye old men, and give ear, all ye inhabitants of the land. Hath this been in your days, or even in the days of your fathers?

— Hear this, ye old men, whose memory reached back through generations of men and give ear in yielding a most willing and careful attention;

— all ye inhabitants of the land. It is a spirited challenge to all the people of Judah to mark the lesson of the great calamity which has befallen them. Hath this been in your days or even in the days of your fathers? A visitation of this kind and grievous to this extent had never yet been seen in Palestine.

3 Tell ye your children of it, and let your children tell their children, and their children another generation.

— tell ye your children of it and let your children tell their children and their children another generation, passing it on from father to son, all of them accepting this tradition with awe, fear and trembling as being an unparalleled manifestation of God’s anger against men on account of their sins.

4 That which the palmer worm hath left hath the locust eaten; and that which the locust hath left hath the cankerworm eaten; and that which the cankerworm hath left hath the caterpillar eaten. — this could be a prophecy of plagues of locusts as yet in the future;

— that which the palmer-worm, literally, “the gnawer-off,” hath left the locust eaten, the swarming or multiplying locust of the desert;

— and that which the locust hath left hath the canker-worm, the devouring grasshopper, eaten; and that which the canker-worm hath left hath the caterpillar eaten, that is, the consuming locust;

— the desolation wrought by the plague of the locusts is described in the most graphic manner; one feature after another being depicted in a way to arouse the people to a realization of the seriousness of the situation.

5 Awake, ye drunkards, and weep; and howl, all ye drinkers of wine, because of the new wine, for it is cut off from your mouth. — weep and howl: signs of dark days;

— awake, ye drunkards and weep; howl, all ye drinkers of wine, because of the new wine, since the supply of grapes and therefore of the liquor made from them were not available; for it is cut off from your mouth. This appeal is introduced to describe the complete devastation of the land.

6 For a nation has come up upon my land, strong and without number, whose teeth are the teeth of a lion, and he hath the cheek teeth of a great lion. — for a nation of locusts come up upon my land, a great and mighty army of fierce warriors, strong and without number in swarms of countless myriads;

— insects are described as a nation or people marching in order under their leaders because of their power to do mischief; the prophet now urges his countrymen to mourn;

— whose teeth are the teeth of a lion, and he hath the cheek-teeth of a great lion or like the “the grinders” of teeth being hard, strong and sharp to bite off the tops, boughs and branches of trees: the jaw-teeth of a lioness protecting or avenging her young, grinding to pieces everything that came in their path.

7 He hath laid my vine waste, and barked my fig tree; he hath made it clean bare and cast it away; the branches thereof are made white. — he, the nation of locust;

— the locust hath laid the Lord’s vine waste, that is, and spoiled the vines by consuming its foliage and barked at his fig-tree; gnawing off the bark and laying bare stem and branches, so that they hath made it clean bare and cast it away; by the complete removal of the bark, stripped it of its leaves, fruit and bark also: this being the condition in which the land was left after the visit of the locusts,

8 Lament like a virgin girded with sackcloth for the husband of her youth. — personified as a woman, lamenting like a virgin, girded with sackcloth, the “daughter of Judah,” or “daughter of my people,”

— the dress of mourning for the husband of her youth, whom after their betrothal, death took away. The grief of a bereaved virgin and bride is represented also in other passages as deep and overwhelming. Cf Isaiah 54:6.

9 The meat offering and the drink offering is cut off from the house of the Lord; the priests, the Lord’S ministers, mourn.

— the meat-offering and the drink-offering, the sacrifices in the worship of God Almighty is cut off from the house of the Lord because it was impossible to procure the necessary materials since everything was destroyed;

— the priests, the Lord’s ministers, mourn on account of the decay resulting from the devastation which was followed also by a dearth of the animals used for sacrificial purposes.

10 The field is wasted, the land mourneth, for the corn is wasted; the new wine is dried up, the oil languisheth.

— the field is wasted, made desolate; the land mourneth, both the uncultivated and the cultivated sections of the land suffering in the same measure; for the corn is wasted, destroyed by the locusts, the grain completely consumed;

— the new wine is dried up, the grapes being spoiled for want of foliage on the vines; the oil languisheth because the olive-trees produced no fruit.

11 Be ye ashamed, O ye husbandmen; howl, O ye vinedressers, for the wheat and for the barley, because the harvest of the field is perished. — manifest by overt signs your distress;

— be ye ashamed, O ye husbandmen, bearing the shame of disappointed hopes after working hard for a crop; howl, O ye vine-dressers; these two representing the agricultural classes of the land for the wheat and for the barley because the harvest of the field is perished, this being the cause of the farmers’ lament.

Swarm of locusts

12 The vine is dried up, and the fig tree languisheth; the pomegranate tree, the palm tree also, and the apple tree—even all the trees of the field are withered, because joy is withered away from the sons of men.

— the ravages produced by the locusts and the drought are universal; the vine is dried up and the fig-tree languisheth so that gardener and horticulturist likewise had reasons for mourning; the pomegranate-tree, the palm-tree also, the date-palm, which ordinarily escaped the onslaughts of the locust;

— and the apple-tree, or the quince, even all the trees of the field are withered; because joy is withered away from the sons of men so that there could be no rejoicing over a bountiful harvest as usual; Cf Psalms 4:7; Isaiah 9:3.

13 Gird yourselves and lament, ye priests; howl, ye ministers of the altar. Come, lie all night in sackcloth, ye ministers of my God; for the meat offering and the drink offering is withheld from the house of your God.

— gird yourselves, namely, with garments of mourning and lament, ye priests; howl, ye ministers of the altar, whose chief duties were concerned with the sacrifices brought on the two altars of the Temple;

— Come, lie all night in sackcloth, ye ministers of my God, extending their exercises of mourning even through the night season; for the meat-offering and the drink-offering is withholden from the house of your God, so that all the usual sacrifices had to be discontinued;

— as Ahab did, when he humbled himself before Elijah (1 Kings 21:27). The sackcloth would be a token not only of grief, but also of sorrow, regret and repentance (Nehemiah 9:1; Jonah 3:5-6).

14 Sanctify ye a fast; call a solemn assembly. Gather the elders and all the inhabitants of the land into the house of the Lord your God, and cry unto the Lord!

— sanctify ye a fast, appointing a day or a number of days for a special religious service, during which the depth of the people’s grief should be indicated by their abstaining from food;

— call a solemn assembly, such as were held in connection with the great festivals; gather the elders and all the inhabitants of the land into the house of the Lord, your God, and cry unto the Lord with impetuous and importunate praying.

15 Alas for the day! For the day of the Lord is at hand, and as a destruction from the Almighty shall it come.

— alas for the day coming near! so the prophet himself laments for the Day of the Lord, the time of stern visitation is coming soon as a destruction from the Almighty shall it come, bringing its desolating scourge upon the land.

16 Is not the meat cut off before our eyes, yea, joy and gladness from the house of our God?

— is not the meat cut off before our eyes as their food supply was destroyed by the invading hordes of locusts? Yea, joy and gladness from the house of our God since the various sacrifices and meals of thanksgiving were no longer possible.

17 The seed is rotten under their clods, the garners are laid desolate, the barns are broken down; for the corn is withered.

— the seed is rotten under their clods, withering in the soil on account of the terrible drought; the garners are laid desolate, the granaries being empty because there could be no harvest;

— the barns, which otherwise harbored such rich crops are broken down, falling to pieces for want of money to repair them; for the corn is withered.

18 How the beasts do groan! The herds of cattle are perplexed, because they have no pasture; yea, the flocks of sheep are made desolate.

— how do the beasts groan? since the meadows also were dried up. The herds of cattle are perplexed, restless hunting of hungry cattle because they have no pasture; yea, the flocks of sheep are made desolate, bearing their sufferings as a consequence of the transgressions of the people of the land. All this causes the prophet to lift up his voice to the Lord in a cry for help.

19 O Lord, to Thee will I cry! For the fire hath devoured the pastures of the wilderness, and the flame hath burned all the trees of the field.

— O Lord, to thee will I cry; for the fire, the parching heat hath devoured the pastures of the wilderness of the great Judean steppes; indicating land which iare unenclosed and uncultivated,

— and the flame, the fierce heat of the drought hath burned all the trees of the field.

20 The beasts of the field cry also unto Thee; for the rivers of waters are dried up, and the fire hath devoured the pastures of the wilderness.

— the beasts of the field, both domestic and wild animals, cry also unto thee, their dumb misery being a powerful appeal for help;

— for the rivers of waters are dried up and the fire hath devoured the pastures of the wilderness. Cf Job 38:41; Psalms 104:21; 145:15; 147:9; Jeremiah 14:5-6. All creation groans and travails in pain together until now on account of the burden of man’s guilt. Romans 8:19-22.

Joel 2

1 Blow ye the trumpet in Zion, and sound an alarm in My holy mountain! Let all the inhabitants of the land tremble; for the day of the Lord cometh, for it is nigh at hand—

— blow ye the trumpet in Zion; this signal the priests announcing the coming calamity and sound an alarm in the Lord’s holy mountain, from the Temple as the center of Yehovah’s worship and the place of his presence in the midst of his people;

— let all the inhabitants of the land tremble, shaken up out of their care-free condition; for the Day of the Lord cometh, for it is nigh at hand, the visitation is no longer in the dim and distant future, but is an event to be expected soon;

— the whole world will be given a Mount Sinai experience as the children had when they came out of Egypt; so that the fear of the Lord will always be embedded in them, all the nations of the world to fear Him; Exodus 19:16-18, 20:18-21.

2 a day of darkness and of gloominess, a day of clouds and of thick darkness, as the morning spread upon the mountains. A great people and a strong, there hath not been ever the like; neither shall be any more after it, even to the years of many generations.

— a day of darkness and of gloominess as when the light of the sun is shut out by immense swarms of locusts, a day of clouds and of thick darkness of heavy, dense and obscuring cloudiness;

— as the morning spread upon the mountains, a great people and a strong, the wings of the locusts reflecting the rays of the sun in a murky light before their immense numbers shut out the sun altogether. There hath not been ever the like, neither shall be any more after it, even to the years of many generations, Cf Joel 1:2.

3 A fire devoureth before them, and behind them a flame burneth. The land is as the Garden of Eden before them, and behind them a desolate wilderness; yea, and nothing shall escape them.

— a fire, a most intense and parching heat, devoureth before them in preparing for the desolation to follow; and behind them a flame burneth, the terrible, withering heat continuing even after the swarms of grasshoppers had passed;

— the land is as the Garden of Eden before them like the beautiful park of paradise described in Genesis 2, and behind them a desolate wilderness; yea, and nothing shall escape them, the devastation would be thorough.

4 The appearance of them is as the appearance of horses; and as horsemen, so shall they run. — the appearance of the locusts is as the appearance of horses, whom they resemble as to the shape of their heads; and as horsemen, so shall they run with uncanny swiftness.

5 Like the noise of chariots on the tops of mountains shall they leap, like the noise of a flame of fire that devoureth the stubble, as a strong people set in battle array.

— like the noise of chariots on the tops of mountains as they clatter along over rough mountain roads shall they leap; such would be the noise of their crackling movements in a great mass;

— like the noise of a flame of fire that devoureth the stubble as a strong people set in battle array for there is a strong similarity to all these rushing, pounding sounds in the movements of vast swarms of locusts.

6 Before their face the people shall be much pained; all faces shall gather blackness. — before their face as they proceed on their path of devastation, the people all those so visited, shall be much pained, trembling and helpless with terror;

— all faces shall gather blackness, losing the glowing color of health, growing pale with conscious helplessness.

7 They shall run like mighty men; they shall climb the wall like men of war; and they shall march every one on his ways, and they shall not break their ranks.

— they shall run like mighty men, straightforward to the attack; they shall climb the wall like men of war in an advance that cannot be stopped;

— and they shall march every one on his ways and they shall not break their ranks, this peculiarity being noted by all observers. It was and is vain to resist them by the means ordinarily used to stop the progress of an invading army.

8 Neither shall one thrust another; they shall walk every one in his path; and when they fall upon the sword, they shall not be wounded.

— neither shall one thrust another, not pressing ahead, upon those going before; they shall walk every one in his path, like a well-drilled army; and when they fall upon the sword, they shall not be wounded for they are represented as an invincible army of the Lord.

9 They shall run to and fro in the city, they shall run upon the wall; they shall climb up upon the houses, they shall enter in at the windows like a thief.

— they shall run to and fro in the city, being altogether unhindered in their advance; they shall run upon the wall, they shall climb up upon the houses; they shall enter in at the windows like a thief;

— when the locusts come and fill the whole space between earth and sky, they fly in perfect order, as if obedient to a divine command so that they look like the squares of a pavement; each one holds its own place, not diverging from it even so much as by a finger’s breadth. To these locusts nothing is impenetrable, fields, meadows, trees, cities, houses, even their most secret chambers.

10 The earth shall quake before them, the heavens shall tremble; the sun and the moon shall be dark, and the stars shall withdraw their shining.

— the earth shall quake before them, liked before Mount Sinai, terrified by their dreadful host, the heavens shall tremble, resounding with the rushing of their flight;

— the sun and the moon shall be dark and the stars shall withdraw their shining, their light shut out by the immense hosts of locusts.

11 And the Lord shall utter His voice before His army, for His camp is very great. For He is strong that executeth His word; for the day of the Lord is great and very terrible, and who can abide it?

— and the Lord shall utter his voice before his army, which the grasshoppers here represent; for his camp is very great, the host under his command exceedingly large; for he (the Son?) is strong that executeth his word, carrying out the will of the Lord; for the day of the Lord, his coming visitation, is great and very terrible; and who can abide it?

— it is evident that the entire description is incidentally symbolical of the great and mighty Judgement Day of the Lord, which, in its preliminary features, is seen in the Deluge, in the two destructions of Jerusalem and in various other calamities and cataclysms, but which is destined to be immeasurably greater than man can conceive of when it actually comes to pass. Cf Malachi 3:2. This being true, the admonition of the prophet comes with particular force.

12 “Therefore also now,” saith the Lord, “turn ye even to Me with all your heart, and with fasting, and with weeping, and with mourning.”

— therefore also now, saith the Lord, turn ye even to me with all your heart, in a true repentance and with fasting and with weeping and with mourning, as outward indications of the change of heart,

13 And rend your heart, and not your garments, and turn unto the Lord your God; for He is gracious and merciful, slow to anger, and of great kindness, and repenteth of the evil.

— and rend your heart in a true and unfeigned sorrow, and not your garments for the latter may be done also by hypocrites;

— and turn unto the Lord, your God; for he is gracious and merciful, slow to anger, and of great kindness, and repenteth him of the evil, that is, he is persuaded not to let stern justice alone rule. Cf Exodus 34:6.

14 Who knoweth if He will return and repent, and leave a blessing behind Him—even a meat offering and a drink offering unto the Lord your God?

— who knoweth if he will return, not carry out the threatened punishment, and repent and leave a blessing behind him, namely, when he, as men pictured him, returns to his throne in heaven;

— even a meat-offering and a drink-offering unto the Lord, your God? for by an abundant harvest which he may be persuaded to give, the people would again be enabled to bring their usual sacrifices in the Temple. In order to accomplish this, however, it was necessary that the people unite in a great service of prayer and supplication.

15 Blow the trumpet in Zion, sanctify a fast! Call a solemn assembly, — blow the trumpet in Zion, the call once more going forth; sanctify a fast; call a solemn assembly,

16 gather the people! Sanctify the congregation, assemble the elders, gather the children and those that suck the breasts; let the bridegroom go forth from his chamber and the bride out of her retreat.

— gather the people for a great meeting of worship and supplication; sanctify the congregation, so that no one would be Levitically unclean;

— assemble the elders, the aged people of the congregation; gather the children and those that suck the breast for no one is to be omitted in this great appeal for mercy, since all of them, from the smallest to the greatest, were guilty;

— let the bridegroom go forth of his chamber and the bride out of her closet, where they were preparing for the coming wedding. The fact that even infants in arms and bride and groom were included in the appeal of the prophet shows that the guilt was universal and beyond excuse.

17 Let the priests, the ministers of the Lord, weep between the porch and the altar; and let them say, “Spare Thy people, O Lord, and give not Thine heritage to reproach, that the heathen should rule over them.Why should they say among the people, ‘Where is their God?’”

— let the priests, the ministers of the Lord, who occupied the position of mediators between God and his people, weep between the porch and the altar and let them say, in a solemn litany chanted at the very door of the Holy Place;

— Spare thy people, O Lord, and give not thine heritage, the people of his own possession to reproach, Cf Exodus 32:11-12, that the heathen should rule over them, or “make mockery of them.” Wherefore should they say among the people, among the nations everywhere, Where is their God? thus bringing disgrace upon the holy name of the Lord.

18 Then will the Lord be jealous for His land, and pity His people.

— then, when the Lord saw that his people were truly penitent, will he be jealous for his land be filled with the zeal of his love, rather, he was so filled and acted accordingly, and pity his people.

19 Yea, the Lord will answer and say unto His people: “Behold, I will send you corn and wine and oil, and ye shall be satisfied therewith; and I will no more make you a reproach among the heathen.

— yea, the Lord will answer and say unto his people, actuated with the zeal of his love for them, Behold, the Lord will send you corn and wine and oil, the richest temporal blessings made possible by the renewed fertility of the land;

— and ye shall be satisfied therewith; and the Lord will no more make you a reproach among the nations of which their prayer had complained.

20 But I will remove far off from you the northern army, and will drive him into a land barren and desolate, with his face toward the east sea, and his hinder part toward the utmost sea. And his stink shall come up, and his ill savor shall come up” because He hath done great things.

— but the Lord will remove far off from you the northern army, the swarms of locusts which came from that direction, and will drive him into a land barren and desolate into the desert of Arabia;

— with his face toward the East Sea, that is, the Dead Sea and his hinder part, his rearguard toward the utmost sea, that is, the Mediterranean; and his stink shall come up, the terrible stench of the decaying insects, and his ill savor shall come up, because he hath done great things;

The Message Bible offers a more colorful description:

At that, God went into action to get his land back. He took pity on his people. God answered and spoke to his people, “Look, listen—I’m sending a gift: Grain and wine and olive oil. The fast is over—eat your fill! I won’t expose you any longer to contempt among the pagans. I’ll head off the final enemy coming out of the north and dump them in a wasteland. Half of them will end up in the Dead Sea, the other half in the Mediterranean. There they’ll rot, a stench to high heaven. The bigger the enemy, the stronger the stench!”

21 Fear not, O land; be glad and rejoice, for the Lord will do great things!

— fear not, O land, the entire country being included in this new admonition as before; be glad and rejoice, namely, over the hosts that laid waste the country; for the Lord will do great things, Yehovah is able to perform marvelous works in delivering his people.

22 Be not afraid, ye beasts of the field; for the pastures of the wilderness spring up, for the tree beareth her fruit, the fig tree and the vine do yield their strength.

— be not afraid, ye beasts of the field which had been so sorely in need of food supplies; for the pastures of the wilderness of the great prairies of the South, do spring, once more verdant with an abundance of grass;

— for the tree beareth her fruit as before the terrible visitation, the fig-tree and the vine do yield their strength so as to bring forth fruit as of old.

23 Be glad then, ye children of Zion, and rejoice in the Lord your God; for He hath given you the early rain moderately, and He will cause to come down for you the rain, the early rain and the latter rain in the first month.

— be glad, then, ye children of Zion, the inhabitants of Judah, the children of the Lord and rejoice in the Lord, your God, the God of the covenant, the Lord of mercy;

— for he hath given you the former rain moderately, literally, “a teacher for righteousness” or “rain in just measure” and he will cause to come down for you the rain, the former rain and the latter rain in the first month, the former rain being due right after seeding-time, in the fall, and the latter rain coming just before harvest, in the spring.

24 And the floors shall be full of wheat, and the vats shall overflow with wine and oil.

— and the floors, the threshing-floors shall be full of wheat, the result of a new, rich harvest and the fats shall overflow with wine and oil, the receptacles of the vineyards being unable to hold the rich measure of blessings.

25 “And I will restore to you the years that the locust hath eaten, the cankerworm and the caterpillar and the palmer worm, My great army which I sent among you.

— and the Lord will restore to you, make up the years that the locust hath eaten, the canker-worm and the caterpillar and the palmer-worm, his great army which he sent among you, the insects of Joel 1:4 being named in the reverse order.

26 And ye shall eat in plenty and be satisfied, and praise the name of the Lord your God that hath dealt wondrously with you; and My people shall never be ashamed.

— and ye shall have plenty to eat, having an abundance of the best food and be satisfied and praise the name of the Lord your God that hath dealt wondrously with you, making his wonders known through the manner in which he dealt with them;

— and the Lord’s people shall never be ashamed again, never to be heaped with mockery and disgrace, since it would be so evident that the Lord was on their side. This would, moreover, be substantiated more than ever by the fullness of spiritual blessings which he intended to pour out upon his children after their restoration to his sonship.

27 And ye shall know that I am in the midst of Israel, and that I am the Lord your God, and none else; and My people shall never be ashamed.

— and ye shall know that the Lord is in the midst of Israel as his chosen people, and that Yehovah is the Lord, their God, the God of the covenant and none else; and his people, the true spiritual Israel shall never be ashamed again.

28 “And it shall come to pass afterward that I will pour out My Spirit upon all flesh; and your sons and your daughters shall prophesy, your old men shall dream dreams, your young men shall see visions;

— and it shall come to pass afterward, in the Millennium toward which this prophecy converged, that the Lord will pour out his Spirit upon all flesh, upon men of every race and nation;

— and your sons and your daughters shall prophesy, openly proclaiming the great deeds of God, your old men shall dream dreams, your young men shall see visions, the great possibilities of the Lord’s work and the energy for carrying out the plans of the Lord coming to them and urging them forward with irresistible power, the barriers of both sex and age being removed, except as limited in other parts of the Scriptures;

29 and also upon the servants and upon the handmaids in those days will I pour out My Spirit. — and also upon the servants and upon the handmaids, upon the lowliest of the land;

— in those days will the Lord pour out his Spirit, all social distinction being abandoned during the Millennium as far as the work of the Kingdom is concerned;

— this prophecy was fulfilled, so far as its beginning is concerned, on the Day of Pentecost, as Peter also states in the introduction to his powerful sermon held before the astonished inhabitants of the city of Jerusalem, Acts 2:17-21. But this event by no means exhausted its wonderful promises;

— for the spirit of the Lord is being poured out on the members of the Kingdom of the New Era and will continue to be given to all true believers until the end of time. But this great and wonderful deed of the Lord is placed side by side with His judgement upon the nations.

30 “And I will show wonders in the heavens and in the earth— blood and fire and pillars of smoke.

— and the Lord will show wonders in the heavens and in the earth, strange and terrifying portents, blood and fire and pillars of smoke, miracles in the sky above and signs of His majesty on the earth beneath, blood and fire and smoky vapor.

31 The sun shall be turned into darkness and the moon into blood, before the great and the terrible day of the Lord come.

— the sun shall be turned into darkness, being changed into a dark and cold mass, and the moon into blood, as bloody wars and devastations would occur on the earth, before the great and the terrible Day of the Lord come, namely, the Day of final Judgement.

32 And it shall come to pass, that whosoever shall call on the name of the Lord shall be delivered; for in Mount Zion and in Jerusalem shall be deliverance, as the Lord hath said, and in the remnant whom the Lord shall call.

— and it shall come to pass, throughout this great Day of the Lord’s preparation for the final Judgement, that whosoever shall call on the name of the Lord, Yehovah, confessing the Messiah and accepting him as the one Savior of mankind, shall be delivered, saved from the wrath to come;

— for in Mount Zion and in Jerusalem shall be deliverance, the Gospel-message proclaimed in and by the Chosen people of God bringing redemption and the assurance of eternal life to all believers, as the Lord hath said, and in the remnant whom the Lord shall call;

— namely, the remainder according to the selection by the Lord, Yehovah, the people whom the Lord has chosen from all nations of the earth. This glorious promise is held out to this day to all who turn to the Lord in keeping his commandments, repentance and faith, confessing his name as the only Savior and fervently calling upon him for deliverance from all evil, especially that of the body of sin;

— God’s name is the four-letter Hebrew word יהוה‎ YHVH Yehovah (not Jehovah since the letter J wasn’t around but only after the sixteenth century).

Joel 3

1 “For behold, in those days and in that time, when I shall bring back the captives of Judah and Jerusalem,

— for behold, heading towards the Millennium, in those days and in that time which had just been described with the Day of Judgement very prominent in the description, when the Lord of hosts shall bring again the captivity of Judah and Jerusalem for forty years, by the deliverance through the Messiah, of which the return of Judah from exile was but a type;

For more into another Captivity: see Ezekiel Timeline – 190/40 Years
For more about a prophecy of Esau or Edom, see Obadiah
For more on the enemy from the South, see A Sword from the South!

2 I will also gather all nations, and will bring them down into the Valley of Jehoshaphat, and will plead with them there for My people and for My heritage Israel, whom they have scattered among the nations, and parted My land.

— the Lord will also gather all nations, with the great and mighty heathen nations, and will bring them down into the Valley of Jehoshaphat, another Mount Sinai experience, which is here remade the scene of another Face to Face before the last Great Judgement and the Lord will plead with them there;

— for the Lord’s people and for his heritage Israel, in the interest of the Lord’s, whom they have scattered among the nations, in the various oppressions and captivities which have struck the Lord’s people from the earliest days, and parted his land, appropriating it or dividing it as they saw fit.

3 And they have cast lots for My people, and have given a boy for a harlot and sold a girl for wine, that they might drink.

— and they have cast lots for the Lord’s people, after they had taken them captive and have given a boy for an harlot, namely, as the price for which they secured the services of a prostitute;

— and sold a girl for wine, for the sake of a drunken debauch that they might drink. The description is typical of the manner with which the Lord’s enemies have ever dealt with the captive Israelites.

4 Yea, and what have ye to do with Me, O Tyre and Sidon and all the coasts of Palestine? Will ye render Me a recompense? And if ye recompense Me, swiftly and speedily will I return your recompense upon your own head,

— yea, and what have ye to do with the Lord, O Tyre and Zidon and all the coasts of Palestine? that is, what object did they have in acting as they did, when not only the capitals of Phoenicia but also the state of Philistia were showing such enmity against him?

— will ye render the Lord a recompense? seeking revenge for what they consider a wrong done them? They had neither cause to seek revenge nor occasion to carry it out. And if ye recompense the Lord, swiftly and speedily will he return your recompense upon your own head, Cf Psalms 7:17,

5 because ye have taken My silver and My gold, and have carried into your temples My goodly, pleasant things.

— because ye have taken silver and gold from the Lord, in the Temple-treasures and throughout the city of Jerusalem, and have carried into your temples, including also the palaces of their rulers, the Lord’s goodly, pleasant things, his most costly possessions;

6 The children also of Judah and the children of Jerusalem have ye sold unto the Grecians, that ye might remove them far from their border.

— the children of Judah and the children of Jerusalem have ye sold unto the Grecians, the Philistines being those who reduced the captives to slavery, the Phoenicians those who acted as agents in selling the Hebrew slaves that ye might remove them far from their border, to be slaves in distant countries.

7 Behold, I will raise them out of the place whither ye have sold them, and will return your recompense upon your own head.

— behold, the Lord will raise them out of the place whither ye have sold them, delivering them from the masters to whom they had been sold, and will return your recompense upon your own head so that their revenge would react upon themselves.

8 And I will sell your sons and your daughters into the hand of the children of Judah, and they shall sell them to the Sabeans, to a people far off; for the Lord hath spoken it.”

— and the Lord will sell your sons and your daughters into the hand of the children of Judah, when Tyre and Sidon were captured and their inhabitants either killed or reduced to slavery and they shall sell them to the Sabeans who are mentioned as being the remotest nation toward the east in the Arabian Desert;

— to a people far off; for the Lord hath spoken it. The imagery of this paragraph is based, at least in part, upon happenings of those days; but the application includes far more than this for the Lord makes those incidents typical of the punishments which He intended for all His enemies.

9 Proclaim ye this among the Gentiles: Prepare war! Wake up the mighty men! Let all the men of war draw near; let them come up.

— proclaim ye this among the nations as they made ready to wage war against the Lord’s people. Prepare war, consecrate the undertaking by means of sacrifices, wake up the mighty men, let them arouse themselves from their inactivity, let all the men of war draw near, let them come up, assembling for the campaign.

10 Beat your plowshares into swords, and your pruning hooks into spears; let the weak say, “I am strong.”

— beat your plowshares into swords and your pruning-hooks into spears, bending every effort toward the winning of their unholy war. Let the weak say, I am strong, as when warlike excitement takes hold of a whole nation.

11 Assemble yourselves and come, all ye heathen, and gather yourselves together round about; thither cause Thy mighty ones to come down, O Lord.

— assemble yourselves and come, all ye nations, and gather yourselves together round about for the Lord’s people are ever regarded as occupying a central position in the earth; thither cause thy mighty ones to come down, O Lord, to meet the invasion of the enemies with a fearless countercharge.

12 “Let the heathen be wakened, and come up to the Valley of Jehoshaphat; for there will I sit to judge all the heathen round about.

— let the nations awake, stir up to warfare and come up to the Valley of Jehoshaphat; for there will the Lord sits to judge all the nations round about, all the nations of the world, since they all, by the time of the final Judgement, would have come into contact with the God of Israel.

13 Put ye in the sickle, for the harvest is ripe. Come, get you down; for the press is full, the vats overflow—for their wickedness is great!”

— put ye in the sickle so the Lord shouts to his mighty champions for the harvest is ripe, the crop of the world having reached its maturity. Come, get you down, stamping the vats of gathered grapes;

— for the press is full, the fats overflow, the earth being more than ripe for Judgment; for their wickedness is great. Cf Revelation 14:15-18

14 Multitudes, multitudes in the valley of decision; for the day of the Lord is near in the valley of decision.

— multitudes, multitudes in the Valley of Decision; for the Day of the Lord, the Day of final Judgement, is also call the Valley of Decision, bound to be revealed as soon as all men would have had an opportunity to learn the Warning.

15 The sun and the moon shall be darkened, and the stars shall withdraw their shining. — the Lord wants the whole world to fear him;

— Targum of Zephaniah 2:3 says, “seek the fear of the Lord, all ye meek of the earth, who do the judgements of his will; seek truth, seek meekness; it may be there will be a protection for you on the day of the Lord’s anger.”

16 The Lord also shall roar out of Zion, and utter His voice from Jerusalem, and the heavens and the earth shall shake; but the Lord will be the hope of His people, and the strength of the children of Israel.

— the Lord also shall roar out of Zion, with a voice of thunder terrifying his enemies, everyone given a Mount Sinai experience, and utter his voice from Jerusalem, in the Word which was proclaimed there for so many centuries;

— and the heavens and the earth shall shake; but the Lord will be the hope of his people and the Strength of the children of Israel. “Zion, or Jerusalem, is naturally not the earthly Jerusalem, but the Holy City of the living God, in which the Lord will be forever united with his saved and glorified congregation.”

— as in Joel 2:1 above, “the earth will shake” that is, the whole world will be given a Mount Sinai experience as the children had when they came out of Egypt; so that the fear of the Lord will always be embedded in them, all the nations of the world to fear Him; Exodus 19:16-18, 20:18-21.

17 “So shall ye know that I am the Lord your God dwelling in Zion, My holy mountain. Then shall Jerusalem be holy, and there shall no strangers pass through her any more.

— so shall ye know that Yehovah is the Lord, your God, dwelling in Zion, his holy mountain, in the midst of the congregation of Israel. Then shall Jerusalem be holy, a true congregation of the saints; and there shall no strangers pass through her any more, only those who have been brought nigh by the blood of the Messiah (the Lamb, the Christ).

18 “And it shall come to pass in that day, that the mountains shall drop down new wine, and the hills shall flow with milk; and all the rivers of Judah shall flow with waters, and a fountain shall come forth from the house of the Lord and shall water the valley of Shittim.

— and it shall come to pass in that day when the blessings of the Millennium would be dispensed that the mountains shall drop down new wine and the hills shall flow with milk and all the rivers of Judah, most of which were dry except during the rainy season;

— shall flow with waters, and a fountain shall come forth of the house of the Lord and shall water the Valley of Shittim, otherwise an arid desert and bringing fertility even to the unfruitful places of the earth, to the hearts of unbelievers and all other nations everywhere.

19 Egypt shall be a desolation, and Edom shall be a desolate wilderness, for the violence against the children of Judah, because they have shed innocent blood in their land.

— Egypt shall be a desolation and Edom shall be a desolate wilderness, these two being representative of the Lord’s enemies, for the violence against the children of Judah and Israel, the representatives of the Lord’s Chosen because they have shed innocent blood in their land.

20 “But Judah shall dwell for ever, and Jerusalem from generation to generation.

21 For I will cleanse their blood that I have not cleansed, for the Lord dwelleth in Zion.”

— for the Lord will cleanse their blood that he has not cleansed before, namely, through the atonement wrought by the Messiah; for the Lord dwelleth in Zion. The entire description clearly does not speak of a mere earthly, temporal glorification of Jerusalem and a corresponding desolation of Egypt and Edom;

— but the latter are types of the powers opposing the Kingdom of God and is setting forth the blessings which the work of the Church is bringing to men on the basis of the redemption brought about by the Messiah. Cf Revelation 22:2. The Lord is dwelling in the midst of his Kingdom and revealing himself as the King of all people, partly by the destruction of his enemies, partly by the perfection of his Kingdom.

Dark Days Ahead: John Mearsheimer

•July 3, 2023 • Leave a Comment

Darkness Lays Ahead for the United States: Where The Ukraine War Is Headed

“And He shall be for you a sanctuary, but for a stone of stumbling and for a rock of offense to both the houses of Israel, for a trap and for a snare to the inhabitants of Jerusalem” Isaiah 8:14

John’s Substack by John Mearsheimer • June 24, 2023

This paper examines the likely trajectory of the Ukraine war moving forward.

I will address two main questions.

First, is a meaningful peace agreement possible? My answer is no. We are now in a war where both sides – Ukraine and the West on one side and Russia on the other – see each other as an existential threat that must be defeated. Given maximalist objectives all around, it is almost impossible to reach a workable peace treaty. Moreover, the two sides have irreconcilable differences regarding territory and Ukraine’s relationship with the West. The best possible outcome is a frozen conflict that could easily turn back into a hot war. The worst possible outcome is a nuclear war, which is unlikely but cannot be ruled out.  

Second, which side is likely to win the war? Russia will ultimately win the war, although it will not decisively defeat Ukraine. In other words, it is not going to conquer all of Ukraine, which is necessary to achieve three of Moscow’s goals: overthrowing the regime, demilitarizing the country, and severing Kyiv’s security ties with the West. But it will end up annexing a large swath of Ukrainian territory, while turning Ukraine into a dysfunctional rump state. In other words, Russia will win an ugly victory.

Before I directly address these issues, three preliminary points are in order. For starters, I am attempting to predict the future, which is not easy to do, given that we live in an uncertain world. Thus, I am not arguing that I have the truth; in fact, some of my claims may be proved wrong. Furthermore, I am not saying what I would like to see happen. I am not rooting for one side or the other. I am simply telling you what I think will happen as the war moves forward. Finally, I am not justifying Russian behavior or the actions of any of the states involved in the conflict. I am just explaining their actions.

Now, let me turn to substance.

Where We Are Today

To understand where the Ukraine war is headed, it is necessary to first assess the present situation. It is important to know how the three main actors – Russia, Ukraine, and the West – think about their threat environment and conceive their goals. When we talk about the West, however, we are talking mainly about the United States, since its European allies take their marching orders from Washington when it comes to Ukraine. It is also essential to understand the present situation on the battlefield. Let me start with Russia’s threat environment and its goals.

Russia’s Threat Environment

It has been clear since April 2008 that Russian leaders across the board view the West’s efforts to bring Ukraine into NATO and make it a Western bulwark on Russia’s borders as an existential threat. Indeed, President Putin and his lieutenants repeatedly made this point in the months before the Russian invasion, when it was becoming clear to them that Ukraine was almost a de facto member of NATO.

Since the war began on 24 February 2022, the West has added another layer to that existential threat by adopting a new set of goals that Russian leaders cannot help but view as extremely threatening. I will say more about Western goals below but suffice it to say here that the West is determined to defeat Russia and knock it out of the ranks of the great powers, if not cause regime change or even trigger Russia to break apart like the Soviet Union did in 1991.

And many among them shall stumble and fall and be broken, and be snared and be taken” Isaiah 8:15

In a major address Putin delivered this past February (2023), he stressed that the West is a mortal threat to Russia. “During the years that followed the breakup of the Soviet Union,” he said, “the West never stopped trying to set the post-Soviet states on fire and, most importantly, finish off Russia as the largest surviving portion of the historical reaches of our state. They encouraged international terrorists to assault us, provoked regional conflicts along the perimeter of our borders, ignored our interests and tried to contain and suppress our economy.” He further emphasized that, “The Western elite make no secret of their goal, which is, I quote, ‘Russia’s strategic defeat.’ What does this mean to us? This means they plan to finish us once and for all.” Putin went on to say: “this represents an existential threat to our country.”

Russian leaders also see the regime in Kyiv as a threat to Russia, not just because it is closely allied with the West, but also because they see it as the offspring of the fascist Ukrainian forces that fought alongside Nazi Germany against the Soviet Union in World War II.

Russia’s Goals

Russia must win this war, given that it believes that it is facing a threat to its survival. But what does victory look like? The ideal outcome before the war began in February 2022 was to turn Ukraine into a neutral state and settle the civil war in the Donbass that pitted the Ukrainian government against ethnic Russians and Russian speakers who wanted greater autonomy if not independence for their region. It appears that those goals were still realistic during the first month of the war and were in fact the basis of the negotiations in Istanbul between Kyiv and Moscow in March 2022.

If the Russians had achieved those goals back then, the present war would either have been prevented or ended quickly.

But a deal that satisfies Russia’s goals is no longer in the cards. Ukraine and NATO are joined at the hip for the foreseeable future, and neither is willing to accept Ukrainian neutrality. Furthermore, the regime in Kyiv is anathema to Russian leaders, who want it gone. They not only talk about “de-Nazifying” Ukraine, but also “demilitarizing” it, two goals that would presumably call for conquering all of Ukraine, compelling its military forces to surrender, and installing a friendly regime in Kyiv.

A decisive victory of that sort is not likely to happen for a variety of reasons. The Russian army is not large enough for such a  task, which would probably require at least two million men.

Indeed, the existing Russian army is having difficulty conquering all the Donbass. Moreover, the West would go to enormous lengths to prevent Russia from overrunning all of Ukraine. Finally, the Russians would end up occupying huge amounts of territory that is heavily populated with ethnic Ukrainians who loathe the Russians and would fiercely resist the occupation. Trying to conquer all of Ukraine and bend it to Moscow’s will, would surely end in disaster.

Rhetoric about de-Nazifying and demilitarizing Ukraine aside, Russia’s concrete goals involve conquering and annexing a large portion of Ukrainian territory, while simultaneously turning Ukraine into a dysfunctional rump state. As such, Ukraine’s ability to wage war against Russia would be greatly reduced and it would be unlikely to qualify for membership in either the EU or NATO. Moreover, a broken Ukraine, would be especially vulnerable to Russian interference in its domestic politics. In short, Ukraine would not be a Western bastion on Russia’s border.

What would that dysfunctional rump state look like? Moscow has officially annexed Crimea and four other Ukrainian oblasts – Donetsk, Kherson, Luhansk, and Zaporozhe – which together represent about 23 percent of Ukraine’s total territory before the crisis broke out in February 2014. Russian leaders have emphasized that they have no intention of surrendering that territory, some of which Russia does not yet control. In fact, there is reason to think Russia will annex additional Ukrainian territory if it has the military capability to do so at a reasonable cost. It is difficult, however, to say how much additional Ukrainian territory Moscow will seek to annex, as Putin himself makes clear.

Russian thinking is likely to be influenced by three calculations. Moscow has a powerful incentive to conquer and permanently annex Ukrainian territory that is heavily populated with ethnic Russians and Russian speakers. It will want to protect them from the Ukrainian government – which has become hostile to all things Russian – and make sure there is no civil war anywhere in Ukraine like the one that took place in the Donbass between February 2014 and February 2022. At the same time, Russia will want to avoid controlling territory largely populated by hostile ethnic Ukrainians, which places significant limits on further Russian expansion. Finally, turning Ukraine into a dysfunctional rump state will require Moscow to take substantial amounts of Ukrainian territory so it is well-positioned to do significant damage to its economy. Controlling all of Ukraine’s coastline along the Black Sea, for example, would give Moscow significant economic leverage over Kyiv.

“Fear and the pit and the snare are upon thee, O inhabitant of the earth” Isaiah 24:17

Dmitri Trenin, a leading Russian strategist estimates that Russian leaders would seek to take even more Ukrainian territory – pushing westward in northern Ukraine to the Dnieper River and taking the part of Kyiv that sits on the east bank of that river. He writes that “A logical next step” after taking all of Ukraine from Kharkiv to Odessa “would be to expand Russian control to all of Ukraine east of the Dnieper River, including the part of Kyiv that lies on the that river’s eastern bank. If that were to happen, the Ukrainian state would shrink to include only the central and western regions of the country.”

The West’s Threat Environment

It might seem hard to believe now, but before the Ukraine crisis broke out in February 2014, Western leaders did not view Russia as a security threat. NATO leaders, for example, were talking with Russia’s president about “a new stage of cooperation towards a true strategic partnership” at the alliance’s 2010 Summit in Lisbon.

Those three calculations suggest that Russia is likely to attempt to annex the four oblasts – Dnipropetrovsk, Kharkiv, Mykolaiv, and Odessa – that are immediately to the west of the four oblasts it has already annexed – Donetsk, Kherson, Luhansk, and Zaporozhe. If that were to happen, Russia would control approximately 43 percent of Ukraine’s pre-2014 territory.

Unsurprisingly, NATO expansion before 2014 was not justified in terms of containing a dangerous Russia. In fact, it was Russian weakness that allowed the West to shove the first two tranches of NATO expansion in 1999 and 2004 down Moscow’s throat and then allowed the George W. Bush administration to think in 2008 that Russia could be forced to accept Georgia and Ukraine joining the alliance. But that assumption proved wrong and when the Ukraine crisis broke out in 2014, the West suddenly began portraying Russia as a dangerous foe that had to be contained if not weakened.

Since the war started in February 2022, the West’s perception of Russia has steadily escalated to the point where Moscow now appears to be seen as an existential threat. The United States and its NATO allies are deeply involved in Ukraine’s war against Russia. Indeed, they are doing everything but pulling the triggers and pushing the buttons.

Moreover, they have made clear their unequivocal commitment to winning the war and maintaining Ukraine’s sovereignty. Thus, losing the war would have hugely negative consequences for Washington and for NATO. America’s reputation for competence and reliability would be badly damaged, which would affect how its allies as well as its adversaries – especially China – deal with the United States. Furthermore, virtually every European country in NATO believes that the alliance is an irreplaceable security umbrella. Thus, the possibility that NATO might be badly damaged – maybe even wrecked – if Russia wins in Ukraine is cause for profound concern among its members.

In addition, Western leaders frequently portray the Ukraine war as an integral part of a larger global struggle between autocracy and democracy that is Manichean at its core. On top of that, the future of the sacrosanct rules-based international order is said to depend on prevailing against Russia. As King Charles said this past March (2023), “The security of Europe as well as our democratic values are under threat.”

Similarly, a resolution introduced in the US Congress in April declares: “United States interests, European security, and the cause of international peace depend on … Ukrainian victory.”

A recent article in The Washington Post, captures how the West treats Russia as an existential threat: “Leaders of the more than 50 other countries backing Ukraine have couched their support as part of an apocalyptic battle for the future of democracy and the international rule of law against autocracy and aggression that the West cannot afford to lose.”

The West’s Goals

As should be clear, the West is staunchly committed to defeating Russia. President Biden has repeatedly said that the United States is in this war to win. “Ukraine will never be a victory for Russia.” It must end in “strategic failure.” Washington, he emphasizes, will stay in the fight “for as long as it takes.”

Specifically, the aim is to defeat Russia’s army in Ukraine – erasing its territorial gains – and cripple its economy with lethal sanctions. If successful, Russia would be knocked out of the ranks of the great powers, weakening it to the point where it could not threaten to invade Ukraine again.

“And it shall come to pass that he who fleeth from the noise of the fear shall fall into the pit, and he that cometh up out of the midst of the pit shall be taken in the snare; for the windows from on high are open, and the foundations of the earth do shake” Isaiah 24:18

Western leaders have additional goals, which include regime change in Moscow, putting Putin on trial as a war criminal, and possibly breaking up Russia into smaller states.

At the same time, the West remains committed to bringing Ukraine into NATO, although there is disagreement within the alliance about when and how that will happen.

Jens Stoltenberg, the alliance’s secretary general told a news conference in Kyiv in April (2023) that “NATO’s position remains unchanged and that Ukraine will become a member of the alliance.” At the same time, he emphasized that “The first step toward any membership of Ukraine to NATO is to ensure that Ukraine prevails, and that is why the US and its partners have provided unprecedented support for Ukraine.” Given these goals, it is clear why Russia views the West as an existential threat.

Ukraine’s Threat Environment and Goals

There is no doubt that Ukraine faces an existential threat, given that Russia is bent on dismembering it and making sure that the surviving rump state is not only economically weak, but is neither a de facto nor a de jure member of NATO. There is also no question that Kyiv shares the West’s goal of defeating and seriously weakening Russia, so that it can regain its lost territory and keep it under Ukrainian control forever. As President Zelensky recently told President Xi Jinping, “There can be no peace that is based on territorial compromises.”

Ukrainian leaders naturally remain steadfastly committed to joining the EU and NATO and making Ukraine an integral part of the West.

In sum, the three key actors in the Ukraine war all believe they face an existential threat, which means each of them thinks it must win the war or else suffer terrible consequences.

The Battlefield Today

Turning to events on the battlefield, the war has evolved into war of attrition where each side is principally concerned with bleeding the other side white, causing it to surrender. Of course, both sides are also concerned with capturing territory, but that goal is of secondary importance to wearing down the other side.

The Ukrainian military had the upper hand in the latter half of 2022, which allowed it to take back territory from Russia in the Kharkiv and Kherson regions. But Russia responded to those defeats by mobilizing 300,000 additional troops, reorganizing it army, shortening its front lines, and learning from its mistakes.

The locus of the fighting in 2023 has been in eastern Ukraine, mainly in the Donetsk and Zaporozhe regions. The Russians have had the upper hand this year, mainly because they have a substantial advantage in artillery, which is the most important weapon in attrition warfare.

Moscow’s advantage was evident in the battle for Bakhmut, which ended when the Russians captured that city in late May (2023). Although it took Russian forces ten months to take control of Bakhmut they inflicted huge casualties on Ukrainian forces with their artillery.

“But the word of the Lord was unto them precept upon precept, precept upon precept, line upon line, line upon line, here a little and there a little, that they might go, and fall backward, and be broken and snared and taken Isaiah” 28:13

Shortly thereafter on 4 June, Ukraine launched its long-awaited counter-offensive at different locations in the Donetsk and Zaporozhe regions. The aim is to penetrate Russia’s front lines of defense, deliver a staggering blow to Russian forces, and take back a substantial amount of Ukrainian territory that is now under Russian control. In essence, the aim is to duplicate Ukraine’s successes in Kharkiv and Kherson in 2022.

Ukraine’s army has made little progress so far in achieving those goals and instead is bogged down in deadly attrition battles with Russian forces. In 2022, Ukraine was successful in the Kharkiv and Kherson campaigns because its army was  fighting against outnumbered and overextended Russian forces. That is not the case today: Ukraine is attacking into the face of well-prepared lines of Russian defense. But even if Ukrainian forces break through those defensive lines, Russian troops will quickly stabilize the front and the attrition battles will continue.

The Ukrainians are at a disadvantage in these encounters because the Russians have a significant firepower advantage.

Where We Are Headed

Let me switch gears and move away from the present and talk about the future, starting with how events on the battlefield are likely to play out moving forward. As noted, I believe Russia will win the war, which means it will end up conquering and annexing substantial Ukrainian territory, leaving Ukraine as a dysfunctional rump state. If I am correct, this will be a grievous defeat for Ukraine and the West.

There is a silver lining in this outcome, however: a Russian victory markedly reduces the threat of nuclear war, as nuclear escalation is most likely to occur if Ukrainian forces are winning victories on the battlefield and threatening to take back all or most of the territories Kyiv has lost to Moscow. Russian leaders would surely think seriously about using nuclear weapons to rescue the situation. Of course, if I am wrong about where the war is headed and the Ukrainian military gains the upper hand and begins pushing Russian forces eastward, the likelihood of nuclear use would increase significantly, which is not to say it would be a certainty.

What is the basis of my claim that the Russians are likely to win the war?

The Ukraine war, as emphasized, is a war of attrition in which capturing and holding territory is of secondary importance. The aim in attrition warfare is to wear down the other side’s forces to the point where it either quits the fight or is so weakened that it can no longer defend contested territory.

Who wins an attrition war is largely a function of three factors: the balance of resolve between the two sides; the population balance between them; and the casualty-exchange ratio. The Russians have a decisive advantage in population size and a marked advantage in the casualty-exchange ratio; the two sides are evenly matched in terms of resolve.

“who make a man an offender for a word, and lay a snare for him that reproveth in the gate, and turn aside the just for a thing of nought” Isaiah 29:21

Consider the balance of resolve. As noted, both Russia and Ukraine believe they are facing an existential threat, and naturally, both sides are fully committed to winning the war. Thus, it is hard to see any meaningful difference in their resolve. Regarding population size, Russia had approximately a 3.5:1 advantage before the war began in February 2022. Since then, the ratio has shifted noticeably in Russia’s favor. About eight million Ukrainians have fled the country, subtracting from Ukraine’s population. Roughly three million of those emigrants have gone to Russia, adding to its population. In addition, there are probably about four million other Ukrainian citizens living in the territories that Russia now controls, further shifting the population imbalance in Russia’s favor. Putting those numbers together gives Russia approximately a 5:1 advantage in population size.

Finally, there is the casualty-exchange ratio, which has been a controversial issue since the war started in February 2022. The conventional wisdom in Ukraine and the West is that the casualty levels on both sides are either roughly equal or that the Russians have suffered greater casualties than the Ukrainians. The head of Ukraine’s National Security and Defense Council, Oleksiy Danilov, goes so far as to argue that the Russian lost 7.5 soldiers for every one Ukrainian soldier in the battle for Bakhmut.

These claims are wrong. Ukrainian forces have surely suffered much greater casualties than their Russian opponents for one reason: Russia has much more artillery than Ukraine.

In attrition warfare, artillery is the most important weapon on the battlefield. In the US Army, artillery is widely known as the “king of battle,” because it is principally responsible for killing and wounding the soldiers doing the fighting.

Thus, the balance of artillery matters enormously in a war of attrition. By almost every account, the Russians have somewhere between a 5:1 and a 10:1 advantage in artillery, which puts the Ukrainian army at a significant disadvantage on the battlefield.

Ceteris paribus, one would expect the casualty-exchange ratio to approximate the balance of artillery. Ergo, a casualty-exchange ratio on the order of 2:1 in Russia’s favor is a conservative estimate.

One possible challenge to my analysis is to argue that Russia is the aggressor in this war, and the offender invariably suffers much higher casualty levels than the defender, especially if the attacking forces are engaged in broad frontal assaults, which is often said to be the Russian military’s modus operandi.

After all, the offender is out in the open and on the move, while the defender is mainly fighting from fixed positions that provide substantial cover. This logic underpins the famous 3:1 rule of thumb, which says that an attacking force needs at least three times as many soldiers as the defender to win a battle.

But there are problems with this line of argument when it is applied to the Ukraine war.

First, it is not just the Russians who have initiated offensive campaigns over the course of the war.

Indeed, the Ukrainians launched two major offensives last year that led to widely heralded victories: the Kharkiv offensive in September 2022 and the Kherson offensive between August and November 2022. Although the Ukrainians made substantial territorial gains in both campaigns, Russian artillery inflicted heavy casualties on the attacking forces. The Ukrainians just began another major offensive on 4 June against Russian forces that are more numerous and far better prepared than those the Ukrainians fought against in Kharkiv and Kherson.

Second, the distinction between offenders and defenders in a major battle is usually not black and white. When one army attacks another army, the defender invariably launches counterattacks. In other words, the defender transitions to the offense and the offender transitions to the defense. Over the course of a protracted battle, each side is likely to end up doing much attacking and counterattacking as well as defending fixed positions. This back and forth explains why the casualty-exchange ratios in US Civil War battles and WWI battles are often roughly equal, not favorable to the army that started out on the defensive. In fact, the army that strikes the first blow occasionally suffers less casualties than the target army.

In short, defense usually involves a lot of offense.

It is clear from Ukrainian and Western news accounts that Ukrainian forces frequently launch counterattacks against Russian forces. Consider this account in The Washington Post of the fighting earlier this year in Bakhmut: “‘There is this fluid motion going on,’ said a Ukrainian first lieutenant … Russian attacks along the front allow their forces to advance a few hundred meters before being pushed back hours later. ‘It’s hard to distinguish exactly where the front line is because it moves like Jell-O,’ he said.”

Given Russia’s massive artillery advantage, it seems reasonable to assume that the casualty-exchange ratio in these Ukrainian counterattacks favors the Russians – probably in a lopsided way.

Third, the Russians are not employing – at least not often – large-scale frontal assaults that aim to rapidly move forward and capture territory, but which would expose the attacking forces to withering fire from Ukrainian defenders. As General Sergey Surovikin explained in October 2022, when he was commanding the Russian forces in Ukraine, “We have a different strategy… We spare each soldier and are persistently grinding down the advancing enemy.”

“But this is a people robbed and spoiled; they are all of them snared in holes, and they are hid in prison houses. They are for a prey, and none delivereth; for a spoil, and none saith, “Restore”” Isaiah 42:22

In effect, Russian troops have adopted clever tactics that reduce their casualty levels.

Their favored tactic is to launch probing attacks against fixed Ukrainian positions with small infantry units, which causes Ukrainian forces to attack them with mortars and artillery.

That response allows the Russians to determine where the Ukrainian defenders and their artillery are located. The Russians then use their great advantage in artillery to pound their adversaries. Afterwards, packets of Russian infantry move forward again; and when they meet serious Ukrainian resistance, they repeat the process. These tactics help explain why Russia is making slow progress in capturing Ukrainian held territory.

One might think the West can go a long way toward evening out the casualty-exchange ratio by supplying Ukraine with many more artillery tubes and shells, thus eliminating Russia’s significant advantage with this critically important weapon. That is not going to happen anytime soon, however, simply because neither the United States nor its allies have the industrial capacity necessary to mass produce artillery tubes and shells for Ukraine. Nor can they rapidly build that capacity.

The best the West can do – at least for the next year or so – is maintain the existing imbalance of artillery between Russia and Ukraine, but even that will be a difficult task.

Ukraine can do little to help remedy the problem, because its ability to manufacture weapons is limited. It is almost completely dependent on the West, not only for artillery, but for every type of major weapons system. Russia, on the other hand, had a formidable capability to manufacture weaponry going into the war, which has been ramped up since the fighting started. Putin recently said: “Our defense industry is gaining momentum every day. We have increased military production by 2.7 times during the last year. Our production of the most critical weapons has gone up ten times and keeps increasing. Plants are working in two or three shifts, and some are busy around the clock.”

In short, given the sad state of Ukraine’s industrial base, it is in no position to wage a war of attrition by itself. It can only do so with Western backing. But even then, it is doomed to lose.

There has been a recent development that further increases Russia’s firepower advantage over Ukraine. For the first year of the war, Russian airpower had little influence on what happened in the ground war, mainly because Ukraine’s air defenses were effective enough to keep Russian aircraft far away from most battlefields. But the Russians have seriously weakened Ukraine’s air defenses, which now allows the Russian air force to strike Ukrainian ground forces on or directly behind the front lines.

In addition, Russia has developed the capability to equip its huge arsenal of 500 kg iron bombs with guidance kits that make them especially lethal.

In sum, the casualty-exchange ratio will continue to favor the Russians for the foreseeable future, which matters enormously in a war of attrition. In addition, Russia is much better positioned to wage attrition warfare because its population is far larger than Ukraine’s. Kyiv’s only hope for winning the war is for Moscow’s resolve to collapse, but that is unlikely given that Russian leaders view the West as an existential danger.

Prospects for A Negotiated Peace Agreement

There is a growing chorus of voices around the world calling for all sides in the Ukrainian war to embrace diplomacy and negotiate a lasting peace agreement. This is not going to happen, however. There are too many formidable obstacles to ending the war anytime soon, much less fashioning a deal that produces a durable peace. The best possible outcome is a frozen conflict, where both sides continue looking for opportunities to weaken the other side and where there is an ever-present danger of renewed fighting.

At the most general level, peace is not possible because each side views the other as a mortal threat that must be defeated on the battlefield. There is hardly any room for compromise with the other side in these circumstances. There are also two specific points of dispute between the warring parties that are unsolvable. One involves territory while the other concerns Ukrainian neutrality.

Almost all Ukrainians are deeply committed to getting back all their lost territory – including Crimea.

Who can blame them? But Russia has officially annexed Crimea, Donetsk, Kherson, Luhansk, and Zaporozhe, and is firmly committed to keeping that territory. In fact, there is reason to think Moscow will annex more Ukrainian territory if it can.

The other Gordian knot concerns Ukraine’s relationship with the West. For understandable reasons, Ukraine wants a security guarantee once the war ends, which only the West can provide. That means either de facto or de jure membership in NATO, since no other countries can protect Ukraine. Virtually all Russian leaders, however, demand a neutral Ukraine, which means no military ties with the West and thus no security umbrella for Kyiv. There is no way to square this circle.

There are two other obstacles to peace: nationalism, which has now morphed into hypernationalism, and the complete lack of trust on the Russian side.

Nationalism has been a powerful force in Ukraine for well over a century, and antagonism toward Russia has long been one of its core elements. The outbreak of the present conflict on 22 February 2014 fueled that hostility, prompting the Ukrainian parliament to pass a bill the following day that restricted the use of Russian and other minority languages, a move that helped precipitate the civil war in the Donbass.

Russia’s annexation of Crimea shortly thereafter made a bad situation worse. Contrary to the conventional wisdom in the West, Putin understood that Ukraine was a separate nation from Russia and that the conflict between the ethnic Russians and Russian-speakers living in the Donbass and the Ukrainian government was all about “the national question.”

The Russian invasion of Ukraine, which directly pits the two countries against each other in a protracted and bloody war has turned that nationalism into hypernationalism on both sides. Contempt and hatred of “the other” suffuses Russian and Ukrainian society, which creates powerful incentives to eliminate that threat – with violence if necessary. Examples abound. A prominent Kyiv weekly maintains that famous Russian authors like Mikhail Lermontov, Fyodor Dostoyevsky, Leo Tolstoy, and Boris Pasternak are “killers, looters, ignoramuses.”

Russian culture, says a prominent Ukrainian writer, represents “barbarism, murder, and destruction …. Such is the fate of the culture of the enemy.”

Predictably, the Ukrainian government is engaged in “de-Russification” or “decolonization,” which involves purging libraries of books by Russian authors, renaming streets that have names with links to Russia, pulling down statues of figures like Catherine the Great, banning Russian music produced after 1991, breaking ties between the Ukrainian Orthodox Church and the Russian Orthodox Church, and minimizing use of the Russian language. Perhaps Ukraine’s attitude toward Russia is best summed up by Zelensky’s terse comment: “We will not forgive. We will not forget.”

Turning to the Russian side of the hill, Anatol Lieven reports that “every day on Russian TV you can see hate-filled ethnic insults directed at Ukrainians.”

Unsurprisingly, the Russians are working to Russify and erase Ukrainian culture in the areas that Moscow has annexed. These measures include issuing Russian passports, changing the curricula in schools, replacing the Ukrainian hryvnia with the Russian ruble, targeting libraries and museums, and renaming towns and cities.

Bakhmut, for example, is now Artemovsk and the Ukrainian language is no longer taught in schools in the Donetsk region.

Apparently, the Russians too will neither forgive nor forget.

The rise of hypernationalism is predictable in wartime, not only because governments rely heavily on nationalism to motivate their people to back their country to the hilt, but also because the death and destruction that come with war – especially protracted wars – pushes each side to dehumanize and hate the other. In the Ukraine case, the bitter conflict over national identity adds fuel to the fire.

Hypernationalism naturally makes it harder for each side to cooperate with the other and gives Russia reason to seize territory that is filled with ethnic Russians and Russian speakers. Presumably, many of them would prefer living under Russian control, given the animosity of the Ukrainian government toward all things Russian. In the process of annexing these lands, the Russians are likely to expel large numbers of ethnic Ukrainians, mainly because of fear that they will rebel against Russian rule if they remain. These developments will further fuel hatred between Russians and Ukrainians, making compromise over territory practically impossible.

There is a final reason why a lasting peace agreement is not doable. Russian leaders do not trust either Ukraine or the West to negotiate in good faith, which is not to imply that Ukrainian and Western leaders trust their Russian counterparts. Lack of trust is evident on all sides, but it is especially acute on Moscow’s part because of a recent set of revelations.

The source of the problem is what happened in the negotiations over the 2015 Minsk II Agreement, which was a framework for shutting down the conflict in the Donbass. French President Francois Hollande and German Chancellor Angela Merkel played the central role is designing that framework, although they consulted extensively with both Putin and Ukrainian President Petro Poroshenko. Those four individuals were also the key players in the subsequent negotiations. There is little doubt that Putin was committed to making Minsk work. But Hollande, Merkel, and Poroshenko – as well as Zelensky – have all made it clear that they were not interested in implementing Minsk, but instead saw it as an opportunity to buy time for Ukraine to build up its military so that it could deal with the insurrection in the Donbass. As Merkel told Die Zeit, it was “an attempt to give Ukraine time … to become stronger.”

Similarly, Poroshenko said, “Our goal was to, first, stop the threat, or at least to delay the war — to secure eight years to restore economic growth and create powerful armed forces.”

Shortly after Merkel’s Die Zeit interview in December 2022, Putin told a press conference: “I thought the other participants of this agreement were at least honest, but no, it turns out they were also lying to us and only wanted to pump Ukraine with weapons and get it prepared for a military conflict.” He went on to say that getting bamboozled by the West had caused him to pass up an opportunity to solve the Ukraine problem in more favorable circumstances for Russia: “Apparently, we got our bearings too late, to be honest. Maybe we should have started all this [the military operation] earlier, but we just hoped that we would be able to solve it within the framework of the Minsk agreements.” He then made it clear that the West’s duplicity would complicate future negotiations: “Trust is already almost at zero, but after such statements, how can we possibly negotiate? About what? Can we make any agreements with anybody and where are the guarantees?”

In sum, there is hardly any chance the Ukraine war will end with a meaningful peace settlement. The war is instead likely to drag on for at least another year and eventually turn into a frozen conflict that might turn back into a shooting war.

Consequences

The absence of a viable peace agreement will have a variety of terrible consequences. Relations between Russia and the West, for example, are likely to remain profoundly hostile and dangerous for the foreseeable future. Each side will continue demonizing the other while working hard to maximize the amount of pain and trouble it causes its rival. This situation will certainly prevail if the fighting continues; but even if the war turns into a frozen conflict, the level of hostility between the two sides is unlikely to change much.

Moscow will seek to exploit existing fissures between European countries, while also working to weaken the trans-Atlantic relationship as well as key European institutions like the EU and NATO. Given the damage the war has done to Europe’s economy and continues to do, given the growing disenchantment in Europe with the prospect of a never-ending war in Ukraine, and given the differences between Europe and the United States regarding trade with China, Russian leaders should find fertile ground for causing trouble in the West.

This meddling will naturally reinforce Russophobia in Europe and the United States, making a bad situation worse.

The West, for its part, will maintain sanctions on Moscow and keep economic intercourse between the two sides to a minimum, all for the purpose of harming Russia’s economy. Moreover, it will surely work with Ukraine to help generate insurgencies in the territories Russia took from Ukraine. At the same time, the United States and its allies will continue pursuing a hard-nosed containment policy toward Russia, which many believe will be enhanced by Finland and Sweden joining NATO and the deployment of significant NATO forces in eastern Europe.

Of course, the West will remain committed to bringing Georgia and Ukraine into NATO, even if that is unlikely to happen. Finally, US and European elites are sure to retain their enthusiasm for fostering regime change in Moscow and putting Putin on trial for Russia’s actions in Ukraine.

Not only will relations between Russia and the West remain poisonous moving forward, but they will also be dangerous, as there will be the ever-present possibility of nuclear escalation or a great-power war between Russia and the United States.

The Destruction of Ukraine

Ukraine was in severe economic and demographic trouble before the war began last year.

The devastation inflicted on Ukraine since the Russian invasion is horrific. Surveying events during the war’s first year, the World Bank declares that the invasion “has dealt an unimaginable toll on the people of Ukraine and the country’s economy, with activity contracting by a staggering 29.2 percent in 2022.” Unsurprisingly, Kyiv needs massive injections of foreign aid just to keep the government running, not to mention fighting the war. Furthermore, the World Bank estimates that damages exceed $135 billion and that roughly $411 billion will be needed to rebuild Ukraine. Poverty, it reports, “increased from 5.5 percent in 2021 to 24.1 percent in 2022, pushing 7.1 million more people into poverty and retracting 15 years of progress.”

Cities have been destroyed, roughly 8 million Ukrainians have fled the country, and about 7 million are internally displaced. The United Nations has confirmed 8,490 civilian deaths, although it believes that the actual number is “considerably higher.”

And surely Ukraine has suffered well over 100,000 battlefield casualties.

Ukraine’s future looks bleak in the extreme. The war shows no signs of ending anytime soon, which means more destruction of infrastructure and housing, more destruction of towns and cities, more civilian and military deaths, and more damage to the economy. And not only is Ukraine likely to lose even more territory to Russia, but according to the European Commission, “the war has set Ukraine on a path of irreversible demographic decline.”

To make matters worse, the Russians will work overtime to keep rump Ukraine economically weak and politically unstable. The ongoing conflict is also likely to fuel corruption, which has long been an acute problem, and further strengthen extremist groups in Ukraine. It is hard to imagine Kyiv ever meeting the criteria necessary for joining either the EU or NATO.

US Policy toward China

The Ukraine war is hindering the US effort to contain China, which is of paramount importance for American security since China is a peer competitor while Russia is not.

Indeed, balance-of-power logic says that the United States should be allied with Russia against China and pivoting full force to East Asia. Instead, the war in Ukraine has pushed Beijing and Moscow close together, while providing China with a powerful incentive to make sure that Russia is not defeated and the United States remains tied down in Europe, impeding its efforts to pivot to East Asia.

Conclusion

It should be apparent by now that the Ukraine war is an enormous disaster that is unlikely to end anytime soon and when it does, the result will not be a lasting peace. A few words are in order about how the West ended up in this dreadful situation.

The conventional wisdom about the war’s origins is that Putin launched an unprovoked attack on 24 February 2022, which was motivated by his grand plan to create a greater Russia. Ukraine, it is said, was the first country he intended to conquer and annex, but not the last. As I have said on numerous occasions, there is no evidence to support this line of argument, and indeed there is considerable evidence that directly contradicts it.

While there is no question Russia invaded Ukraine, the ultimate cause of the war was the West’s decision – and here we are talking mainly about the United States – to make Ukraine a Western bulwark on Russia’s border. The key element in that strategy was bringing Ukraine into NATO, a move that not only Putin, but the entire Russian foreign policy establishment, saw as an existential threat that had to be eliminated.

It is often forgotten that numerous American and European policymakers and strategists opposed NATO expansion from the start because they understood that the Russians would see it as a threat, and that the policy would eventually lead to disaster. The list of opponents includes George Kennan, both President Clinton’s Secretary of Defense, William Perry, and his Chairman of the Joint Chiefs of Staff, General John Shalikashvili, Paul Nitze, Robert Gates, Robert McNamara, Richard Pipes, and Jack Matlock, just to name a few.

At the NATO summit in Bucharest In April 2008, both French President Nicolas Sarkozy and German Chancellor Angela Merkel opposed President George W. Bush’s plan to bring Ukraine into the alliance. Merkel later said that her opposition was based on her belief that Putin would interpret it as a “declaration of war.”

Of course, the opponents of NATO expansion were correct, but they lost the fight and NATO marched eastward, which eventually provoked the Russians to launch a preventive war. Had the United States and its allies not moved to bring Ukraine into NATO in April 2008, or had they been willing to accommodate Moscow’s security concerns after the Ukraine crisis broke out in February 2014, there probably would be no war in Ukraine today and its borders would look like they did when it gained its independence in 1991. The West made a colossal blunder, which it and many others are not done paying for.

Ephraim also is like a silly dove without heart; they call to Egypt, they go to Assyria” Hosea 7:11

“And I will show wonders in the heavens and in the earth—blood and fire and columns (pillars) of smoke” Joel 2:30

“For the day of the Lord is near upon all the nations. As you have done, it shall be done to you; your dealings will return upon your own head” Obadiah 1:15

Haggai (Ch 1-2)

•July 3, 2023 • Leave a Comment

Haggai, Zechariah and Malachi were among the last of the prophets; but Haggai’s prophecy about Zerubbabel the governor of Judah and Joshua the high priest set the intriguing scenes of a prophetic endtime.

The hand of Zerubbabel with those seven eyes of the Lord which are also the seven spirits of God, sent forth to and fro into all the earth; only a Divine Being could have seven eyes or seven spirits of the Lord which run to and fro through the whole earth; thus the Scriptures testify that Zerubbabel is the Son of God, the Messiah.

Haggai 1

1 In the second year of Darius the king, in the sixth month, on the first day of the month, came the word of the Lord by Haggai the prophet unto Zerubbabel the son of Shealtiel, governor of Judah, and to Joshua the son of Jehozadak, the high priest, saying,

— in the second year of Darius, king of Persia, the year 520 BC in the first day of the sixth month, a feast of the new moon, the month Elul, that is, of the Jewish Sacred year, came the word of the Lord to Haggai, the prophet unto Zerubbabel the governor, and to Joshua the high priest, Cf Ezra 3:2, saying,

— today, we have repudiated God’s way of numbering months that he has given us but adopted a system to honor the host of heaven with a pagan-named week and a paganised monthly calendar; hence we have Covid and yet not realizing what is happening (more at the end);

— the Targum of Zephaniah 2:3 says, “seek the fear of the Lord, all ye meek of the earth, who do the judgements of his will; seek truth, seek meekness; it may be there will be a protection for you on the day of the Lord’s anger.”

2 “Thus speaketh the Lord of hosts, saying: This people say, ‘The time has not come, the time that the Lord’S house should be built.’”

— thus speaketh the Lord of hosts, saying, This people say, ‘The time is not come, the time that the Lord’s house should be built,’ it was not a time fit and convenient to carry on such a building effort; that being showing their ingratitude and the lame excuse with which the people tried to cover their indifference for they had allowed themselves to drift along.

3 Then came the word of the Lord by Haggai the prophet, saying,

4 “Is it time for you, O ye, to dwell in your ceilinged houses, and this house lie waste?” — Is It time for you, O ye, to dwell in your panelled houses, for yourselves to dwell in the most expensive manner, showing that they lived not only in comfort, but in luxury,

— and this house of God to lie in waste? since it had never gotten beyond the foundations, only the altar of burnt offerings standing on the top of Moriah.

5 Now therefore, thus saith the Lord of hosts: “Consider your ways! — Now, therefore, thus saith the Lord, Consider your ingratitudes,

— “Set your hearts upon your ways,” contemplating the consequences of your bad behavior and upon the manner in which the Lord would have make judgement on your self-indulgence.

6 Ye have sown much, and bring in little; ye eat, but ye have not enough; ye drink, but ye are not filled with drink; ye clothe yourselves, but there is none warm; and he that earneth wages, earneth wages to put it into a bag with holes.”

— Ye have sown much, or have been sowing much, in the expectation of big crops but bring in little, the harvest being small in spite of all their efforts; ye eat, but ye have not enough, they were not really satisfied in spite of their abundance;

— ye drink but ye are still thirsty; ye clothe yourselves, seemingly having enough clothes; but there is no warm; and he that earn wages earn wages to put it Into a bag with holes, that is, they found themselves unable to buy much. All this indicated that there could be no real prosperity without the blessing of the Lord and that was evidently lacking as it always is when people think only of themselves and not of Him.

7 Thus saith the Lord of hosts: “Consider your ways! — thus saith the Lord, Consider your ways, think them over very carefully, for the matter was urgent,

8 Go up to the mountain, and bring wood and build the house; and I will take pleasure in it, and I will be glorified,” saith the Lord.

— Go up to the mountain, to the great forests of Lebanon, to cut down cedars, and bring them from thence for the building of the temple; and bring wood, timber for building;

— and build the house; and the Lord of hosts will take pleasure in, glad to regard it as the house where he might be worshiped, and the Lord will be glorified, receiving the honor which was due to him, causing his Shekinah to dwell here in glory as the Targum says.

9 “Ye looked for much, and lo, it came to little; and when ye brought it home, I blew upon it. Why?” saith the Lord of hosts. “Because of Mine house that is laid waste, and ye run every man unto his own house.

— Ye looked for much, expecting still greater crops and a corresponding prosperity, and, lo, it came to little; and when ye brought it home, believing that at least the little which they had gotten was safe, the Lord did blow upon it, thus dissipating and scattering it; as the Targum interprets it, “behold, I sent a curse upon it:”

— Why? asked the Lord of hosts; he himself undertakes to explain this condition to the people in order to explain it to them more impressively. Because of his house that is in waste, still unfinished and desolate, and ye run every man unto his own house, in a base selfishness, which regarded only their own interests.

10 Therefore the heaven over you is stayed from dew, and the earth is stayed from her fruit. — therefore the heaven over you is restrained from dew, withholding the moisture necessary to insure full crops and the earth is withheld from her fruit, it does not yield even its ordinary harvest.

11 And I called for a drought upon the land, and upon the mountains, and upon the corn, and upon the new wine, and upon the oil, and upon that which the ground bringeth forth, and upon men, and upon cattle, and upon all the labor of the hands.”

— and the Lord of hosts called for a drought upon the land, upon the cultivated fields and upon the mountains, with their rich meadows and upon the corn, the grain products;

— and upon the new wine and upon the oil, all the chief products of the country; and upon that which the ground bringeth forth and upon men and upon cattle and upon all the labor of the hands, his blessing being withheld from all animate and inanimate beings. This earnest rebuke was heeded by the people.

12 Then Zerubbabel the son of Shealtiel, and Joshua the son of Jehozadak, the high priest, with all the remnant of the people, obeyed the voice of the Lord their God and the words of Haggai the prophet, as the Lord their God had sent him; and the people feared before the Lord.

— then Zerubbabel the governor, and Joshua the high priest, with all the remnant of the people, all the rest of the returned exiles;

— obeyed the voice of the Lord and the words of Haggai as the Lord had sent him, considering them as coming from the Lord himself and the people did fear the Lord with reverence and awe.

13 Then spoke Haggai, the Lord’S messenger, in the Lord’S message unto the people, saying, “I am with you, saith the Lord.”

— then, when the people showed such obvious signs of repentance, Haggai spoke unto the people, saying, the Lord is with you, he has accepted your repentance as genuine and acted accordingly.

14 And the Lord stirred up the spirit of Zerubbabel the son of Shealtiel, governor of Judah, and the spirit of Joshua the son of Jehozadak, the high priest, and the spirit of all the remnant of the people; and they came and began work on the house of the Lord of hosts their God,

— and the Lord stirred up the spirit of Zerubbabel, governor of Judah and the spirit of Joshua, the high priest and the spirit of all the remnant of the people and they came and worked; they took steps to continue the building operations in the house of the Lord,

15 on the four and twentieth day of the sixth month, in the second year of Darius the king. — in the twenty-fourth day of the sixth month, twenty-three days after the first message of Haggai, in the second year of Darius, the king, the people were filled with the spirit of repentance and of the fear of the Lord and they took up the work which the Lord has entrusted them.

~~~

More about today’s Repudiation of God’s Sacred Calendar and Adopting a Paganised calendar:

— Days of the Week Names: “Sunday” is the Sun’s day and “Monday” is the Moon’s day. “Tuesday” is Tiw’s day; Tiw is an Anglo-Saxon god of war. “Wednesday” comes from Woden, the Anglo-Saxon king of the gods; in Saxon the name is Wodnesdaeg. “Thursday” is Thursdaeg, Thor’s day; Thor is a Norse god of thunder, lightning and storms. “Friday” is Frigedaeg, Frigga’s day; Frigg is a Norse goddess of home, marriage and fertility. “Saturday” is Saeterndaeg, Saturn’s day; Saturn is an ancient Roman god of fun and feasting;

— Months of the Year Names: January (derived from the Latin Januarius) is to honor their Roman gods Janus; and March, named for Mars, is the Roman mighty god of war; February is derived from the Februa festival or its eponymous februa (“purifications, expiatory offerings”); April relates to what the Romans called the month Aprilis; from a word meaning “to open” and further back from Aphrodite, the Greek name for the goddess of love. May – named for Maia, is the Roman goddess of spring and growth;

— June is a name attributed to Juno, the female mighty wife of Jupiter in Roman mythology. She is also called the “Queen of Heaven” and “Queen of Mighty Ones.” July is to honor Julius Caesar; the Roman Senate named it “Julius” in honor of Roman emperor Julius Caesar. August honor Julius Caesar’s successor, the emperor Augustus; and the months September, October, November, and December are archaic adjectives derived from the ordinal numbers 7 to 10;

Should we think we can get away from His wrath and judgement by repudiating His Word and His Calendar; adopping paganisation and get away with impunity?

Haggai 2

1 In the seventh month, on the one and twentieth day of the month, came the word of the Lord by the prophet Haggai, saying,

— after a short time after the construction of the Temple had resumed in the seventh month, month Tisri, in the twenty-first day of the month, came the word of the Lord by the word of prophecy to Haggai, as the Targum says;

2 “Speak now to Zerubbabel the son of Shealtiel, governor of Judah, and to Joshua the son of Jehozadak, the high priest, and to the residue of the people, saying:

3 ‘Who is left among you who saw this house in her first glory? And how do ye see it now? Is this not in your eyes by comparison with it as nothing?

— Who is left among you that saw this house in her first glory? the Temple of Solomon with its almost unequaled rich ornamentation. And how do ye see it now? What impression did this second Temple make upon them as they observed it?

— it appears by this question of the prophet, that some of the Jews there present had seen the former temple when young, before they were carried to Babylon, and could remember what a magnificent building it was. Is it not in your eyes as nothing? that is, in comparison of the former; as seen from Ezra 3:12;

4 Yet now be strong, O Zerubbabel,’ saith the Lord; ‘and be strong, O Joshua, son of Jehozadak the high priest; and be strong, all ye people of the land,’ saith the Lord, ‘and work, for I am with you,’ saith the Lord of hosts.

— Yet now be strong, O Zerubbabel, saith the Lord of hosts, filled with reassuring comfort; and be strong, O Joshua, the high priest; and be strong, all ye people of the land, saith the Lord, all filled with the same reassurance and work to complete the erection of the Temple; for the Lord be with you;

5 ‘According to the word that I covenanted with you when ye came out of Egypt, so My Spirit remaineth among you. Fear ye not.’

— according to the word that the Lord of hosts covenanted with you when ye came out of Egypt, when Israel was formally accepted as Yehovah’s people in the great assembly at Mount Sinai, so the Lord remaineth among you, to strengthen them for the successful conclusion of their work. Fear ye not!

6 For thus saith the Lord of hosts: ‘Yet once, it is a little while, and I will shake the heavens and the earth, and the sea and the dry land.

— for thus saith the Lord of hosts, the same powerful God of the covenant who had entered into fellowship with them at Horeb, Yet once, it is a little while, but a short time as men reckon time, and the Lord will shake the heavens and the earth and the sea and the dry land, in a mighty commotion involving practically the entire known world, such as took place when the Roman emperors ordered their periodical censuses of the empire.;

— as in Joel 3:16, “the earth will shake” that is, the whole world will be given a Mount Sinai experience as the children had when they came out of Egypt; so that the fear of the Lord will always be embedded in them, all the nations of the world to fear him; Exodus 19:16-18, 20:18-21.

7 And I will shake all nations, and the desire of all nations shall come; and I will fill this house with glory,’ saith the Lord of hosts. — and the Lord of hosts will shake all nations, that is, every nation will be having a Mount Sinai experience as the Israelite had, all of them being drawn into this agitation, and the Desire of all nations, the long-expected Messiah, shall come; and the Lord will fill this house, now so lowly and unpretentious, with glory.

8 ‘The silver is Mine, and the gold is Mine,’ saith the Lord of hosts. — the silver and the gold belong to the Lord of hosts, for which reason it would be a small matter for Him to fill any mere earthly house with ornamentation and treasures beyond the dreams of avarice. But that is not the Lord’s chief concern.

9 ‘The glory of this latter house shall be greater than of the former,’ saith the Lord of hosts. ‘And in this place will I give peace,’ saith the Lord of hosts.”

— the glory of this latter house, of the Millenium shall be greater than of that of Solomon’s, saith the Lord of hosts; and in this place will he give peace, namely, the peace of the redemption gained by the promised Messiah.

10 In the four and twentieth day of the ninth month, in the second year of Darius, came the word of the Lord by Haggai the prophet, saying,

— in the twenty-fourth day of the ninth month, the month Chisleu, a little more than two months later, in the second year of Darius, came the word of the Lord by Haggai, saying,

11 “Thus saith the Lord of hosts: Ask now the priests concerning the law, saying,

12 ‘If one bear holy flesh in the skirt of his garment, and with his skirt toucheth bread, or pottage, or wine, or oil, or any meat, shall it be holy?’” And the priests answered and said, “No.”

— if one bear holy flesh in the skirt of his garment, namely, the meat of sacrifices which had been offered, and with his skirt do touch bread or pottage, any of the holy food that was sodden, or wine or oil or any meat, such as was used in offering sacrifices or in connection with sacrificial meals, shall it be holy?

— and the priests answered and said, No. This was in agreement with the Law, Leviticus 6:20-27; for though the garment itself was sanctified by such consecrated food, it could impart no holiness to one who, by neglecting the will of the Lord, had become unholy.

13 Then said Haggai, “If one who is unclean from a dead body touch any of these, shall it be unclean?” And the priests answered and said, “It shall be unclean.”

— then said Haggai, If one that is unclean by a dead body, by touching a corpse, touch any of these, shall it be unclean? And the priests answered and said, It shall be unclean, again in perfect agreement with the Law and Ordinances established since the days of Moses, Leviticus 22:4; Numbers 5:2; Numbers 9:10.

14 Then answered Haggai and said, “‘So is this people, and so is this nation before Me,’ saith the Lord, ‘and so is every work of their hands; and that which they offer there is unclean.

— then answered Haggai and said, So is this people, and so is this nation before the Lord, in his presence as Ruler and Judge; and so is every work of their hands, everything that they might undertake;

— Rashi: So is this people: Just as you err in this, so do you err in many halachot (‘Jewish’ Laws and Ordinances established since the days of Moses);

— and that which they offer there is unclean. The children of Israel were in disgrace because of their neglect to finish the house of the Lord, and though their land was holy land, consecrated to the Lord, yet its fruits found no favor in his eyes and could not serve to make the people clean by a mere outward service, as long as their hearts were not in the right relation to him, so that they were constrained to give him the worship which lie desired.

15 And now, I pray you, consider from this day and upward, from before a stone was laid upon a stone in the temple of the Lord:

— and now, I pray you, consider from this day and upward, by applying their hearts to this problem, from before a stone was laid upon a stone in the Temple of the Lord, before its reconstruction was resumed;

16 Since those days were, when one came to a heap of twenty measures, there were but ten. When one came to the wine vat to draw out fifty vessels out of the press, there were but twenty.

— since those days were, when one came to an heap of twenty measures, a stack of sheaves which promised a yield of twenty bushels or pecks, there were but ten; when one came to the press-fat for to draw out fifty vessels out of the press, thinking that the harvest should have brought that much, there were but twenty.

17 I smote you with blight and with mildew and with hail in all the labors of your hands; yet ye turned not to Me,’ saith the Lord.

— the Lord of hosts smote you with blasting, with blight of the fruits and grains, and with mildew, from excessive moisture, and with hail in all the labors of your hands, the harvests over which they had worked so hard; yet ye turned not to the Lord, all his punishments did not have the desired effect.

18 ‘Consider now from this day and upward, from the four and twentieth day of the ninth month, even from the day that the foundation of the Lord’S temple was laid, consider it:

— Consider now from this day and onward, applying their hearts to the consideration of that which pertained to their best interests, from the twenty-fourth day of the ninth month, even from the day that the foundation of the Lord’s Temple was laid,

— consider it, for the entire period of time since the Jews, in accordance with the decree of Cyrus, had first laid the foundation till the day of the assembly at which these words were spoken, was a time during which the blessing of the Lord was not poured out in its fullest measure, because all their labor for the new Temple had been fitful.

19 Is the seed yet in the barn? Yea, as yet the vine, and the fig tree, and the pomegranate, and the olive tree hath not brought forth. From this day will I bless you.’”

— Is the seed yet in the barn? They were still suffering as a consequence of the shortage. Yea, as yet the vine and the fig-tree and the pomegranate and the olive-tree hath not brought forth, the results of their former lack of zeal were still in evidence; from this day will the Lord bless you;

— times would now change, since they were showing evidence of the change which had come over their hearts. If men turn to the Lord in true repentance, he may turn to them in mercy and give them blessings of this life in rich measure.

20 And again the word of the Lord came unto Haggai in the four and twentieth day of the month, saying, — and again the word of the Lord came unto Haggai in the twenty-fourth day of the month, this being a second revelation on the same day, saying,

21 “Speak to Zerubbabel, governor of Judah, saying: ‘I will shake the heavens and the earth.

— Speak to Zerubbabel, governor of Judah, saying, in a message of encouragement which was nevertheless intended for the entire assembly of returned exiles, the Lord will shake the heavens and the earth, setting their machinery in motion in the interest of his plans for his people;

— as in Joel 3:16 and Haggai 2:6 above, “and I will shake the heavens and the earth” that is, the whole world will be given a Mount Sinai experience as the children had when they came out of Egypt; so that the fear of the Lord will always be embedded in them, all the nations of the world to fear Him; Exodus 19:16-18, 20:18-21.

22 And I will overthrow the throne of kingdoms, and I will destroy the strength of the kingdoms of the heathen; and I will overthrow the chariots and those who ride in them, and the horses and their riders shall come down, every one by the sword of his brother.

— and the Lord of hosts will overthrow the throne of kingdoms, all the world-powers opposed to his reign and he will destroy the strength of the kingdoms of the heathen, all the forces of evil that are opposed to the Kingdom of God;

— and the Lord will overthrow the chariots and those that ride in them, the leaders of the hostile forces; and the horses and their riders shall come down, being overthrown and destroyed, everyone by the sword of his brother; for that, in the end is a condition which favors the Lord’s Kingdom, the fact that the enemies are often not at peace among themselves, but turn their weapons against one another.

23 In that day,’ saith the Lord of hosts, ‘will I take thee, O Zerubbabel, My servant, the son of Shealtiel,’ saith the Lord, ‘and will make thee as a signet; for I have chosen thee,’ saith the Lord of hosts.”

— on that day, the Lord God will take thee, O Zerubbabel, my servant, and will make thee as a signet, a very precious possession in the eyes of its Oriental possessor; for the Lord have chosen thee;

— the fulfilment of tills prophecy is found in the Messiah, the son of David for he established the Kingdom of His father David in a most unique manner, as a spiritual rule and reign, which is to last throughout eternity. Cf Luke 1:32-33. The Targum says of Zerubbabel: “for in thee I am well pleased.”

~~~

More on Zerubbabel, from Zechariah 4

10 For who hath despised the day of small things? For they shall rejoice and shall see the plummet in the hand of Zerubbabel with those seven. They are the eyes of the Lord, which run to and fro through the whole earth.” — “the hand of Zerubbabel with those seven” and these seven are “the seven eyes of the Lord” which are also the seven spirits of God, sent forth “to and fro” into all the earth; Revelations 5:6;

— only a Divine Being could have seven eyes or seven spirits of the Lord “which run to and fro through the whole earth,” thus the Scriptures testify that Zerubbabel is the Son of God, the Messiah. Selah!


US owes Nicaragua Reparations

•July 2, 2023 • Leave a Comment

US owes Nicaragua reparations, must implement 1986 Int’l Court of Justice ruling

37 years after a 1986 International Court of Justice ruling, the United States still refuses to pay Nicaragua the reparations it legally owes. Today, the Nicaraguan government is demanding that the United Nations take action.

Geopolitical Economy by Ben Norton • June 28, 2023

The International Court of Justice in the Hague ruled in 1986 that the US government had violated international law in its attacks on Nicaragua and that it owed the Central American nation reparations.

June 27, 2023 was the 37th anniversary of this ruling, and Washington still to this day refuses to pay Nicaragua the money that it legally owes it.

The International Court of Justice is the judicial arm of the United Nations.

In 1986, the top UN court determined that the US repeatedly violated international law by:

  • training, arming, equipping, financing, and supplying the Contra paramilitaries in Nicaragua;
  • attacking Nicaraguan infrastructure;
  • putting mines in Nicaragua’s ports;
  • imposing an embargo on Nicaragua; and
  • encouraging the Contras to commit atrocities that violate international humanitarian law.

Nicaragua’s current government has publicly called on the US to meet its obligations under international law.

This June 26, Nicaragua’s President Daniel Ortega sent a letter to UN Secretary General António Guterres demanding that Washington pay reparations.

“There exists a historical debt with the Nicaraguan people that 37 years later has not been settled by the United States,” Ortega said. “It is an obligation clearly established in a final judgment of the highest international judicial authority, the International Court of Justice.”

The Nicaraguan president wrote:

The list of direct damages includes human damages, direct material damages, defense expenses, losses caused by the embargo. Also other damages such as social losses in education, health, work, social security, as well as potential losses for development and production.

From all points of view, the nation’s right to development was irreparably affected.

The estimated value of the damages in March 1988, the date on which the Report was presented along with all supporting documentation, was estimated at $12 billion. This amount does not reflect damages after said date, the consequences of which are currently verifiable.

For example, to this day, the country’s social security system continues to pay pensions to those injured in the war and their relatives, including those who were part of the counterrevolutionary forces illegally financed by the United States, which never assumed the social cost of said illegalities.

Adjusted for inflation, $12 billion in 1988 would be more than $31 billion in 2023.

The current Nicaraguan president wrote to the UN:

Nicaragua never received anything to which it was not entitled (such as the right not to be attacked) in exchange for discontinuing the trial before the Court.

Instead of receiving compensation as it morally and legally corresponds, Nicaragua continues to be the object of a new type of aggression. It is in this context, in which Nicaragua has once again been the victim of attacks, now euphemistically called sanctions, and the victim of an attempted coup, that the people of Nicaragua remember the historic sentence of the International Court of Justice.

Nicaragua takes this opportunity to recall that the judgments of the International Court of Justice are final and of inescapable compliance, and therefore the United States has the legal obligation to comply with the reparations ordered by the judgment of June 27, 1986.

“Therefore thus saith the Lord God: As I live, surely Mine oath that he hath despised and My covenant that he hath broken, even it will I recompense upon his own head.

“And I will spread My net upon him, and he shall be taken in My snare, and I will bring him to Babylon and will plead with him there for his trespass that he hath trespassed against Me

“And all his fugitives with all his troops shall fall by the sword, and they that remain shall be scattered toward all winds; and ye shall know that I, the Lord, have spoken it” Ezekiel 17:19-21

Zephaniah (Ch 1-3)

•July 1, 2023 • Leave a Comment

Zephaniah, the son of Cushi, who would be the most ancient of the prophets, and a contemporary of Jeremiah, Habakkuk, Amaziah and Uzziah, kings of Judah, about the year 625 BC when he is expressly said to prophesy in the days of Josiah.

Its theme is the great day of judgement, the Day of the Lord, or the Lord’s Day, upon Judah and Jerusalem, as well as upon the entire world in graphic details. His name, which is compounded of Saphon, to hide, and Yah the Lord, signifies the secrets of the Lord.

Zephaniah 1

1 The word of the Lord which came unto Zephaniah the son of Cushi, the son of Gedaliah, the son of Amariah, the son of Hezekiah, in the days of Josiah the son of Amon, king of Judah.

— the word of the Lord which came unto Zephaniah, the son of Cushi; when the name of a prophet and his father’s name are mentioned; he is a prophet, the son of a prophet; or whether a prince, a person of some great family, or maybe of the blood royal;

— the son of Gedaliah, the son of Amariah, the son of Hezekiah, four representative members from his ancestry being given; in the days of Josiah, the son of Amon, king of Judah, there were but three generations from him to Josiah, in whose days Zephaniah prophesied as though it is very probable that these progenitors of the prophet were men of note and character.

2 “I will utterly consume all things from off the face of the land,” saith the Lord. — the Lord of host will utterly consume all things off the land, sweeping them off the face of the earth in an utter devastation.

3 “I will consume man and beast; I will consume the fowls of the heaven and the fishes of the sea, and the stumbling blocks with the wicked; and I will cut off man from off the land,” saith the Lord.

— God will make his judgement to consume man and beast, even the creatures being affected by the universality of the decision;

— he will consume the fowls of the heaven and the fishes of the sea and the stumbling-blocks with the wicked, that is, whatever men have offended and transgressed with together with the objects of their idolatry; he will cut off man from off the land, certainly destroying them off the face of the earth, in a great fiery destruction.

4 “I will also stretch out Mine hand upon Judah, and upon all the inhabitants of Jerusalem; and I will cut off the remnant of Baal from this place, and the name of the Chemarim with the priests,

— God will also stretch out his hand upon Judah and upon all the inhabitants of Jerusalem, for the people of the land followed the inhabitants of the capital in their transgressions; and he will cut off the remnant of Baal from this place,

— for there were still such as adhered to his idolatrous worship, and the name of the Chemarim, the idol-priests, those engaged in the worship of Baal, with the priests, for these also had polluted themselves and were therefore destined for destruction;

— a parallel Scripture in Malachi 3:2 speaks of a “refiner’s fire” that shall purify the sons of Levi; hence within 700 years later, both the Boethusians, who hailed from Egyptian’s “idolatrous priests” and the Hellenised Sadducees, who played harlotry with the Greek gods of Zeus and goddess Athena, were consumed in the AD 70 inferno.

— the Boethusians and the Sadducees were members of two Jewish sects that, following the Samaritans, kept a heretic passover, and that flourished for a century or so before their destruction in the prophesied refiner’s purification of the Levites;

— the Essene/Qumran has their own 364 day solar calendar totally at odds with the calendrics of the Sanhedrin; they acted presumptuously by repudiating the Calendar that God has instituted through his Word; they, too, were wiped out during the AD 70 inferno.

5 and them that worship the host of heaven upon the housetops, and them that worship and that swear by the Lord, and that swear by Milcom,

— and them that worship the host of heaven upon the housetops, had a full view of the host of heaven, regarding the Sun, Moon and Stars as their gods; and them that worship and that swear by the Lord and that swear by their pagan deity, Malcham, so that they tried to combine the service of the true God and that of Baal, solemnly pledging themselves to the latter’s service;

— Israel being warned the danger of worshiping the heavenly bodies (Deuteronomy 4:19) and prescribed the death penalty for the crime of worshiping the sun, or the moon, or any of the “host of heaven” (Deuteronomy 17:2-7).

— a parallel in Jeremiah 8:2 the heads of the twenty-four courses of the priesthood, led by the high priest, making up the “twenty five men” were not only worshipping the SUN: they were doing so in the very temple of God, with their backs turned upon the presence of God!

— today, many pretending Christians honor the host of heaven with a pagan-named week and a paganised monthly calendar; and more than 98.5 percent of Christians are honouring the Sun by observing Sunday worship. They have “their backs toward the temple of the Lord and their faces toward the east; and they worshipped the SUN toward the east; whose Godly penalty is to be “cut off” or “shalt stone them with stones” to death (Deuteronomy 17:5) – ’till they die (more at the end).

6 and them that are turned back from the Lord, and those that have not sought the Lord nor inquired for Him.” — and them that are turned back from the Lord, their backs against the Temple of the Lord;

— and their faces toward the east, worshipping the Sun; and those that have not sought the Lord nor enquired for him, both the openly wicked and the irreligious or else seeking advice from other gods: Egyptian, Babylonian, Greek or Roman.

7 Hold thy peace at the presence of the Lord God, for the day of the Lord is at hand. For the Lord hath prepared a sacrifice; He hath bidden His guests.

— hold thy peace at the presence of the Lord God! ready to submit to his judgement as outlined above; for the day of the Lord—the Lord’s Day; as in Revelation 1:10; not Sunday but the day of his Judgement—is at hand, when his punishment must strike the transgressors;

— for the Lord hath prepared a sacrifice, the Jewish nation itself, his people the Jews, who were to fall to his justice, to atone for the injury done to their sins, he hath bid his guests, namely, the world-powers, the Chaldeans, the Greeks, the Romans and their allies, all ready to devour Judah.

8 “And it shall come to pass in the day of the Lord’S sacrifice, that I will punish the princes and the king’s children, and all such as are clothed with strange apparel.

— and it shall came to pass in the day of the Lord’s sacrifice, when his punishment is put into effect, that the Lord of host will punish the princes, the mighty ones, the dignitaries of state, and the king’s children, all those belonging to the royal family;

— and all such as are clothed with strange apparel, their dress showing that they were estranged from the national spirit and customs; the Targum says, “and upon all those that make a noise at the worship of idols.”

9 In the same day also will I punish all those that leap on the threshold, who fill their masters’ houses with violence and deceit.

— in the same day also God will punish all those that leap over the threshold, namely, that of the temple of Dagon, the idol of the Philistines, 1 Samuel 5:5 which fill their masters’ houses with violence and deceit;

— this also sounds like a dramatic transformed deceitful Mike Pompeo CIA’s “We lie, we cheat, we stole” in bringing power, wealth, money and influence, unjustly acquired through “violence and deceit” into the houses of the Pentagon which they hope to get away with impunity, for the moment at least;

— or the deeds and mischiefs of Victoria Nuland that she had created in Ukraine!

10 “And it shall come to pass in that day,” saith the Lord, “that there shall be the noise of a cry from the Fish Gate, and a howling from the Second, and a great crashing from the hills.

— and it shall come to pass in that day, the Lord’s Day, saith the Lord, that there shall be the noise of a cry, of a woeful shout, from the fish-gate, that through which the road to Joppa passed;

— and an howling from the second, from the lower city, where the attack of the enemy would be launched, and a great crashing from the hills, those extending upward from the lower city. The Lord set out to punish, and his Judgement was thorough, as it always is in the case of such as refuse to heed his warning.

11 Howl, ye inhabitants of Maktesh, for all the merchant people are cut down; all they that bear silver are cut off.

— howl, ye inhabitants of Maktesh, meaning the mortar, a small section of Jerusalem, so called because it presented a depression or hollow; the Targum says differently, “howl, all ye that dwell in the valley of Kidron;”

— for all the merchant people are cut down, entirely destroyed; all they that bear silver, the traders laden with silver, who occupied that part of the lower city, are cut off by the sword of the enemy.

12 And it shall come to pass at that time that I will search Jerusalem with candles, and punish the men that are settled on their dregs, that say in their heart, ‘The Lord will not do good, neither will He do evil.’

— and it shall come to pass at that time that the Lord of host will search Jerusalem with candles, investigating even the dark and hidden corners, so that not one of the wrong-doers is overlooked;

— that say in their heart, The Lord will not do good, neither will he do evil, which is a flat denial of his providence; saying that he takes no notice of what is done by men on earth, whether good or bad; and neither rewards the one, nor punishes the other;

— so the Targum says, “it is not the good pleasure of God to do good to the righteous, or to do evil to the wicked;” that is, there is no need of worry, matters will go on as they always have been.

13 Therefore their goods shall become a booty, and their houses a desolation. They shall also build houses, but not inhabit them; and they shall plant vineyards, but not drink the wine thereof.”

— therefore their wealth will be plundered by the enemies, and their houses a desolation, in the overthrow of the city;

— they shall also build houses, but not inhabit them, the destruction taking place before they can move into them, and they shall plant vineyards, but not drink the wine thereof. Cf Amos 5:11; Micah 6:15.

14 The great day of the Lord is near; it is near and hasteneth greatly, even the voice of the day of the Lord; the mighty man shall cry there bitterly.

— the great Day of the Lord, “the Lord’s Day” as in Revelation 1:10; not Sunday but the day of his Judgement is near; it is near and hasteth greatly, there will be no further delay, even the voice of the day of the Lord, or “Hark! the day of Yehovah”

— the mighty man shall cry there bitterly, the mighty men within the city of Jerusalem besieged, as was in AD 70; the Boethusian and Sadducaic elites of Jerusalem, crying in bitter lamentation, because he cannot save themselves, but must yield to the foe.

15 That day is a day of wrath, a day of trouble and distress, a day of waste and desolation, a day of darkness and gloominess, a day of clouds and thick darkness,

— that day is a day of wrath and judgement, Cf Isaiah 19:18, a day of trouble and distress, of anguish and pressure, Job 15:24, a day of wasteness and desolation, of the greatest devastation, a day of darkness and gloominess, Joel 2:2, a day of clouds and thick darkness, Deuteronomy 4:11,

16 a day of the trumpet and alarm against the fortified cities and against the high towers. — a day of the trumpet and alarm against the fenced cities, in proclaiming God’s power upon a sinful people,

— in the war-signal of desolation and against the high towers, these signify their princes, governors, magistrates and great men, well-protected by the battlements of their forts.

17 “And I will bring distress upon men, that they shall walk like blind men, because they have sinned against the Lord; and their blood shall be poured out as dust, and their flesh as the dung.”

— and the Lord of host will bring distress upon men, that they shall walk like blind men, not knowing which way to go, groping about in a futile effort to escape from existing evils;

— because they have sinned against the Lord; and their blood shall be poured out as dust, in endless quantities, and their flesh as the dung, or their carcasses, that is, their dead bodies shall lie unburied, and rot and putrefy and shall be cast upon fields like dung, to fatten them.

18 Neither their silver nor their gold shall be able to deliver them in the day of the Lord’S wrath; but the whole land shall be devoured by the fire of His jealousy, for He indeed shall make a speedy riddance of all them that dwell in the land.

— neither their silver nor their gold shall be able to deliver them; like the Medes when they took on Babylon, Isaiah 13:17 in the day of the Lord’s wrath, they would not be able to buy themselves off when His fury is once set in motion;

— but the whole land shall be devoured by the fire of his jealousy, his indignation for his honor; for he shall make even a speedy riddance of all them that dwell in the land, consuming them with a suddenness which they had not anticipated. Even so will the Day of Wrath come upon a world which, as a whole, is not prepared for the coming of the Lord’s Day of Judgement. Cf Matthew 24:44.

Zephaniah 2

1 Gather yourselves together, yea, gather together, O nation not desired, — Gather yourselves together, yea, gather together; O nation not desired; that is, not desirable; unworthy of the favor of God;

— to call a solemn assembly, to gather the people, priests and elders together, to one place as for a penitential assembly with earnest self-examination, O nation not desired, literally, “that does not grow pale,” not desirable to God, which till now has felt no sense of shame,

— Rashi: O nation that has no desire: That has no desire to return to the Torah.

2 before the decree bring forth, before the day pass as the chaff, before the fierce anger of the Lord come upon you, before the day of the Lord’S anger come upon you!

— before the decree bring forth, when, according to God’s plan, the day of judgement upon Judah would suddenly come, before the day pass quickly as when the wind carries the chaff along, before the fierce anger of the Lord come upon you, as it surely would if they would not show the proper repentance;

— the Targum explains more fully, “before the decree of the house of judgement come out upon you, and ye be like chaff which the wind blows away, and like a shadow which passes from before the day,” like the Boethusian and Sadducaic elites during the AD 70 inferno.

3 Seek ye the Lord, all ye meek of the earth, who have wrought His judgement; seek righteousness, seek meekness; it may be ye shall be hid in the day of the Lord’S anger.

— seek ye the Lord, in proper repentance, all ye meek of the earth, the humble of the land, those who were still disposed to be guided by his will, which have wrought his judgement, observed his right, trying to fulfill the decrees of his holy Word; seek righteousness, with ever greater truth and sincerity, seek meekness, with all humility, with a constant sense of their own unworthiness;

— it may be ye shall be hid in the day of the Lord’s anger, so that the Lord would make use of mercy rather than in wrath and fierce anger and save them in the general overthrow. This exhortation is now supported by a reference to the doom of many nations;

— the Targum of the whole says, “seek the fear of the Lord, all ye meek of the earth, who do the judgements of his will; seek truth, seek meekness; it may be there will be a protection for you on the day of the Lord’s anger.”

Remember: the Targum is an indispensable source of understanding the Bible. Started by Ezra for those returning Jews from Babylon and for these returnees they could only understand the Sacred Text in Aramaic; hence the Targum is as if Ezra is speaking to us in modern times from the Sacred Text.

4 For Gaza shall be forsaken, and Ashkelon a desolation; they shall drive out Ashdod at the noonday, and Ekron shall be rooted up. — for Gaza shall be forsaken, overthrown and forgotten; and Ashkelon a desolation;

— they shall drive out Ashdod, the chief seat of the worship of Dagon, at the noon day, since she would be helpless even at midday, so that there would be no need of resorting to a night attack, and Ekron shall be rooted up. The four Philistine city-states mentioned here are clearly representative of the entire country.

5 Woe unto the inhabitants of the seacoast, the nation of the Cherethites! The word of the Lord is against you, O Canaan, the land of the Philistines: “I will even destroy thee, that there shall be no inhabitant.”

— Woe unto the inhabitants of the seacoast, of the plains along the Mediterranean sea, the nation of the Cherethites, for a part of the Philistines, at least, traced their descent to the ancient people of Crete;

— the word of the Lord is against you, O Canaan, the land of the Philistines, the word Canaan here applied chiefly to the lowlands of Palestine to the west; the Lord of host will even destroy thee that there shall be no inhabitant, the nation as such to be destroyed;

— Rashi: the nation of Cherethites: the people liable to destruction. Who are the inhabitants of the seacoast of Canaan, the land of the Philistines? The Philistines, who dwell on the coast of the western sea, in the west of Eretz lsrael, within its boundaries.

Although Jonathan explains this phrase homiletically as [the nation of] destruction, the nation of the Cherethites is a province of the Philistines; its name is Cherethi. So Scripture states (I Sam. 30:14) regarding Ziklag: “We made a raid upon the south of the Cherethites, etc.”

Jonathan translates: on the south of Cherethi. Below (ibid. 30:16) it is written: “Because of all the great spoil which they had taken from the land of the Philistines and from the land of Judah.”

— note: this seacoast in Cherethites is destined for destruction; yet the same seacoast in the next verses are prophesied to be a place of refuge for shepherds and folds of flocks – that is, the remnant of the house of Judah, for the Lord their God shall visit them and return them from captivity!

6 And the seacoast shall be dwellings and cottages for shepherds, and folds for flocks. — and the seacoast, then teeming with the life of rich commercial cities,

— shall be dwellings and cottages for shepherds, dugouts and shanties, or places for pastures where they would carry on the work of their calling, and folds for flocks, the land reverting to the use of nomads;

— Rashi: breakfast nooks for shepherds: a temporary dwelling where the shepherds eat bread in the morning. כְּרֹת is an expression related to (II Kings 6:23) “He prepared for them a lavish feast.”

— this is a prophecy: Yavne, where it is a “dwellings and cottages for shepherds and folds for flocks” on the Mediterranean coast, seems to fit this verse perfectly in a subtle way by God of referring to this seacoast!

— during the inferno in Jerusalem around AD 70, the Hillel branch of Pharisees, those of the House of Hillel, fled to Yavne. They were headed by a Pharisaic rabbi, Johanan ben Zakkai, the head of the Sanhedrin, he was smuggled out of besieged Jerusalem in a coffin;

— they escaped first to Yavne, and later to Tiberias; his followers re-emerged as Rabbinic Jews, who established the Hillel Calendar, which was revealed by Hillel II in about AD 359 concerning the rules of the calendar.

Yavne, near the Coast, shall be for the remnant of the house of Judah

7 And the coast shall be for the remnant of the house of Judah; they shall feed thereupon. In the houses of Ashkelon shall they lie down in the evening; for the Lord their God shall visit them, and return them from captivity.

— and the coast shall be for the remnant of the house of Judah, those whom the Lord would lead hack to their own country; the Pharisees of the House of Hillel; they escaped to Yavne on the Mediterranean coast and, later, his followers re-emerged as Rabbinic Jews, who established the Hillel Calendar; they shall feed thereupon, making the country a pasture-ground; their God shall visit them, to make the nucleus of a renewed people, members of the Jewish nation that returned;

— Rashi: And it shall be a lot for the remnant of the house of Judah: And that border shall be a lot for the remnant. This חֶבֶל is an expression of a lot. In this manner, Jonathan rendered: And it shall be a lot for the remnant of the house of Judah.

— with them the Jews are also embedded with the Oral Law, the knowledge of where the Vowels are in the Scriptures (which were then written only in consonants and no spaces nor punctuations); and how and when to use them; Romans 3:1-4; see a Study here and here; or see The Word from Moses to King James; that’s why God provide a refuge for them; and bring them back from captivity!

8 “I have heard the reproach of Moab, and the revilings of the children of Ammon, whereby they have reproached My people, and magnified themselves against their border.

— the Lord of host have heard the reproach of Moab, Cf Jeremiah 48:27, and the revilings of the children of Amman, two people that descended from Lot, east of Jordan and of the Dead Sea, but later became the enemies of God’s people and made known their hostility in bitter blasphemies;

— whereby they have reproached God’s people, in mockery and scorn, they spoke reproachfully of the land of Israel, and magnified themselves against their border, acted violently against the boundary of the Lord’s people, constantly attempting to get into possession of some of Israel’s territory;

— Rashi: who taunted My people: When [the people of] Israel were being led into exile toward the land of the Chaldeans, and they were passing through Ammon and Moab, and they would see Israel weeping, sighing, and crying out, they would taunt them and say, “Why are you suffering? Aren’t you going to your father’s house? Your fathers dwelt on the other side of the river from earliest times.” (Josh. 24:2).

9 Therefore as I live,” saith the Lord of hosts, the God of Israel, “surely Moab shall be as Sodom, and the children of Ammon as Gomorrah” even the breeding of nettles and salt pits, and a perpetual desolation. The residue of My people shall despoil them, and the remnant of My people shall possess them.”

— therefore as the Lord of host lives, the God of Israel, the Supreme Ruler of the world, Surely Moab shall be as Sodom, and the children of Amman as Gomorrah, being overwhelmed by the destruction which was the fate of their ancestor’s cities;

— even the breeding of nettles, a plant with pointed leave; a weed growing only in desolate places, and salt-pits, on the shore of the Dead Sea, and a perpetual desolation, a waste, barren and uncultivated; a desert until the end of time; the residue of God’s people shall spoil them, take possession of their land, and the remnant of his people shall possess them; that is, the Jews, the remnant of them that returned from Babylon: these events being typical of the destruction of the sinners in contrast to the redemption of the Lord’s people;

— Rashi: for Moab shall be like Sodom: You, too, shall return to your previous dwelling. Was not your father, Lot, from Sodom?

10 This shall they have for their pride, because they have reproached and magnified themselves against the people of the Lord of hosts.

— this shall they have for their (that of the Moabites and Ammonites) pride, in proper retaliation for the manner in which they had dealt with Yehovah’s people, because they have reproached and magnified themselves against the people of the Lord of hosts; they spoke contemptibly of them, of their nation and religion.

11 The Lord will be fearsome unto them; for He will famish all the gods of the earth; and men shall worship Him, every one from his place, even all the isles of the heathen.

— the Lord will be terrible unto the Moabites and Ammonites; dealing with them in a manner which is hound to strike terror to their hearts; for he will famish, make them extremely hungry, or be destroyed;

— all the gods of the earth, all the idols in which men placed their trust: Dagon, Chemosh, Molech, Bel, Astarte, Mithra or Mitra (the Sun-God whose birthday many drunks honor and celebrate on December 25th), Zeus and others; called “gods of the earth” in distinction from the God of heaven; and men shall worship these earthly gods, acknowledging their supremacy, everyone from his place, Protestants or Catholics alike, even all the isles of the heathen, that is, men from every nation of the earth.

12 “Ye Ethiopians also, ye shall be slain by My sword.” — ye Ethiopians also, not just Ethiopians in Africa but all beyond Egypt, ye shall be slain by my Sword, an instrument in the hand of God for punishing all the nations of the earth.

13 And He will stretch out His hand against the north and destroy Assyria, and will make Nineveh a desolation and dry like a wilderness.

— and the Lord of host will stretch out his hand against the North and destroy Assyria, powerful though it was at that time, and will make Nineveh, the capital of Assyria, Jonah 1:2, a desolation, although it was then surrounded by a network of irrigation canals, and dry like a wilderness.

14 And flocks shall lie down in the midst of her, all the beasts of the nations: both the cormorant and the bittern shall lodge in the upper lintels of it: their voice shall sing in the windows; desolation shall be in the thresholds; for He shall uncover the cedar work.

— and flocks shall lie down in the midst of her, the former great city had been leveled to the ground and reverted back to a pasture-ground, all the beasts of the nations, beasts of all kinds in droves or great masses;

— both the cormorant, the pelicans, and the bittern, or hedge-hog, shall lodge in the upper lintels of it, on the capitals of pillars standing in the midst of the ruins; their voice shall sing in the windows, or “hark how tile singer sings in the window,” where he has built his nest; desolation, or dirt, shall be in the thresholds; for the Lord of hosts shall uncover the cedar work, all the beautiful cedar paneling of their palaces the Lord has torn away, and it has fallen into decay;

— Rashi: for the cedarwork has been destroyed: For he has uprooted its cedars, as in (Ps. 137:7) “Raze it, raze it.” Jonathan rendered: And they demolished its roof. That is the roof of the house that is ceiled with cedar; even stone houses are ceiled with boards of wood.

15 This is the rejoicing city that dwelt without care, that said in her heart, “I am, and there is none besides me.” How she has become a desolation, a place for beasts to lie down in! Every one that passeth by her shall hiss and wag his hand.

— this is the rejoicing city, where shouts of gaiety were heard without ceasing, that dwelt carelessly, in perfect security; that said in her heart, in proud self-confidence, I am, and there is none beside me.

— How is she become a desolation, a deserted place, a place for beasts to lie down in, a lair for the animals of the desert. Everyone that passeth by her shall hiss and wag his head, in scorn and derision, both astonished and gratified at the overthrow of the proud city, a consequence of the ending in which the Lord carried out his judgements upon his enemies.

Zephaniah 3

1 Woe to her that is filthy and polluted, to the oppressing city! — Woe to her that is filthy and polluted, meaning the city of Jerusalem,

— and its inhabitants; not just before the Babylonish captivity, but after their return, under the second temple, stubborn and full of uncleanness.

2 She obeyed not the voice; she received not correction; she trusted not in the Lord; she drew not near to her God.

— she obeyed not the voice of his servants the prophets, paying no attention to the Lord’s admonitions; she received not correction, the instruction or discipline which was intended to be of benefit to her; she trusted not in the Lord, placing no confidence in his exhortations and promises; she drew not near to her God, she has become indifferent to Yehovah.

3 Her princes within her are roaring lions; her judges are evening wolves, they gnaw not the bones till the morrow.

— her princes within her are roaring lions, bent upon rapine and murder; her judges are evening wolves of civil magistrates in common; the members of the Sanhedrin; their princes with their mouths like ravening and roaring lions driven forth by hunger in the evening;

— their greed being insatiable; they gnaw not the bones till the morrow, that is, they leave not the bones till the morning; they are so hungry that they eat up bones and all at once, their voracious appetite causing them to devour their victims instantly.

4 Her prophets are light and treacherous persons; her priests have polluted the sanctuary, they have done violence to the law.

— her false prophets are light and treacherous, dishonest, unscrupulous, boastful and faithless; her priests have polluted the Sanctuary, desecrating the Temple by their neglect of the prescribed sacrifices or by their blasphemous manner in offering them; they have done violence to the Law, simply setting aside the precepts of God whose guardians they were supposed to be.

5 The just Lord is in the midst thereof; He will not do iniquity: Every morning doth He bring His judgement to light, He faileth not. But the unjust knoweth no shame.

— the just Lord is in the midst thereof, he, the righteous One, having left nothing untried; he will not do iniquity, he commits no wrong; every morning doth he bring his judgement to light, giving evidence of the justice of all his dealings;

— he faileth not, no blame, therefore, rests on him. But the unjust knoweth no shame, the wicked people of Jerusalem are not influenced either by the example of God or by his threat of punishment.

6 “I have cut off the nations; their towers are desolate; I made their streets waste, that none passeth by; their cities are destroyed, so that there is no man, that there is no inhabitant.

— the Lord of host have cut off the nations, also as an act of warning Israel; their towers are desolate, their walls and fortresses leveled to the ground; the Lord made their streets waste, the roads obliterated, that none passeth by their cities are destroyed, so that there is no man, that there is none inhabitant, all this being done, in part at least, to serve as an example of warning to the people of Jerusalem and Judah.

7 I said, ‘Surely thou wilt fear Me, thou wilt receive instruction’—so their dwelling should not be cut off, howsoever I punished them; but they rose early and corrupted all their doings.

— the Lord of host said, Surely thou wilt fear me, the kindness and tenderness of the warning being emphasized; thou wilt receive instruction, if only thou wouldst suffer thyself to be taught!

— so their dwelling should not be cut off, howsoever the Lord of host punished them, or “in accordance with all that the Lord had appointed them” that is, Yehovah still hoped to have mercy on them, so that he would not have to send the threatened punishment;

— but they rose early, zealous for their wicked works, and corrupted all their doings, they were eager to speed their perverted actions, their infamous deeds. Thus many a godless person refuses to heed the Lord’s call to repentance and deliberately plunges all the more deeply into transgressions of every kind.

8 “Therefore wait ye upon Me,” saith the Lord, “until the day that I rise up to the prey; for My determination is to gather the nations, that I may assemble the kingdoms, to pour upon them Mine indignation, even all My fierce anger; for all the earth shall be devoured with the fire of My jealousy.

— therefore wait ye upon the Lord, this merciful invitation being extended to all who will still listen to his words, until the day that the Lord rise up to the prey, when he pours out his wrath upon the nations;

— for his determination is to gather the nations, to carry out his punishment upon them, that the Lord may assemble the kingdoms, to pour upon them his indignation, even all his fierce anger, all the burning wrath which he has stored tip against them;

— for all the earth shall be devoured with the fire of his jealousy, by the zeal which he would show on his Day of Judgement. That is the promise of the Millennium, the elimination of the enemies as a factor in interfering with the progress of the Lord’s Kingdom;

— as in Joel 3:16, “the earth will shake” or here “all the earth shall be devoured with the fire” that is, the whole world will be given a Mount Sinai experience as the children had when they came out of Egypt; so that the fear of the Lord will always be embedded in them, all the nations of the world to fear him; Exodus 19:16-18, 20:18-21.

9 For then will I return to the people a pure language, that they may all call upon the name of the Lord, to serve Him with one accord.

— for then will the Lord of host turn to the people a pure language, by purifying their sinful lips and thereby enabling them to call upon him with pure lips, that they may all call upon the name of the Lord, Yehovah, in the true unity of a common faith to serve him with one consent, literally, “with one shoulder,” all bearing together the pleasant yoke of our great God.

10 From beyond the rivers of Ethiopia My suppliants—even the daughter of My dispersed—shall bring Mine offering.

— from beyond the rivers of Ethiopia, from the remotest corners of the earth, the Lord’s suppliants, those who would worship Yehovah in spirit and in truth, even the daughter of his dispersed, gained for the Lord from the midst of a strange nation, shall bring his offering, turning to him with true worship.

11 “In that day shalt thou not be ashamed for all thy doings wherein thou hast transgressed against Me; for then I will take away out of the midst of thee them that rejoice in thy pride, and thou shalt no more be haughty because of My holy mountain.

— in that day shalt thou, the restored Israel, the Kingdom of God, not be ashamed for all thy doings wherein thou hast transgressed against him, there being no more occasion for such a feeling;

— for then the Lord of host will take away out of the midst of thee them that rejoice in thy pride, the wicked and blasphemous whom the prophet had described at the beginning of the Chapter, and thou shalt no more be haughty because of his holy mountain, all boastfulness and pride being eliminated in favor of a meek and humble submission to Yehovah’s reign of mercy.

12 I will also leave in the midst of thee an afflicted and poor people, and they shall trust in the name of the Lord.

— the Lord of host will also leave in the midst of thee an afflicted and poor people, one fully conscious of its absolute dependence upon the grace and mercy of God, and they shall trust in the name of the Lord, Yehovah, placing all their confidence in him alone.

13 The remnant of Israel shall not do iniquity nor speak lies, neither shall a deceitful tongue be found in their mouth; for they shall feed and lie down, and none shall make them afraid.”

— the remnant of Israel, the nucleus of the Kingdom, which would become the stock of the Kingdom of God, shall not do iniquity, not willfully serve wickedness, nor speak lies, becoming guilty of deliberate falsehood,

— neither shall a deceitful tongue be found in their mouth, particularly so far as false doctrine is concerned; for they shall feed, of the rich pasture offered by the Good Shepherd, and lie down, in calm satisfaction, and none shall make them afraid. Cf Micah 7:14; Psalms 23.

14 Sing, O daughter of Zion! Shout, O Israel! Be glad and rejoice with all the heart, O daughter of Jerusalem!

— Sing, O daughter of Zion, the Kingdom of God; shout, O Israel, namely, the spiritual Israel; be glad and rejoice with all the heart, O daughter of Jerusalem, for the communion of the elect is established in the Jerusalem which is above. Cf Galatians 4:26.

15 The Lord hath taken away thy judgments; He hath cast out thine enemy. The King of Israel, even the Lord, is in the midst of thee; thou shalt not see evil any more.

— the Lord of host hath taken away thy judgements, the sentences of condemnation which had rightly been spoken upon her on account of her sins;

— he hath cast out thine enemy, sweeping away the world-power which personified all the hostile forces of the world. The King of Israel, even the Lord, is in the midst of thee, namely, in the person of the Messiah; thou shalt not see evil any more, his blessings removing everything that might bring evil.

16 In that day it shall be said to Jerusalem, “Fear thou not”; and to Zion, “Let not thine hands be slack.

— in that day, in the great Messianic period, it shall be said to Jerusalem, Fear thou not, this being the fundamental note of the Kingdom of God, no more weird stories from either the paganised Christmas or Easter shows; and to Zion, Let not thine hands be slack, namely, in terror at the prospect of danger and affliction from without.

17 The Lord thy God in the midst of thee is mighty; He will save, He will rejoice over thee with joy; He will rest in His love, He will joy over thee with singing.”

— the Lord, thy God, the Lord of host in the midst of thee is mighty, not at a dim distance, but in the closest proximity, and powerful to help; he will save, that’s his name Yeshua, he is the Savior;

— he will rejoice over thee with joy, in his delight over the renewal of the marriage covenant between himself and his Church; he will rest in his love, in quiet satisfaction; he will joy over thee, after his meditation has proved so satisfactory, with singing. Moreover, the Lord will let all humble and afflicted partake of his joy.

18 “I will gather them that are sorrowful for the solemn assembly, who are of thee, to whom the reproach of it was a burden.

— the Lord of host will gather them that are sorrowful for the solemn assembly, mourning far from the festive gathering when the Lord would make his salvation known, who are of thee, they were of the same family and descent, but were now far removed from the visible congregation of the Lord, to whom the reproach of it was a burden, who felt the weight of their captivity among the heathen nations.

19 Behold, at that time I will undo all that afflict thee; and I will save her that is halt, and gather her that was driven out; and I will get them praise and fame in every land where they have been put to shame.

— behold, at that time, in the Millennium, the Lord of host will undo all that afflict thee, dealing with the oppressors according to his justice; and he will save her that halteth, heal the limping, and gather her that was driven out, those who were dispersed;

— and he will get them praise and fame in every land where they have been put to shame, so that the name of the Lord’s people would be celebrated everywhere.

20 At that time will I bring you back, even in the time that I gather you; for I will make you a name and a praise among all people of the earth, when I bring back your captives before your eyes,” saith the Lord.

— at that time will the Lord of host bring you again, the calling of the Lord to join his Kingdom being an act of his mercy, even in the time that I gather you, in his Kingdom;

— for he will make you a name and a praise among all people of the earth, when he turn back your captivity before your eyes, saith the Lord. The fulfillment of this prophecy is clearly found in the gathering of the Kingdom, its members being called from the various nations of the earth, and the consummation and climax will be reached in the eventual complete deliverance from this present evil world as the Kingdom of God opens its portals.

~~~

Facing the East, worship the host of heaven (Zephaniah 1:5; Ezekiel 8:16); worshipping the Sun:

— the worship of heavenly bodies was against God’s will which Moses had warned the people (Deuteronomy 4:19, 17:3, whose penalty “and shalt stone them with stones” is to be stoned to death, Deuteronomy 17:5 ’till they die).

— those 25 men in Ezekiel 8:16 corrupted themselves by worshipping the sun; and so the Targum renders it, “and, lo, they corrupted themselves, worshipping facing the east the sun; their backs toward the temple of the Lord” — they turned their backs against the most holy place; which is an aggravation of their impiety; casting the utmost contempt for God:

Moses’ warnings in Deuteronomy 17

3 And [if you] hath gone and served other gods and worshipped them, either the sun or moon or any of the host of heaven, which I have not commanded, 4 and it be told thee, and thou hast heard of it and inquired diligently, and behold, it be true and the thing certain that such abomination is wrought in Israel, 5 then shalt thou bring forth that man or that woman who has committed that wicked thing unto thy gates, even that man or that woman, and shalt stone them with stones till they die. Deuteronomy 17:3-5

The following quotation show that the first Christians understood the Sabbath but were made forbidden and gathered for worship on Sunday: “Christians should not Judaize and should not be idle on the Sabbath, but should work on that day; they should, however, particularly reverence the Lord’s day and, if possible, not work on it, because they were Christians” (Canon 29 AD 360);

— also, Days of the Week Names: “Sunday” is the Sun’s day and “Monday” is the Moon’s day. “Tuesday” is Tiw’s day; Tiw is an Anglo-Saxon god of war. “Wednesday” comes from Woden, the Anglo-Saxon king of the gods; in Saxon the name is Wodnesdaeg. “Thursday” is Thursdaeg, Thor’s day; Thor is a Norse god of thunder, lightning and storms. “Friday” is Frigedaeg, Frigga’s day; Frigg is a Norse goddess of home, marriage and fertility. “Saturday” is Saeterndaeg, Saturn’s day; Saturn is an ancient Roman god of fun and feasting;

— Months of the Year Names: January (derived from the Latin Januarius) is to honor their Roman gods Janus; and March, named for Mars, is the Roman mighty god of war; February is derived from the Februa festival or its eponymous februa (“purifications, expiatory offerings”); April relates to what the Romans called the month Aprilis; from a word meaning “to open” and further back from Aphrodite, the Greek name for the goddess of love. May – named for Maia, is the Roman goddess of spring and growth;

— June is a name attributed to Juno, the female mighty wife of Jupiter in Roman mythology. She is also called the “Queen of Heaven” and “Queen of Mighty Ones.” July is to honor Julius Caesar; the Roman Senate named it “Julius” in honor of Roman emperor Julius Caesar. August honor Julius Caesar’s successor, the emperor Augustus; and the months September, October, November, and December are archaic adjectives derived from the ordinal numbers 7 to 10;

— do you think we can get away from God’s wrath and judgement by repudiating his Word and his Calendar; adopping paganisation and get away with impunity?

— today, more than 98.5 percent of Christians are honouring the Sun by observing Sunday worship. They have “their backs toward the temple of the Lord and their faces toward the east; and they worshipped the SUN toward the east; whose Godly penalty is to be stoned to death – ’till they die.

— also, following the SUN-worshipping Samaritans, most Church of God Communities are showing their contempt for God by having their “wavesheaf offering” and Pentecost on a Sunday; always on a Sunday. And these are supposedly in God’s Sanctuary, but God says he is a jealous God, so these pretentious Christians could be spewed out of his mouth! A death penalty – ’till they die!

Malachi (Ch 3-4)

•June 30, 2023 • Leave a Comment

The last of the prophets, Malachi begins with a prophecy of a forerunner of the coming of the Messiah; and the effects and consequences of his coming, and the prophecy of uniting the messages of the Father of the Old Testament and the Son in the New.

Malachi 3

1 “Behold, I will send My messenger, and he shall prepare the way before Me. And the Lord, whom you seek, shall suddenly come to His temple, even the Messenger of the covenant, whom ye delight in. Behold, He shall come,” saith the Lord of hosts.

— behold, the Lord of hosts will send his messenger, the special prophet spoken of Isaiah 40:3, who was John the Baptist, the passage upon which the present statement is evidently founded, and he shall prepare the way before me, Mark 1:3; and the Lord whom ye seek, the Son of God, and promised Messiah, for whose who were so anxiously waiting;

— shall suddenly come to his Temple; and here Simeon, Anna and others were waiting for him, Luke 2:22; appeared suddenly to dwell in the midst of his people, of his Church, even the Messenger of the Covenant, the Son of God Himself, whom ye delight in, namely, all those who still desire the covenant of the Lord with his people to he fulfilled;

— behold, so the announcement is once more made with impressive solemnity, he shall come, saith the Lord of hosts. This is the preaching of the Kingdom of God in order to prepare the hearts for the great coming of Yehovah.

2 “But who may abide the day of His coming? And who shall stand when He appeareth? For He is like a refiner’s fire and like fullers’ soap. — but who may abide the day of his coming? be able to endure that Day of Judgement upon the disobedient and secure? Cf Matthew 3:8-12; Luke 3:9. And who shall stand when he appeareth? Cf Joel 2:11.

— for he is like a refiner’s fire, separating pure doctrines from ones of dross compared to fire, Jeremiah 23:29; false ones shall be burned like chaff, or which separates the dross from the pure metal, and like fullers’ soap, thoroughly to cleanse the garment of His Church from all impurities;

— the Syriac version says, “as sulphur that makes white.”

3 And He shall sit as a refiner and purifier of silver; and He shall purify the sons of Levi, and purge them as gold and silver, that they may offer unto the Lord an offering in righteousness.

— and he shall sit as a refiner and purifier of silver, the entire Messianic era being a time of testing and of judgement, John 9:39, culminating in the final day of Judgement;

— and he shall purify the sons of Levi, for the judgement begins at the house of God, and purge them as gold and silver that they may offer unto the Lord an offering in righteousness, so that all the members of the Millenium priesthood, in fact, might serve him in holiness and righteousness;

— the “refiner’s fire” shall purify the sons of Levi; both the Boethusians, who hailed from the Egyptian paganism and the Hellenised Sadducees, who played harlotry with Greek gods, couldn’t escape the consuming inferno in AD 70. The Boethusians and the Sadducees were members of two Jewish sects that kept a heretic passover, and that flourished for a century or so before their destruction in the prophesied refiner’s purification of the Levites;

— but the inferno in AD 70 could also be a microcosm of the end-time Captivity!

For more into another Captivity: see Ezekiel Timeline – 190/40 Years
For more about a prophecy of Esau or Edom, see Obadiah
For more on the enemy from the South, see A Sword from the South!

4 Then shall the offering of Judah and of Jerusalem be pleasant unto the Lord, as in the days of old and as in former years.

— after the “refiner’s fire” then shall the offering of Judah and Jerusalem be pleasant unto the Lord, the entire Church worshiping him in spirit and in truth, as in the days of Moses, when the children of Israel were still in truth as His chosen.

5 “And I will come near to you in judgement; and I will be a swift witness against the sorcerers and against the adulterers, and against those who swear falsely, and against those who oppress the hireling in his wages, the widow and the fatherless, and those who turn aside the stranger from his right, and fear not Me,” saith the Lord of hosts.

— and I will come near to you to judgement, namely, the judgement of wrath upon the wicked; and I will be a swift witness against the sorcerers, the transgressors of the First and Second Commandments; the Targum says, “my Word shall be among you for a swift witness,”

— and against the adulterers, those disregarding the Sixth Commandment, and against false swearers, with reference both to the Second and the Eighth Commandments, and against those that oppress the hireling in his wages, by withholding them altogether or by underpaying him;

— for more, see: Who is Ephraim, a Chronic Liar?

— the widow, and the fatherless, as being without a natural protector, and that turn aside the stranger from his right, Cf Deuteronomy 27:19, and fear not me, saith the Lord of hosts, this last point indicating the source of all iniquity lack of the fear of the Lord.

6 “For I am the Lord, I change not. Therefore ye sons of Jacob are not consumed. — for I am Yehovah, I change not, I’m also the Everlasting, the Eternal indicating that He is the same from everlasting to everlasting;

— the Targum says, “for I the Lord have not changed my covenant.”

— therefore ye sons of Jacob are not consumed, literally, “and ye, the Sons of Jacob, ye are not yet consumed,” that is, the Lord will keep the true spiritual Israel safe while he sends his judgement upon the wicked in their midst. Even so the Church of God may also go into Captivity in the midst of hypocrisy and deceit, while the wicked will finally be destroyed;

— but some sects escaped death during the inferno of AD 70; were not consumed:

(1) the Christians, known as Nazarenes in Acts 24:5. They escaped to a northern town called Pella, west of the Jordan River; these were those that acknowledged Yeshua as the Messiah and keeping God’s laws, statutes and ordinances;

(2) the Hillel branch of Pharisees, those of the House of Hillel. They were headed by a Pharisaic rabbi, Johanan ben Zakkai, the head of the Sanhedrin, he was smuggled out of besieged Jerusalem in a coffin. They escaped to Yavne, and later to Tiberias; his followers re-emerged as Rabbinic Jews, who established the Hillel Calendar, which was revealed by Hillel II in about AD 359 concerning the rules of the calendar.

— the Shammites branch of Pharisees, together with the wicked Boethusians and Sadducees, all were deemed as chaff and were consumed during the inferno of AD 70. Take heed! This is God’s judgement!

7 “Even from the days of your fathers, ye have gone away from Mine ordinances and have not kept them. Return unto Me, and I will return unto you,” saith the Lord of hosts. “But ye said, ‘In what manner shall we return?’

— even from the days of your fathers ye are gone away from mine ordinances and have not kept them, this being the reason why he has withheld the fullness of his blessing and salvation from them. Return unto me, and I will return unto you, saith the Lord of hosts, his appeal being made in all sincerity, since he wants all men to be saved and to come to the knowledge of the truth;

— but ye said, still blind toward their transgressions, Where shall we return? They did not realize that the real service of Yehovah must be a growth from within, from a heart which lives in his fear, keeping his laws, statutes and ordinances. Therefore the prophet asks, in turn, in order to arouse them to a consciousness of the true meaning of worship,

8 Will a man rob God? Yet ye have robbed Me! But ye say, ‘Wherein have we robbed Thee?’ In tithes and offerings. — will a man rob God, defraud him? Is not the very idea preposterous and revolting? Yet ye have robbed me, actually trying to defraud Yehovah of the service which he rightly expected;

— but ye say, Wherein have we robbed thee? And the answer is, in tithes and offerings, keeping back from the priests and Levites their dues, for these the people had deliberately withheld, thus making a mockery of their worship of Yehovah.

9 Ye are cursed with a curse; for ye have robbed Me, even this whole nation. — ye are cursed with a curse, as a consequence of such behavior; for ye have robbed me, even this whole nation,

— for the practice rebuked was general among the people; the first-fruits of their ground and cattle and other offerings which were allotted to the priests, Deuteronomy 18:4, out of which revenue they were to provide the daily sacrifices and also to maintain the Levites, who attended upon the service in the Temple; therefore he admonishes them with great solemnity:

10 Bring ye all the tithes into the storehouse, that there may be meat in Mine house, and put Me to the proof now herewith,” saith the Lord of hosts, “if I will not open to you the windows of heaven and pour you out a blessing, that there shall not be room enough to receive it.

— bring ye all the tithes, the entire tithes, not only a part, into the storehouse, not keeping back a part, as heretofore, that there may be meat in mine house, provision for the daily sacrifices, and for the maintenance of the priests and Levites, as food for his servants, Numbers 18:24;

— and prove me now herewith, to find out whether he is not still the same righteous and holy God as of old, saith the Lord of hosts, if I will not open you the windows of heaven and pour you out a blessing, in plentiful harvests, that there shall not be room enough to receive it, your prosperity being practically limitless.

11 And I will rebuke the devourer for your sakes, and he shall not destroy the fruits of your ground, neither shall your vine cast her fruit before the time in the field,” saith the Lord of hosts.

— and God will rebuke the devourer for your sakes, not permitting the locusts or caterpillar or any such devouring creature that eats up the herbage, corn and fruits of trees; to devour the crops, to ravage the land; and these creatures shall not destroy the fruits of your ground, all the ordinary field-crops;

— neither shall your vine cast her fruit before the time in the field, saith the Lord of hosts, that is, that these devourers or locusts, that they should not cause the vine to be abortive; the grapes would not fall before they had matured.

12 “And all nations shall call you blessed, for ye shall be a delightsome land,” saith the Lord of hosts. — and when they shall see the land freed from the devouring locusts,

— all nations shall call you blessed, praising them for the obvious blessings which they enjoyed as a gift of Yehovah; for ye shall be a delightsome land, as seen by your neighbouring nations, an object of pleasure, saith the Lord of hosts.

13 “Your words have been defiant against Me,” saith the Lord. “Yet ye say, ‘What have we spoken so much against Thee?’

— you have spoken arrogantly against me, saith the Lord, namely, in the murmuring which he has rebuked above. Yet ye say, What have we spoken against thee? The Lord’s answer through his prophet is;

14 Ye have said: ‘It is vain to serve God; and what profit is it that we have kept His ordinance, and that we have walked mournfully before the Lord of hosts?

— when you said, ‘it doesn’t pay to serve God; what do we ever get out of it? It is vain to serve God, it does not pay; and what profit is it that we have kept his laws, statutes and ordinances, and that we have walked mournfully before the Lord of hosts? with all indications of deep sorrow and mourning over their sins. Their complaint was that it was poor business, that it did not pay.

15 So now we call the proud happy; yea, they that work wickedness are set up; yea, they that tempt God are even delivered.’”

— and now we call the proud and arrogant, they had actually reached the stage when they praised the wicked, with their apparent happiness in matters of this world; yea, they that work wickedness are set up, they abound in riches and honours; they are set in high places; they are the lucky ones, in their presumptuous opinion;

— yea, they that tempt God are even delivered, as if they tried to provoke him, even these men escape those dangers and calamities; they have no misfortune, they have everything that their heart desires; they seem to escape judgement and go on with impunity.

16 Then those who feared the Lord spoke often one to another, and the Lord hearkened and heard it. And a book of remembrance was written before Him for those who feared the Lord and who thought upon His name.

— then, namely, when the scoffers were making these blasphemous remarks, they that feared the Lord spoke often one to another, they made it a practise to encourage one another over against such blasphemous talk;

— and the Lord hearkened and heard it, by the omniscience of God, who hearkens and hears everything; he paid attention to their remarks, and a book of remembrance, records, annals and chronicles was written before him for them that feared the Lord and that thought upon his name, the subject of their conversations being things which pertained to his glory.

17 “And they shall be Mine,” saith the Lord of hosts, “in that day when I make up My jewels; and I will spare them as a man spareth his own son who serveth him.

— and they shall be mine, saith the Lord of hosts, the precious people of his inheritance, 1 Peter 2:9, in that day when God make up his jewels, when he would impart to them the fullness of his glory;

— and God will spare them, in manifesting his tender mercies upon them and as a man spareth his own son that serveth him, ready to show his love and goodness in such an instance.

18 Then shall ye return and discern between the righteous and the wicked, between him that serveth God and him that serveth Him not.

— then shall ye, those who were now grumbling, return and discern between the righteous and the wicked, noting the difference between the two classes, the difference between such who are really and truly righteous, who are here meant, even such who believe in Christ and keeping his laws, statutes and ordinances;

— those that are justified by his righteousness; and those that are wicked, also in the manner in which God dealt with them, between him that serveth God and him that serveth him not. The time of judgement is still at hand, but infidels and scoffers and by their characters and judgement that will be issued to them by the Judge; and the different sentences passed and executed on them;

— doing his commandments is the final reward, that is, fulfilling the laws, statutes and ordinances:

I am Alpha and Omega, the Beginning and the End, the First and the Last.”

Blessed are they that do His commandments, that they may have right to the Tree of Life, and may enter in through the gates into the city. Revelation 22:13-14

Malachi 4

1 “For behold, the day cometh that shall burn as an oven; and all the proud, yea, and all that do wickedly shall be stubble. And the day that cometh shall burn them up,” saith the Lord of hosts, “that it shall leave them neither root nor branch.

— for, behold, the day cometh, the day before Christ’s return, reaching to a global destruction, is compared to a burning oven; the wicked to stubble, whose ruin would be utter and complete being considered a day of sifting;

— because it culminates in the Day of Judgement, that shall burn as an oven, one which holds the refiner’s fire; and all the proud, yea, and all that do wickedly, shall be stubble, under the fire of His wrath, Cf Matthew 3:10-12;

— and the day that cometh shall burn them up, saith the Lord of hosts, Cf Isaiah 5:24; Zephaniah 1:18, that it shall leave them neither root nor branch, which signifies complete destruction; the final, eternal destruction of the wicked being coincidental with the last Judgement. Such is the terrible fate of those who do not avail themselves of the Lord’s mercy.

2 But unto you that fear My name shall the Sun of Righteousness arise with healing in His wings; and ye shall go forth and grow up as calves from the stall.

— but unto you that fear God’s name, Malachi 3:16, whose names were written in the book of remembrance; who loved the laws of their God, and kept them, shall the Sun of Righteousness, the Messiah, with the fullness of his power;

— arise with healing in His wings, by which are meant its rays and beams of his righteousness sent out through his Word; and ye shall go forth, with joyfully uplifted heads, and grow up as calves of the stall, in strength, vigour and spiritual stature, nourished by the Word of God. Cf John 1:14.

3 And ye shall tread down the wicked, for they shall be ashes under the soles of your feet in the day that I shall do this,” saith the Lord of hosts.

— and ye shall tread down the wicked, whose final overthrow is consistently prophesied in Scripture; for they shall be ashes under the soles of your feet, the ashes of the wicked, powerless and worthless; like the ashes of the Boethusians and the Sadducees, were destroyed in the inferno of Jerusalem, and many of them burned to ashes in the flames in the latter day by which it will similarly be consumed.

— in the day that God shall do this, saith the Lord of hosts. All believers are happy in their faith, in the enjoyment of God’s mercy; they enjoy true liberty and will finally celebrate an eternal victory over all their enemies. The prophet therefore, in concluding his message, adds an admonition:

4 “Remember ye the Law of Moses, My servant, which I commanded unto him in Horeb for all Israel, with the statutes and judgements. — remember ye the Laws (statutes and ordinances) of Moses, God’s servant; they were apt to forget: hence this exhortation is given now,

— because no other prophet after Malachi would be sent unto them, which God had commanded unto him in Horeb for all Israel, with the statutes and judgements, the Word which contained His solemn covenant; to be observed by the children of Israel, and which were shadows of things to come;

5 “Behold, I will send you Elijah the prophet before the coming of the great and dreadful day of the Lord. — behold, God will send you Elijah, the prophet, a prophet like him,

— namely, John the Baptist, the forerunner of the Messiah, Matthew 11:10-14; Matthew 17:10-13; Luke 1:17, before the coming of the great and dreadful Day of the Lord, Joel 2:31, namely, before the Lord himself would begin his administration, which ushered in the Millennium, just after the Final Judgement;

6 And he shall turn the heart of the fathers to the children, and the heart of the children to their fathers, lest I come and smite the earth with a curse.” — and “Elijah the prophet” shall turn the heart of the fathers to the children and the heart of the children to their fathers,

— this shows in what John’s office would consist: in the turning of men to God, and uniting the father and children in one act of reconciliation: so that the father will turn to the religion of his son who is converted to Christ, and the son will embrace the faith of their true fathers: Abraham, Isaac and Jacob;

— in having them both realize the love of the Father in sending his Son, the Messiah and in the subsequent salvation wrought for all men, Luke 1:17, or uniting the Chosens of the Old Testament who are their fathers in the faith to Elects of the New who are their children; or a link between the testaments;

— lest the Lord of hosts will come and smite the earth with a curse, namely, in the event that men will not heed the preaching of repentance and the forgiveness of sins. The Jews as a nation rejected the Messiah and have come under the curse as in AD 70 and AD 132. But this did not result in the overthrow of the Kingdom of God and the Church. The Elect, rather, has heeded and is heeding the Word of God and would enjoy the fullness of the blessings promised throughout the Old and New Testament; thus uniting the messages of both the Father and Son. Selah!

And finally, after the Final Judgement, these are the true elect—all have the common traits of keeping God’s Commandments—that shall be saved:

“And the dragon was wroth with the woman, and he went to make war with the remnant of her seed, who keep the commandments of God, and have the testimony of Jesus Christ” Revelation 12:17

“Here is the patience of the saints: here are they that keep the commandments of God, and the faith of Jesus” Revelation 14:12

“Blessed are they that do His commandments, that they may have right to the Tree of Life, and may enter in through the gates into the city” Revelation 22:14

Malachi (Ch 1-2)

•June 29, 2023 • Leave a Comment

Malachi spoke to the Jewish exiles some 100 years after their initial return, after the days of Zechariah and Haggai; he served God either at the time of Nehemiah or immediately after his time. So although Zechariah was the last of the prophets, the more commonly accepted opinion is that Malachi was the last; hence he was regarded “the end of the prophets.”

Malachi 1

1 The burden of the word of the Lord to Israel by the hand of Malachi. — the burden of the word of the Lord to Israel; by which is meant the prophecy of this book, so called because it is heavy, burdensome and distressful, either for the prophet to carry or the people to bear;

2 “I have loved you,” saith the Lord. “Yet ye say, ‘Wherein hast Thou loved us?’ Was not Esau Jacob’s brother?” saith the Lord. “Yet I loved Jacob,

— God reminds them that the Idumeans, were descended from Abraham as well as they, and from a progenitor who was their own brother to their progenitor Jacob: the message was that the birthright may not have been given to Jacob but more importantly it was God’s love to the house of Israel;

— who is Esau today? The answer lies in the book of Obadiah; and Jonathan Targum identifies Esau (Sepharad of the Southland identified) as Spain! Obadiah 1:20; the Targums identified Sepharad with Spain, hence, Spanish Jews are called Sephardim;

Wikipedia: Sepharad (/sɛfəræd/or səˈfɛərəd/ Hebrew: סְפָרַד Sp̄āraḏ; also Sefarad, Sephared, Sfard) is the Hebrew name for Spain. A place called Sepharad, probably referring to Sardis in Lydia (‘Sfard’ in Lydian), in the Book of Obadiah (Obadiah 1:20, 6th century BC) of the Hebrew Bible. The name was later applied to Spain. (Later version of wikipedia, as above, changed it to “Iberian peninsula.”

3 and I hated Esau, and laid his mountains and his heritage waste for the dragons of the wilderness.” —and God hated Esau, or “rejected” him as the Targum says;

— God did not love him as Jacob: even though both were equally descended from Abraham, had an equal claim to his blessing; they lay in the same womb together; they were twins; and if any could be thought to have the advantage by birth, Esau had it, being born first; Genesis 25:23; Esau is Edom Genesis 36:8);

— for the dragons of the wilderness; so called to distinguish them from sea dragons and these land dragons are no other than serpents of an enormous size; were found in the mountains; such as were bred in caves or in the flat country; and such as were found in fens and marshes;

Genesis 27:39; “Your dwelling will be away from the richness of the earth and away from the dew from the sky above” so the Targum renders it, “into the wasteness of the desert” or into a waste desert where none but such sort of animals inhabit;

— one Report by McKinsey says of the 60 millions Latinos in US, they often live in ‘deserts’ where adequate housing, groceries are hard to find. “Nearly 9 in 10 of the Latino residents in such communities lived in five states: California, Florida, New Jersey, New York and Texas.”

McKinsey: Latinos are projected to make up 22.4 percent of the US labor force by 2030 and more than 30 percent by 2060 (Latinos population to 111.2 million by ’60).

4 Whereas Edom saith, “We are impoverished, but we will return and rebuild the desolate places;” but thus saith the Lord of Hosts: “They shall build, but I will throw down; and they shall call them the Border of Wickedness and the people against whom the Lord hath indignation forever.

— whereas Edom saith, We, or the Idumeans, are impoverished; the posterity of Esau, who live South of the children of Jacob, acknowledging themselves being greatly reduced by the desolations made in their country, cities, towns and houses, being plundered of all their valuable things; as if the Edomites should know they are poor and impoverished and their land is laid waste:

— they shall build, but the Lord will throw down; they attempted to rebuild their cities and towns, but could not succeed, God was against them; the Spanish Empire at its height in the mid-18th century governed 13% of the world’s land – 7.5 million square miles; but since then they could never reclaim that status.

The Spanish Empire at the height of its power in the mid-18th century

— and the people against whom the Lord hath indignation forever; not for seventy years only, as against the Jews, Zechariah 1:12, but those from the posterity of Edom are to be poor, impoverished and despised forever;

— a parallel description of the Edomites in an earlier study of the Prophecy of Obadiah

“Behold, I have made thee small among the nations; thou art greatly despised. Obadiah 1:2 — thou art greatly despised; another parallel in Jeremiah 49:15 “For lo, I will make thee small among the nations and despised among men,” as the term beaners (Latinx or Latinos?) could allude to. The southern wall in the United States is “the Border of Wickedness.”

Rashi: Behold I have made you small: In contrast with what his father called him, his big son, and his mother called him her big son, the Holy One, blessed be He, says: In My eyes, he is small. And our Sages expounded: small for they have neither script nor language.

5 And your eyes shall see, and ye shall say, ‘The Lord will be magnified from the border of Israel.’ — and your eyes from the house of Jacob shall see… the destruction of the Edomites,

— and their fruitless attempts to rebuild their desolate places; and the difference between them and the Israelites, who were returned to their own land and inherited it, when they could not; and the love of God to the one, and his hatred of the other:

— and ye shall say, the Lord will be magnified from the border of Israel; following the Mexican-American War that ended in 1848, the United States magnified their border by more than 500,000 square miles (1,300,000 square km) of land from Mexico, expanding US territory by about one-third. Mexico ceded nearly all the territory now included in the US states of New Mexico, Utah, Nevada, Arizona, California, Texas, and western Colorado for $15 million and US assumption of its citizens’ claims against Mexico; (Cf  Habakkuk 2:8)

— and so the Targum says, “let the glory of the Lord be multiplied, because he hath enlarged the border of Israel’ – all to show that God had loved them more than others and therefore they ought to have honoured, obeyed and loved him, in which they were deficient and ungrateful.

6 “A son honoreth his father, and a servant his master. If then I be a father, where is Mine honor? And if I be a master, where is the fear of Me? saith the Lord of hosts unto you, O priests, who despise My name. And ye say, ‘Wherein have we despised Thy name?’

— a son honoreth his father and a servant his master, in agreement with the commandment of God; If, then, I be a Father, where is mine honor? Why were they persisting in their unnatural behavior and denying him the obedience which he had a right to expect? and so the Targum says, “lo concerning a son it is said (or commanded) that be should honour his father; and of a servant, that he should fear (or show reverence) before his master;”

— and if I be a Master, where is my fear? fear and reverence are due to the Lord from his people, considered in such a relation to them; both a fear of wrath and punishment; and also a Godly filial fear, Why did they not give him the reverence and respect which were his due? asked the Lord of hosts unto you, O priests, that despise my name, who ought to have honoured and feared the Lord; and yet they despised his name, or made it contemptible; by not paying that regard to his authority, as a Father and master:

— and ye say, as if honestly resenting the charge against them or pretending to be innocent and guiltless, Wherein have we despised thy name? the priest were very ones who should have been leaders in such worship in keeping and the teaching of the Law and ordinances.

7 Ye offer polluted bread upon Mine altar; and ye say, ‘Wherein have we polluted Thee?’ In that ye say: ‘The table of the Lord is contemptible.’

— ye offer polluted bread upon mine altar, in connection with some of the offerings brought to the Lord; not made of fine wheat flour, nor of pure frankincense put upon or by each row, as the law required, Leviticus 24:5;

— and ye say, wherein have we polluted thee? In that ye say, The table of the Lord is contemptible, their practise of offering sacrifices which were expressly forbidden by God and their manner in the entire administration of their work being an insult to the holiness of the God Almighty. Cf Leviticus 22:21-22.

8 And if ye offer blind animals for sacrifice, is that not evil? And if ye offer the lame and sick, is that not evil? Offer it now unto thy governor! Will he be pleased with thee or accept thy person?” saith the Lord of hosts.

— and if ye offer the blind for sacrifice, is it not evil? or “there is no evil” that is, in their opinion. And if ye offer the lame and the sick, is it not evil? this of the daily meat offering, which went along with the daily sacrifice of the lambs, and part of which was burnt on the altar, Exodus 29:40 or rather this designs sacrifice in general, sometimes called “bread” Leviticus 3:11;

— and so the Targum says, “ye offer upon my altar an abominable offering” such as having blemishes in them, were blind or lame; and thus not the requisites of a sacrifice in them; or were offered not in a right manner, or by bad men or those with a wicked mind;

— offer it now unto thy governor, so the Lord ironically bids them do; will he be pleased with thee or accept thy person? asked the Lord of hosts; will he thank thee for it? or on the contrary, will he not resent it as an affront to him? and if so it would be with an earthly prince, how can it be thought that to offer the blind, lame and sick should be acceptable to the King of kings and Lord of lords?

9 “And now, I pray you, beseech God that He will be gracious unto us. This has been by your hand: Will He regard your persons?” saith the Lord of hosts.

— and now, Malachi prays unto them, beseech God that he will be gracious unto you: these are the words of the prophet to the priests; and are spoken either seriously, exhorting them to that part of their office which lay in interceding for the people that God would be gracious to them, and forgive their sins;

— this hath been by your means, that is, this their hand had done; that such sacrifices were offered up; they indulged the people in such practices and encouraged them; the fault was theirs; or this curse, as from Malachi 1:14:

— now try asking God to be kind to you; will he welcome you? Can you ever imagine that God will have any respect to your prayers, when you have acted so vile a part, and been the cause of so much sin and evil? no, he will not, as is asserted in the next verse:

10 “Who is there even among you who would shut the doors for nought? Neither do ye kindle fire on Mine altar for nought. I have no pleasure in you,” saith the Lord of hosts, “neither will I accept an offering from your hand.

— there were four and twenty porters to open and shut the doors, four on each side; yet the Lord asked, is there any among you who would shut the doors to the Temple at even for me?

— so that you could not light fires on my altar for no reason. If one would but lock the doors leading to the altar of burnt offering, in order to keep anyone from bringing any vain oblations! I have no pleasure in you, saith the Lord of hosts, being thoroughly disgusted at the lack of care with their custodianship, neither will God accept an offering at your hand, no matter of what kind it was.

11 For from the rising of the sun even unto the going down of the same, My name shall be great among the Gentiles. And in every place incense shall be offered unto My name, and a pure offering; for My name shall be great among the heathen,” saith the Lord of hosts.

— for from the rising of the sun even unto the going down of the same, as far as the world extends, God’s name shall be great among the Gentiles, including those recruits gained for the Church of the New Testament from the heathen world;

— and in every place incense, namely, that of the prayers of the faithful, shall be offered unto God’s name and a pure offering, on the part of those who had accepted the God of the covenant as their God; for my name Yehovah shall be great among the nations, saith the Lord of hosts, for the kingdom of God was started by the Jews (through the Messiah Yeshua and his twelve apostles), then to be expanded to the other tribes and then to all the nations;

— Rashi: My Name is great among the nations: Our Sages stated (Men. 110a): For they call Him the God of the gods. Even one who has an idol knows that He is the God Who is over all of them. Our Sages, explained: these are the scholars who are engaged in the laws of the Temple service everywhere, and likewise, every prayer of Israel that they pray anywhere is to Me as a pure oblation and My great Name is sanctified through you, and your prayer is like a pure offering before Me. This is the explanation of the verse: Now why do you profane My Name? Is it [that I am] not great among the nations?

— God’s name is the four-letter Hebrew word יהוה‎ YHVH Yehovah (not Jehovah since the letter J wasn’t around but only after the sixteenth century; (more on this at the end)

12 “But ye have profaned it in that ye say, ‘The table of the Lord is polluted; and the fruit thereof, even His meat, is contemptible.’

— but ye have profaned it, that is, the name of the Lord, which they are said to despise, Malachi 1:6 and pollute, Malachi 1:7 and is a reason why they and their offerings were rejected: in that ye say, The table of the Lord Is polluted, Cf v. 7, and the fruit thereof, even his meat is contemptible; the word for fruit as sometimes use as figure of speech, the fruit of the lips, Isaiah 57:19.

13 Ye said also, ‘Behold, what a weariness is it!’ And ye have sniffed it,” saith the Lord of hosts. “And ye brought that which was torn and the lame and the sick; thus ye brought an offering! Should I accept this from your hand?” saith the Lord.

— ye said also, Behold, what a weariness is it! these are either the words of the priests, saying what a wearisome and fatiguing duty the temple service was to them, for which they thought they were poorly appreciated; such as slaying the sacrifices; removing the ashes from the altar; putting the wood in order; kindling the fire, and laying the sacrifice on it: or of the people that brought the sacrifice, who, when they brought a lamb upon their shoulders, and laid it down, said, how weary are they in bringing it, suggesting it was so heavy, fat and fleshy;

— and ye have snuffed at it, saith the Lord of hosts; ye have puffed and panted and blown as persons weary with bringing such a heavy lamb, when it was so light that, if it was blown at, it would fall to the ground; or publicly showing other contempt for the work of their Temple;

— and the whole should render, “and ye have grieved me” that is, the Lord, by bringing such sacrifices, and complaining of weariness and by your hypocrisy and deceitfulness;

— and ye brought that which was torn and the lame and the sick, in a contemptuous disregard for the Lord; thus ye brought an offering: should I accept this at your hand? asked the Lord.

14 “But cursed be the deceiver who hath in his flock a male, and vow and sacrifice unto the Lord a corrupt thing. For I am a great King,” saith the Lord of hosts, “and My name is dreadful among the heathen.

— but cursed be the deceiver; a cunning, crafty, subtle man who thinks and contrives, speaks and acts in a very artful and deceiving manner; which hath in his flock a male, without spot and blemish as the law requires for sacrifice;

— and vow and sacrifice to the Lord a corrupt thing; that was a female or had blemishes in it; for the law required what was perfect and without a blemish for a vow; what was superfluous or deficient in its parts might do for a freewill offering, but not for a vow,

— for I am a great King, saith the Lord of hosts; the King of the whole world, the King of kings and Lord of lords; and therefore to be honoured and reverenced suitable to his dignity and greatness;

— and my name is to be feared among the nations; because of God’s judgements executed to the house of Israel for 190 years and the house of Judah for 40 years; for details, see Ezekiel 4 – 390/40 Years;

— God’s name is the four-letter Hebrew word יהוה‎ YHVH Yehovah (not Jehovah since the letter J wasn’t around but only after the sixteenth century; (more on this at the end)

Malachi 2

1 “And now, O ye priests, this commandment is for you. — and now, O ye priests, those that even dare to despise and profane the name of the Lord;

— that suffered such corrupt and illegal sacrifices to be brought and offered up: these commandment and judgement are for them, they must be aware of the seriousness of the situation and accept the Lord’s rebuke and threat accordingly.

2 If ye will not hear, and if ye will not lay it to heart to give glory unto My name,” saith the Lord of hosts, “I will even send a curse upon you, and I will curse your blessings. Yea, I have cursed them already, because ye do not lay it to heart.

— if ye will not hear and if ye will not lay it to heart, if they persisted in your callousness over against God’s commands, to give glory unto my name, saith the Lord of hosts, by a worship in agreement with His commands;

— I will even send a curse upon you, and I will curse your blessings, both upon priests and people; those that bring the bad offerings, such as their corn, wine and oil; yea, God have cursed you already because you do not lay it to heart, presenting an indifferent front to the Lord’s admonitions.

3 Behold, I will corrupt your seed and spread dung upon your faces, even the dung of your solemn feasts; and one shall take you away with it.

— behold, God will corrupt your seed, rebuking that which had been sowed in the fields, thus reducing also the amounts which the priests received as tithes and spread dung upon your faces as an expression of His extreme contempt;

— even the dung of your solemn feasts, that of the excesses of such pagan feasts (1) Astarte, the queen of heaven; from whom Easter is derived; Jeremiah 7 and Jeremiah 44; (2) the palm tree, Mithra, the sun-god, now proliferates during Christmas; with decorated with lights, tinsel, red and green ribbon, poinsettias and other crowning glory; Jeremiah 10:3-5;

— (3) heavenly bodies, especially the Sun, hence professing Christians have shifted the Sabbath from Saturday to Sunday by outlawing the keeping of the Sabbath. — thus saith the Lord: “Learn not the way of the heathens. . .”  Jeremiah 10:2; his wrath and subsequent judgement of throwing dungs onto our faces is the central theme of Jeremiah’s message against idolatrous worship!

— and one shall take you away with it, treating them as though they were themselves dung, to be thrown out in disgraceful heaps; with the dung spread upon them; they looking like a heap of dung, being covered with it, and had in no more account than that;

— the Targum says, “I will make manifest the shame of your sins upon your faces; and will cause to cease the magnificence of your feasts.”

Remember: the Targum is another source of the Bible. Started by Ezra for those returning from Babylon and for these returnees they could only understand in Aramaic; hence the Targum is as if Ezra is speaking to them in ancient times and to us from the verses quoted.

4 And ye shall know that I have sent this commandment unto you, that My covenant might be with Levi,” saith the Lord of hosts.

— and ye shall know, by the token of this punishment, that I have sent this commandment unto you, this decree of covenant and punishment which they thought they might so calmly disregard, that my covenant might be with Levi, who were the Levites, including the priests;

— especially in Leviticus 23 regarding all of God’s feast days, involving all the priests and Levites, saith the Lord of hosts. The Lord’s sentence of punishment upon all those who despised his worship was included in the original covenant through the tribe of Levi to be teachers and light to others: first to the house of Jacob then to rest of the world.

5 “My covenant was with him of life and peace, and I gave them to him for the fear with which he feared Me and was afraid before My name. — my covenant was with the priests and Levites of life and peace, with the promise of life and peace attached; and God gave them, namely, life, deliverance and salvation;

— to the priests and levites for the fear wherewith they feared me, as an example to the rest of the world as a reward for leadership with this attitude, and was afraid before my name, Cf Numbers 25:12;

— the Targum says, “I gave him the perfect doctrine of the law, or the doctrine of the perfect law that he might fear before me.”

— God’s name is the four-letter Hebrew word יהוה‎ YHVH Yehovah (not Jehovah since the letter J wasn’t around but only after the sixteenth century; (more on this at the end)

6 The law of truth was in his mouth, and iniquity was not found on his lips. He walked with Me in peace and equity, and turned many away from iniquity.

— the Truth of the Law was with the tribe of Levi, so that everything which they did and taught was in agreement with divine truth, and iniquity should not be found in their lips;

— they walked with me in peace and equity, in an ideal situation of peace, integrity and righteousness and did turn many away from iniquity, this being the praise which the Lord bestowed upon true members of the tribe of Levi in setting an example.

7 For the priest’s lips should keep knowledge, and they should seek the law at his mouth; for he is the messenger of the Lord of hosts.

— as teachers of the covenant the priest’s lips should keep and teach knowledge, preserving the right understanding of Yehovah worship among the people as a precious treasure, and they, the people, should seek the Law at the mouth of the priests, to be instructed by them; for they are messengers of the Lord of hosts. That is what the Lord found praiseworthy in members of the tribe of Levi in the early days of Moses; that it should continue as it should he.

8 But ye have departed from the way; ye have caused many to stumble at the law; ye have corrupted the covenant of Levi,” saith the Lord of hosts.

— but ye, the present members of the tribe are departed out of the way, leaving the path shown them by the Law of the Lord; ye have caused many to stumble at the Law, you have either perverted the sense of the law, or encouraged others to break it by your bad example; so that they became guilty of transgressing the Law;

— ye have corrupted the covenant of Levi by your evil practices you have broken or rendered void that covenant: by your not performing that part of the covenant which the tribe of Levi was bound to perform; or you have disengaged God from performing his part, or fulfilling those promises which God had engaged to make good to them on the performance of certain conditions on their side, saith the Lord of hosts.

9 “Therefore have I also made you contemptible and base before all the people, according as ye have not kept My ways but have been partial in the law.”

— therefore have God also made you contemptible and base, an object of contempt and loathing when your city and temple were destroyed by the Romans in 70 AD, and they were carried away again as captives and slaves and became a taunt and a proverb in all places where they went to:

— before all the nations of the world among whom you were scattered: according as ye have not kept my ways, in the same degree as they had transgressed, but have been partial in the Law, in applying the Law to the conduct of the people; in the observance of it, attending to the lesser and taking no notice of the weightier matters when required.

10 Have we not all one Father? Hath not one God created us? Why do we deal treacherously every man against his brother by profaning the covenant of our fathers?

— have we not all one Father? Hath not one God created us? These questions, the sense of these words, that there ought to be no partiality used in the law, or any respect had to persons, in that the rich and the poor have all one Father and one Creator;

— why do we deal treacherously, faithlessly, by perverting justice, having respect to persons, favouring one to the prejudice of another, every man against his brother, by profaning the covenant of our fathers? the covenant made with them at Sinai, the law that was then enjoined them, particularly such as forbid respect of persons, Leviticus 19:15; which should govern all their lives.

11 Judah hath dealt treacherously, and an abomination is committed in Israel and in Jerusalem; for Judah hath profaned the holiness of the Lord which he loved, and hath married the daughter of a strange god.

— Judah hath dealt treacherously, with a disregard of the covenant of impartiality, not only every man against his brother, by being partial in the law; and an abomination is committed in Israel, throughout the nation, in Judah and in Jerusalem, the capital, which should have led in the observance of the Law;

— for Judah hath profaned the holiness of the Lord which He loved, namely, the people as a body, whom the Lord had chosen as his holy people, as the Targum says of Judah, who was holiness to the Lord; and others of the holy place, the sanctuary and all holy things belonging thereto;

— and hath married the daughter of a strange god, by the fact that numerous members of the nation had entered into the marriage relationship with women addicted to idolatry, an act which was distinctly prohibited in the Law of God, Exodus 34:11Deuteronomy 7:1-4; as the Targum paraphrases thus, “and they were pleased to take to them wives, the daughters of the people” the Gentiles;

— King Herod took the daughter, Mariamne, of Boethus (of Egypt of the high-priestly family of Boethus: Simon, son of Boethus from Alexandria) to wife and made her father the high priest of Jerusalem; they lived in luxurious splendor, using silver and golden vessels all their lives; hence the birth of profanity serving in the Temple of Jerusalem.

12 The Lord will cut off the man who doeth this — the master and the scholar — out of the tabernacles of Jacob, and him that offereth an offering unto the Lord of hosts.

— the Lord will cut off the man that doeth this, he is guilty of such treachery and idolatry: or “to the man that doeth this” all that belong to him, his children and substance: it denotes the utter destruction, not of a single man and his family only, but of the whole Jewish nation and its polity, civil and ecclesiastical;

— since it was a profanation of the sacred position of the people, the master and the scholar, or “the watcher and the answerer,” out of the tabernacles of Jacob, and him that offereth an offering unto the Lord of hosts, so that there would be a complete exile, expulsion and captivity of all those who had transgressed;

— they shall “be cut off” – the Boethusians and the Sadducees, members of two Jewish sects that kept a heretic passover, and that flourished for a century or so before their destruction with Jerusalem in AD 70 inferno. (The Hellenised Sadducees who played harlotry with the Greeks couldn’t escape the same fate)

13 And this have ye done again, covering the altar of the Lord with tears, with weeping, and with crying out insomuch that He regardeth not the offering anymore, nor receiveth it with good will from thy hand.

— and this have ye done again, as another transgression which the Lord found it necessary to rebuke their prayers, covering the altar of the Lord with hypocritical tears with weeping and crying aloud, to come to the Sanctuary and there register their lament over the injustice received; pretending great humiliation for their sins:

— insomuch that he, the God of the covenant, regardeth not the offering any more or receiveth it with goodwill at their hand, he wanted nothing of their worship and expresses an utter rejection and abrogation of their sacrifices.

14 Yet ye say, “Why?” Because the Lord hath been witness between thee and the wife of thy youth, against whom thou hast dealt treacherously; yet she is thy companion and the wife of thy covenant.

— yet ye asked, apparently surprised that the Lord should repudiate their prayers, Wherefore? Because the Lord hath been witness between thee and the wife of thy youth, every true marriage being entered into with his sanction and the Lord therefore being the witness for the rights of the wife;

— against whom thou hast dealt treacherously, in breaking the promised faith, the troth which had been plighted; yet is she thy companion, the partner of her husband’s joys and sorrows, and the wife of thy covenant, she with whom the husband had entered into the relation controlled by a mutual promise.

15 And did not He make one? Yet had He the residue of the spirit. And why one? That He might seek a godly seed! Therefore take heed to your spirit, and let none deal treacherously against the wife of his youth.

— and did not he make one? Yet had he the residue of the spirit, literally, “And not one acted so who still had a particle of reason,” that is, this manner of acting was unknown among men of reason. Of course, the people might raise the objection, And wherefore one? What did Abraham do when he repudiated Hagar?

— that he might seek a godly seed. The object of Abraham in going in to Hagar was not to gratify the lust of the flesh, but he honestly thought that he might thus get the son whom God had promised him. Therefore, Malachi concludes, take heed to your spirit, watching over themselves with the greatest care, and let none deal treacherously against the wife of his youth, namely, by lightly dismissing her.

16 “For the Lord, the God of Israel, saith that He hateth putting away; for one covereth violence with his garment,” saith the Lord of hosts. “Therefore take heed to your spirit, that ye deal not treacherously.”

— for the Lord, the God of Israel, saith that he hateth putting away, Cf Deuteronomy 24:1; for one covereth violence with his garment, or “iniquity covers his garment,” saith the Lord of hosts so that it would cling to him forever;

— therefore take heed to your spirit that ye deal not treacherously. The same thought is found in the New Testament, not only in various sayings of Jesus concerning the sanctity of the marriage covenant, but also in the words of Peter regarding the living together of a man with his wife according to reason. Cf 1 Peter 3:7.

17 Ye have wearied the Lord with your words. Yet ye say, “Wherein have we wearied Him?” When ye say: “Every one who doeth evil is good in the sight of the Lord, and He delighteth in them,” or “Where is the God of judgement?”

— ye have wearied the Lord with your words, with their dissatisfied grumbling over recent events. Yet ye say, Wherein have we wearied him? the same disobedient people again standing out in opposition to God, in resenting the rebuke of Malachi, His prophet;

— when ye say, Every one that doeth evil is good in the sight of the Lord, and he delighteth in them, such as homosexuality and the LGBTqia or LGBTQ+ movement which is sinful because it goes against God’s nature and revelation in Scripture; this being the statement of godless insolence in direct opposition to the rebuke of the prophet Malachi, or

— Where is the God of judgement? Since you see that the way of the wicked prospers, and the righteous are afflicted and stumble; hence the great mass of the people boldly declared that there was no foundation for the prophet’s threat, that the talk of the coming Judgement was unfounded. Cf II Peter 3:4. Over against this question of doubt and unbelief the Lord places a very definite statement.

“Thou shalt not lie with mankind as with womankind: it is abomination” Leviticus 18:22

Grace and mercy come with keeping of His laws, statutes and ordinances; otherwise,

“The anger of the Lord shall not return, until He has executed and till He has performed the thoughts of His heart; in the latter days ye shall consider it perfectly” Jeremiah 23:20.

~~~

More on God’s name, Yehovah.

God’s name is the four-letter Hebrew word יהוה‎ YHVH Yehovah, which are embedded in the Masoretic text over 6000 times, yet when translated into our English language most had been translated as Lord, or LORD, which are titles, but not his name. His name is יהוה‎ Yehovah, or YEHOVAH (but there are no capital letters in Hebrew).

It wasn’t until 1524 that Gian Giorgio Trissino, an Italian Renaissance grammarian, invented the letter J that this new letter started to take a hold in the writings of western Europe. Even in 1611 when the English Bible the King James has our subject of study by the prophet Jeremiah, he was known as Ieremiah. So Jehovah is a very late comer.

The following verses with the LORD erred in translation. His name Yehovah should be used:

I am the LORD; that is My name. And My glory will I not give to another, neither My praise to graven images. Isaiah 42:8

And it shall come to pass, that whosoever shall call on the name of the LORD shall be delivered; for in Mount Zion and in Jerusalem shall be deliverance, as the LORD hath said, and in the remnant whom the LORD shall call. Joel 2:32

“I am sought of them that asked not for Me; I am found of them that sought Me not. I said, ‘Behold Me, behold Me,’ unto a nation that was not called by My name. Isaiah 65:1

When we call our God, the LORD, we err, because his name is not the LORD, which is a title. His name is YEHOVAH! May We all ask for his forgiveness, and may Our merciful God forgive us all.

A Study Index of Hosea

•June 28, 2023 • Leave a Comment

The Prophecy of Hosea is primarily to the house of Ephraim (mentioned 32 times in this book, Hosea, and more than in any other books of the Bible). Often, as Ephraim being the chief tribe of the ten tribes, the name is used in place of Israel (used 41 times) when it is referring to the northern kingdom.

Elsewhere on this site Ephraim has been established as the United States. So although Hosea may refer to situation in his time, the encrypted message of Ephraim and Israel is specially meant primarily for the United States or the “Anglosphere” and secondarily its European allies.

Chapter 1

— the word of the Lord that came unto Hosea
— “Go, take unto thee a wife, Gomer, of whoredoms
— and bore him a son: “Call his name Jezreel; the scattered ones
— and bore a daughter: “Call her name Loruhamah; not having mercy
— for I will no more have mercy upon the house of Israel
— and bore a son :“Call his name Loammi, not My people
— for ye are not My people, and I will not be your God
— yet the children of Israel shall be as the sand of the sea

~ Chapter 2

— now were “Ammi,” the Lord’s people; and who had not
— but now have, “Ruhamah,” obtained mercy
— for their mother hath played the harlot; conceived shamefully
— and I will also cause all her mirth to cease, her feast days,
— her new moons, and her sabbaths, and all her solemn feasts
— (a) Christmas, which honors Mithraism
— (b) Easters, a celebration of Ishtar
— (c) her Sunday sabbaths, the original keepers were Samaritans

A Study of Chapters 1 and 2 HERE ~ —— ~

Chapter 3

— “Go yet, love a woman, a different woman, yet an adulteress
— according to the love of the Lord toward the children of Israel
— who look to other gods and love flagons of wine”
— So I bought her for myself for fifteen pieces of silver
— For the children of Israel shall abide many days without a king
— and without a prince, and without a sacrifice
— “in the latter days,” the house of Israel will end their abandonment

~ Chapter 4

— Hear the word of the Lord, ye children of Israel
— “By swearing and lying, and killing and stealing
— and committing adultery, they break out and blood toucheth blood
— therefore shall the land mourn, and thou shalt fall in the day
— and the prophet shall also fall with thee in the night
— Because thou hast rejected knowledge, I will also reject thee
— therefore will I change their glory into shame

A Study of Chapters 3 and 4 HERE ~ —— ~

Chapter 5

— O priests! And hearken, ye house of Israel! And give ye ear
— O house of the king! For judgement is against you
— O Ephraim, thou committest whoredom and Israel is defiled
— for the spirit of whoredoms is in the midst of them
— Ephraim shall be desolate in the day of rebuke
— For I will be unto Ephraim as a lion
— and as a young lion to the house of Judah

~ Chapter 6

— After two days will He revive us
— on the third day He will raise us up and we shall live in His sight
— “O Ephraim, what shall I do unto thee?
— O Judah, what shall I do unto thee?
— I have seen a horrible thing in the house of Israel
— there is the whoredom of Ephraim, Israel is defiled

A Study of Chapters 5 and 6 HERE ~ —— ~

Chapter 7

— the iniquity of Ephraim was uncovered
— and the wickedness of Samaria; like hand in glove
— they make the king glad with their wickedness
— and the princes with their lies
— “Ephraim, he hath mixed himself among the people
— Ephraim is a cake not turned
— Woe unto them, for they will try to flee from their Destruction
— because they have transgressed against Me!

~ Chapter 8

— “Set the trumpet to thy mouth!
— He shall come as an eagle against the house of the Lord
— because they have transgressed My covenant and My law
— they sacrifice flesh for the sacrifices of Mine offerings
— and eat it; but the Lord accepteth them not
— For Israel hath forgotten his Maker, yet buildeth temples
— and Judah hath multiplied fortified cities
— but I will send a fire upon his cities and devour their palaces

A Study of Chapters 7 and 8 HERE ~ —— ~

Chapter 9

— Rejoice not, O Israel, for thou hast gone whoring in Egypt
— and they shall eat unclean things in Assyria
— The watchman of Ephraim was with my God
— but, now, the prophet is a snare of a fowler in all his ways
— and a hatred in the house of his God
— Ephraim, as I saw Tyre, is planted in a pleasant place
— but Ephraim shall bring forth his children to be slaughtered
— Give them a miscarrying womb and dry breasts

~ Chapter 10

— Israel’s hearts are divided; between God and their idols
— they have spoken words, swearing falsely in making covenant
— thus judgement springeth up as the golden calves at Dan and Bethel
— their thorn and the thistle shall come up on their altars
— Ye have plowed wickedness, ye have reaped iniquity
— ye have eaten the fruit of lies
— therefore shall a tumult arise among thy people
— So shall Bethel and the king of Israel be utterly cut off

A Study of Chapters 9 and 10 HERE ~ —— ~

Chapter 11

— “When Israel was a child, then I loved him
— and called My son out of Egypt
— I taught Ephraim by their arms but they knew Me not
— for My people are bent on backsliding from Me
— “How shall I give thee up, Ephraim?
— How shall I deliver thee, Israel? How shall I make thee as Admah?
— When He shall roar then the children shall tremble from the west
— and as a bird out of Egypt and as a dove out of the land of Assyria

~ Chapter 12

— Ephraim feedeth on wind and followeth after the east wind
— he daily increaseth lies and desolation
— The Lord will punish Jacob according to his ways
— I, the Lord thy God; as in the land of Egypt
— will make them dwell in tabernacles and keep the solemn feasts

A Study of Chapters 11 and 12 HERE ~ —— ~

Chapter 13

— When Ephraim spoke, trembling, he exalted himself in Israel
— but now they sin more and more
— and have made for themselves molten images of their silver
— and idols according to their own understanding
— Therefore I will be unto them as a lion
— as a leopard by the way will I observe them
— I will meet them as a bear that is bereaved of her whelps
— and I will devour them like a lion; and shall tear them

~ Chapter 14

— O Israel, return unto the Lord thy God
— for thou hast fallen by thine iniquity
— “I will heal their backsliding, I will love them freely
— for Mine anger is turned away from him
— I will be as the dew unto Israel
— he shall grow as the lily and cast forth his roots as Lebanon
— His branches shall spread
— his beauty shall be as the olive tree and his smell as Lebanon

A Study of Chapters 13 and 14 HERE ~ —— ~

Who is Ephraim, a Chronic Liar?

•June 27, 2023 • Leave a Comment

Who is the lying Ephraim?

Ephraim may be a land fills with amber waves of grains and a nation in control of the gates of its enemies, but another dominant characteristic that Ephraim has, is sadly, a Chronic Liar!

Pearls and Irritations: “They Lied About Afghanistan. They Lied About Iraq. And They Are Lying About Ukraine,” writes Chris Hedges

For more about Ephraim

“Ephraim compasseth me with lies, and the house of Israel with deceit” (Hosea 11:12).

The house of Israel (the ten lost tribes) operates with hypocrisy but the house of Ephraim (the top dog of the northern ten tribes with its capital in Samaria) operates with lies and deceits!

Ephraim and Manasseh

The United States is Ephraim!

Below are some classic examples of lying and deceit in the house of Ephraim for reflection:

The Gulf of Tonkin incident was a perceived confrontation that led to the United States engaging in the Vietnam War. It involved a falsely claimed clash between ships of North Vietnam and the United States in the waters of the Gulf of Tonkin. The original American report blamed North Vietnam for an attack on the USS Maddox, but the Pentagon Papers, the memoirs of Robert McNamara, and NSA publications from 2005, proved that the US government lied to justify a war against Vietnam. 

The outcome of this deception was the passage by US Congress of the Gulf of Tonkin Resolution, which granted President Lyndon Johnson the authority and justification for deploying US forces against “communist aggression”. 

The Web of Language | Illinois

“But I want to say one thing to the American people. I want you to listen to me. I’m going to say this again: I did not have sexual relations with that woman, Miss Lewinsky. I never told anybody to lie. Not a single time. Never,” Bill Clinton testified before the nation, Jan. 26, 1998. For his deceit, Clinton became the second president in American history impeached by the House of Representatives.

In an August 2002 speech that kicked off the Bush White House administration’s campaign for war against Iraq, Cheney asserted, “Simply stated, there’s no doubt that Saddam Hussein now has weapons of mass destruction. There is no doubt he is amassing them to use against our friends, against our allies, and against us.”

In October 2002, Defense Secretary Donald Rumsfeld claimed he had “bullet-proof” evidence that Saddam was tied to Osama bin Laden. And a National Intelligence Estimate said Iraq had “continued its weapons of mass destruction program.”

“However, there is no doubt at all that the development of weapons of mass destruction by Saddam Hussein poses a severe threat not just to the region, but to the wider world.” – Tony Blair, House of Commons, 10 April 2002.

US Secretary of State Colin Powell holding a model vial of anthrax while giving the presentation to the United Nations Security Council on 5 February 2003

Prime Minister Tony Blair defended himself in 2005: “I have never told a lie. No. I don’t intend to go telling lies to people. I did not lie over Iraq.”

“The 1989 Tiananmen Square massacre was one of the most prominent lies. Wikileaks testifies that there were no bloodshed inside Tiananmen Square! HERE

The Real Donald Trump

Colin Powell, the former Secretary of State and Joint Chiefs of Staff in an interview on CNN’s “State of the Union” on June 7, 2020, called Donald Trump a chronic liar. “The one word I have to use with respect to what he’s been doing for the last several years is the word I would never have used before, never would have used with any of the four presidents I worked for, he lies,” said Colin Powell. “He lies about things. And he gets away with it because people will not hold him accountable.”

Twitter taking on Trump's lies? About time too | Twitter | The Guardian

President Trump’s top staff mocked him behind his back. His first Secretary of State, Rex Tillerson, famously called him a “f***ing moron.” Political Adviser Steve Bannon said he was “like an 11-year-old child.” Former White House Chief of Staff John Kelly labelled Trump an “idiot.” 

And even Secretary of State Mike Pompeo, considered a loyalist, was said to have written a note describing the President as “full of shit.”

Trump did not seem to know, for example, that Britain was a nuclear power, and asked if Finland was a part of Russia, John Bolton wrote. “I don’t think he’s fit for office,” the former National Security Advisor continued. “I don’t think he has the competence to carry out the job.” 

“There really isn’t any guiding principle that I was able to discern other than what’s good for Donald Trump’s re-election,” Bolton, known to the world for his walrus moustache,” added, “I think he was so focused on the re-election that longer-term considerations fell by the wayside.”

“He doesn’t operate pursuant to philosophy, or grand strategy or policy,” Bolton, described by Trump as “a war mongering fool, reflected on his 17 months in the White House. “He’s often described as transactional, but what it means is that every day is a new adventure. Decisions get made on an ad-hoc and episodic basis.”

I Didn't Lie,' Trump Asserts About Seriousness of Coronavirus | Voice of  America - English
“I didn’t lie.”

In an interview with ABC News, Bolton said of President Trump: “Putin thinks he can play him like a fiddle.” 

And lastly, Bolton was alarmed at Trump’s comments where the President had said “the only way we’re going to lose this election is if the election is rigged.” Bolton added that Trump “may attempt anything” and that “there are no rules” with the President.

“Mr. Trump is an enigma,” Michael Cohen, who worked for Trump for many years, who knew him better than even his family did, revealed in details “who he really was: a cheat, a liar, a fraud, a bully, a racist, a predator, a con man,” and one who “has lived his entire life avoiding and evading taking responsibility for his actions.”

“He’s a clown,” Mary Trump recalled what her aunt Maryanne said of Donald Trump during one of their lunches when Donald announced he would run for President. “This will never happen.” 

Maryanne also became enraged when Donald began to receive endorsements from prominent Christians and White Evangelicals such as Jerry Falwell Jr. remembering he was a man with “five bankruptcies.” Maryanne, who is a Catholic since her conversion 50 years ago, allegedly raged to Mary: “What the f*** is wrong with them? The only time Donald went to church is when the cameras were there. It’s mind boggling. He has no principles. None!”

A “Frankenstein’s Monster,” exclaimed Mary, who had studied patients with schizophrenia at Hillside Hospital on Long Island. She wrote further of the narcissist’s “dysfunctional” family background comparing him to a three-year-old, saying, “Trump’s ego is a fragile thing that must be bolstered every moment because he knows deep down that he is nothing of what he claims to be.”

Mary added about his uncle’s life of “cheating and lies” by tracing an episode to his young age: “Trump even paid someone to take the SAT tests for him to help him get into the University of Pennsylvania for its famous Wharton School of Business,” where he has claimed that he graduated with the “highest grades possible.” 

That someone was his buddy named Joe Shapiro, a smart kid with a reputation for being a good test taker, and the “sociopath” had calculated from such an early age the art of “lying, spinning, and obfuscating” and how to pay people well which set the stage for the rise of what we have today not just “the World’s Most Dangerous Man” as Commander-in-Chief in the White House but the World”s Most Boggling Gorilla.

Mike Cohen lays out an alarming portrait of the constellation of characters orbiting around Trump, describing him as “a cheat, a liar, a fraud, a bully, a racist, a predator, a con man.”

“You’ll never have an election count on November 3,” Trump said in a speech in August to the Council of National Policy, a conservative activist group. “You’re not going to be able to know the end of this election, in my opinion, for weeks, months, maybe never,” he said.

Bob Woodward: Trump Doesn’t Seem To Know “What Is Real And What Is Unreal.”

And here is Donald Trump’s Secretary of State, Mike Pompeo:

Ex-CIA director Pompeo: 'We lied, we cheated, we stole' - YouTube

“I was the CIA director. We lied, we cheated, we stole,” former CIA director and now Secretary of State Mike Pompeo said on April 15, 2019 at a forum at Texas A&M University. “It was like – we had entire training courses. It reminds you of the glory of the American experiment.” Interestingly, a Christian religious news broadcaster that described Pompeo’s words with such precision as follows: “that’s not the resume of the Secretary of State… that’s the resume of Satan.”

Obviously Trump’s Secretary of State isn’t Satan, but certainly one that’s demon-possessed.

And here comes Ellen G White:

Ellen G. White - Wikipedia

“The Bible nowhere sanctions the use of intoxicating wine. The wine that Christ made from water at the marriage feast of Cana was the pure juice of the grape” (Ellen G White, Ministry of Healing p.333).

“I do not write one article in the paper expressing merely my own ideas. They are what God has opened before me in vision–the precious rays of light shining from the throne” (Ellen G White, Testimonies for the Church, vol. 5, p.67).

Ellen G White’s vision from the throne and her revelation about the Flood:

“At this time immense forests were buried. These have since been changed to coal, forming the extensive coal beds that now exist, and also yielding large quantities of oil. The coal and oil frequently ignite and burn beneath the surface of the earth. Thus rocks are heated, limestone is burned, and iron ore melted. The action of the water upon the lime adds fury to the intense heat, and causes earthquakes, volcanoes, and fiery issues. As the fire and water come in contact with ledges of rock and ore, there are heavy explosions underground, which sound like muffled thunder. The air is hot and suffocating. Volcanic eruptions follow; and these often failing to give sufficient vent to the heated elements, the earth itself is convulsed, the ground heaves and swells like the waves of the sea, great fissures appear, and sometimes cities, villages, and burning mountains are swallowed up” (Patriarchs and prophets, Pacific Press, 1958, pg 108-109).

Truth of God - "Overcome Through God's Purpose for You." By: Fred Coulter  (second half) - CBCG-GoToMeeting

“The chronological events that are recorded in Exodus 16 clearly define ben ha arbayim— “between the two evenings,” or “between the setting times”— as the time period that immediately FOLLOWS sunset, or ba erev” (Frederick R. Coulter, The Christian Passover, p 48).

Notice that Fred Coulter has the definition as distinct different times; i.e. they do not overlap.

Hence two lamb would be needed: one to fulfil Exodus 12:6 “hā·‘ar·bā·yim” another Detueronomy 16:6 “at erev!” Hence this false shepherd is blind and naked!

“There is no question that the Passover commands in Exodus 12 have been misinterpreted and given different meanings than the true scriptural meaning of God’s ordinances and statutes delivered to Moses” (ibid, p 115). Such a loaf of greasy bullshit!

Gerald Flurry’s chronic lying claim of a Mighty Angel that had handed Malachi’s Message to him must be confused and not very articulated because Flurry in later years has to make revisions after revisions to get the messages right for his so-called Philadelphia Church of God. Flurry also prophesied that Donald Trump would serve his second term to fulfill Jeroboam II revival, “BECAUSE A BIDEN PRESIDENCY IS CONTRARY TO BIBLE PROPHECY.” What nonsense and all Flurry’s incurable BULLSHIT! (Pg 1, The Philadelphia Trumpet, January, 2021).

In fact, Gerald Flurry’s teaching is more like the original crafty Jeroboam. “It is too much for you to go up to Jerusalem. Behold thy gods, O Israel, which brought thee up out of the land of Egypt!  And he set one in Bethel, and the other put he in Dan,” (King Jeroboam: I King 12:28-29)

And in UCG‘s teaching, the morning includes the afternoon? 

And the writer wrote, “Evening is associated with darkness and night, morning is associated with day, (pg 9).

Nothing is consistent as yet a while later he wrote evening means twilight:

The term twilight means: “evening twilight; time of concealment; of refreshment; of stumbling, in dim light.” Twilight is not in the afternoon, but it is when the light grows dim, after sunset, but before complete darkness.(Pg 10).

UCG Seal.jpg | United Church of God

Can this writer be specific and consistent since later he came back and wrote it means night again!

Genesis 1:3-5 “Then God said, ‘Let there be light,’ and there was light. And God saw the light, that it was good; and God divided the light from the darkness. God called the light Day, and the darkness He called Night. So the evening [erev, darkness, night] and the morning [boqer, light, day] were the first day.” Morning is used in Scripture to refer to the light portion of a day. The Hebrew word for night is layil. It is used as a synonym for the Hebrew erev, which is normally translated “evening.” (Pg 11).

So according to UCG, morning (boqer) would be day, which starts from 6 AM unto 6 PM, including the afternoon? “Morning is used in Scripture to refer to the light portion of a day.” So 1 PM, 2PM 3 PM is also morning. And evening is the whole night, from 6 PM to 6 AM. Think again. Morning includes the afternoon? Yes this is not just UCG’s morning but UCG’s insanity! 

Think again, the morning includes the afternoon? Was the writer just lying or on drugs? And this contradicts a moment later: “Next we find the expression “at evening” or “at even” (Exodus 12:18). This is the Hebrew expression ba ‘erev. In general it means sunset” (pg12). It doesn’t mean night anymore? Blind Guides. The whole body of UCG is sick, full of coronavirus, starting with the head, and the whole Council of Elders has been infected since 1999.

This is like going back to the days of Jeroboam:

Jeroboam's Table of Demons - Bible Matrix

“It is too much for you to go up to Jerusalem. Behold thy gods, O Israel, which brought thee up out of the land of Egypt!” 29 And he set the one in Bethel, and the other put he in Dan . . . 31 And he made a house of high places . . . 32 And Jeroboam ordained a feast in the eighth month, on the fifteenth day of the month, like unto the feast that is in Judah. (King Jeroboam: I King 12:28-32)

“Ephraim shall be desolate in the day of rebuke; among the tribes of Israel have I made known that which shall surely be” Hosea 5:9

Rare Earth Production: Top 5 Countries

•June 26, 2023 • Leave a Comment

Rare Earth Metals Production By Country: Top 5 Countries

In this brief article, we’ll learn about the 5 largest rare earth metal producing countries.

Insider Monkey by Sana Uaz • June 22, 2023

1. China

Rare Earth Metal Mine Production in 2022: 0.21 million metric tons – (210,000 metric tons)

China is the largest rare earth metals producing country that accounts for over 70% of rare earth metals’ global production. The country’s mine yield of rare earth metals was recorded at 0.21 metric tons in 2022. China also has the largest deposits of rare earth metals, amounting to 44 million metric tons. The main REEs deposit in China is the Bayan Obo Mining District in Inner Mongolia, which is also the world’s largest known REEs deposit.

Bayan Obo Mining District in Inner Mongolia, China

2. United States

Rare Earth Metal Mine Production in 2022: 43,000 metric tons

The United States saw mine production of 43,000 metric tons of rare earth metals in 2022. Also, the current estimates suggest that the country holds approximately 2.3 million metric tons of reserves of rare earth metals. This substantial reserve capacity indicates the potential for continued and amplified domestic production in the future. Currently, the largest rare earth metals mine in the US is the Mountain Pass Mine in southeastern California, which is an open-pit mine with substantial mining capacity.

3. Australia

Rare Earth Metal Mine Production in 2022: 18,000 metric tons

Australia is the third-largest producer of rare earth metals, only behind the US and China. The country mined 18,000 metric tons of rare earth metals in 2022, which is a slight drop from the country’s yield of 24,000 metric tons in 2021. This generous rare earth metals output indicates the country’s immense rare earth potential, as its reserves are estimated to be 4.2 million metric tons. Australia’s most prominent rare earth metals mine is the Mount Weld Mine, which has state-of-the-art infrastructure to extract REEs from other minerals. Also, despite having the world’s sixth largest reserves of rare earth metals, Australia’s mining efforts in this sector remain relatively curtailed.

4. Burma

Rare Earth Metal Mine Production in 2022: 12,000 metric tons

Burma’s mine output of rare earth metals was recorded to be 12,000 metric tons in 2022. The country’s production volumes primarily consist of dysprosium and terbium, with minor outputs of scandium and yttrium. Burma’s production yield indicates its potential to offer diversified supply sources, mitigating the risks associated with the concentration of these critical resources. Moreover, Burma is amongst the largest exporters of rare earth metals worldwide. Its export of REEs reached $803 million in 2021, despite the country’s complex socio-political landscape and developing mining infrastructure.

5. Thailand

Rare Earth Metal Mine Production in 2022: 7,100 metric tons

When it comes to rare earth metals production by country, Thailand is among the top five. Its reported production volume of rare earth metals was 7,100 metric tons in 2022. Notably, Thailand’s rare earth metals output reached 8,200 metric tons in 2021, more than double the production in 2020, which stood at 3,600 metric tons. However, following this unprecedented increase, the production experienced a decrease, sliding to 7,100 metric tons in 2022. Such a shift might be indicative of a level of volatility in Thailand’s rare earth metals production over the observed period.

Know more about important structural metals by reading 15 Largest Steel Producing Countries in the World and 12 Biggest Iron Ore Producers in the World.

“O Ephraim, what shall I do unto thee? For your goodness is as a morning cloud, and as the early dew it goeth away” Hosea 6:4

Ellsberg: US plan to ‘nuke China!’

•June 25, 2023 • Leave a Comment

Ellsberg’s last scoop: details of US plan to ‘nuke China!’

Pearl and iritations by Nury Vittachi • June 20, 2023

Millions would have died in the bombing, planned for 1958, which was set to start with Hiroshima-sized atomic bombs on the Chinese mainland near Taiwan and then move to larger nuclear weapons on a path going north to Shanghai. The resulting nuclear war would lead to countless deaths across mainland China, Taiwan, and Japan.

The final revelation of whistleblower Daniel Ellsberg, who died on June 16 at the age of 92, was to reveal details of top secret US plans; then under US president Dwight D Eisenhower, to drop 10 to 15 atomic bombs in China

The Chinese at the time had [no atomic or nucleay bombs] only conventional weapons.

While it had long been rumoured that the US had considered “nuking” China in the 1950s, Ellsberg revealed full details of the secret plans in 2021, sharing the original papers documenting the plans. There was a little coverage of the revelation in some mainstream media outlets, but then the story quickly disappeared.

Here’s what happened—and how details were hidden for more than half a century.

Tension across the Straits

When there was tension across the waters between parties on mainland China and a military group, the Nationalists, which had fled to the island of Taiwan in 1958, US military officials met to discuss what role they should play. Mainland fighters were making headway against the group on the island, a Joint Chiefs of Staff meeting was told.

The US decided it was in their interest to maintain control of the region by holding key islands in the South China Seas. If mainlanders fought with the Nationalists on Taiwan, the US would launch an invasion “to destroy the war-making capability of Communist China.”

The decision was made that the US would act in “a situation in which there would be a Communist military offensive against Taiwan that would be countered by an American attack with atomic weapons against the Chinese mainland.”

(It’s interesting to note that planners repeatedly used the word “communist” to reinforce negativity about China, a technique still used by the mainstream media today, despite the country having run a state capitalist system for more than 40 years.)

For Israel hath forgotten his Maker, and buildeth temples; and Judah hath multiplied fortified cities. But I will send a fire upon his cities, and it shall devour the palaces thereof” Hosea 8:14

“For the day of the Lord is near upon all the nations. As thou hast done, it shall be done unto thee: thy reward shall return upon thine own head” Obadiah 1:15

Islands useful to America

Classified notes of the meetings reveal that there was no discussion of the need to defend people living on the island of Taiwan, but were wholly focused on the military value of offshore islands to US maintenance of control of the region.

Page 50, MEMORANDUM RM-4900-ISA (Abridged) DECEMBER 1988 Image: supplied

US military leaders believed at the time that numerous islands in addition to Taiwan were worth defending with the use of atomic weapons. As well as Taiwan, there were seven others: the ones known to the west at that time as Big Quemoy, Little Quemoy and the five-strong Matsu group. (An earlier document had 13 islands listed as worth protecting.)

On August 7 of 1958, a revised US plan was issued indicating that Phase 1 was based on patrolling the area, while Phase 2 “would involve atomic weapons strikes by both sides”. The strategy was for “The 13th Airforce commander to direct atomic operations and the initial operations were to emphasise pre-planned strikes against enemy airbases.”

A later contingency plan, co-drafted by CIA personnel, clearly specified a US nuclear invasion of China, described as: “an American expansion of the crisis to include atomic attack against the Chinese mainland.”

Page 57, MEMORANDUM RM-4900-ISA (Abridged) DECEMBER 1988 Image: supplied

Nuclear war ‘Inevitable’

At one meeting of US military leaders, Air Force General Nathan Twining, chairman of the Joint Chiefs of Staff, said the use of atomic weapons was “inevitable” and planning “must proceed on that assumption.”

The nuclear invasion of China would begin with US fighter bombers dropping atomic bombs of 10 to 15 kilotons (the bomb dropped in Hiroshima was 15 kilotons) on the mainland near Taiwan, namely Xiamen, then known as Amoy. They would initially aim at airbases so as to deflect any criticism from humanitarians.

A summary said: “He [Air Force leader Twining] noted that the US military would begin by attacking a few of the fields in the Amoy area, using low- yield ten to fifteen kiloton nuclear weapons. At this point the Chinese Communists hopefully would break off. But if they did not , the United States, Twining indicated, would have no alternative but to conduct nuclear strikes deep into China as far north as Shanghai.”

The Chinese would fight back and a nuclear war would take place, the summary said. “The Chairman of the Joint Chiefs suggested that this would almost certainly involve nuclear retaliation against Taiwan and possibly against Okinawa.”

This seems odd, since China had no atomic weapons, but US military leaders mentally blurred China and Russia together (exactly as they do today) into a single, monolithic “commies” block. Retaliation by the Chinese was guaranteed because the Russians had atomic bombs. The resulting nuclear war would leave millions of people in Asia dead (but relatively few Americans—that was the beauty of nukes, as shown in Hiroshima and Nagasaki).

Yet the US military never got to launch the atomic bombers.

The Chinese switched to a focus on mainland issues and adopted what would today be called an attitude of “strategic patience” with the hostile group which had moved to Taiwan; a policy that continues today.

Ellsberg’s revelations

How was all this revealed? In the late 1960s and early 1970s, Daniel Ellsberg, a Harvard-educated marine with top level access to military intelligence, became shocked at the sheer immorality of US foreign policy, which he realised was built on lying to everyone about what the military and the intelligence services were doing.

In 1971, he leaked a top secret history of the Vietnam War, which the press dubbed “the Pentagon Papers.” He was threatened with years in jail—but when people saw the depth of the deception that was being carried out, he was gradually recast as a hero, and a judge set him free. He became known as the first whistleblower.

A second secret Document

But unknown to anyone, Ellsberg had also copied another top secret study, written in 1966, which summarised military plans to nuke China in 1958. While others had talked about the existence of such a plan, details had never been released.

Decades passed. Ellsberg did not disclose the documents.

Official papers covering US military activity in Asia were eventually declassified over the years, but sections about the US planning first-strike nuclear invasion of China were removed, remaining as top secret information.

Ellsberg realised that he alone had the full, uncensored document.

History repeats itself

In 2021, Ellsberg realised that history was repeating itself, with the US again flirting with the idea of military adventuring which was carelessly leading to a possible nuclear war based around Taiwan.

Still staunchly opposed to the way his government goads conflicts into being and then blames the victims, he found the 1966 document and released it to the public.

But times had changed. In the early 1970s, the media was shocked by revelations of US military provocations in East Asia, and was happy to give him the headlines and hold the government to account.

But half a century later, Ellsberg released a bombshell—and the mainstream media had relatively little interest. After brief coverage, the story disappeared.

The media, he realised, had become part of the war machine. US manipulates politics in Ukraine, invents a genocide in Xinjiang, stirs up protests in Iran, sponsors trouble in Hong Kong, and what happens? Journalists edit out all indications of US provocation, and blame the victims. O those awful Chinese. O those dreadful Iranians. O those monstrous Russians.

In a final interview published by Politico on June 4, 2023, Ellsberg said the United States was still running a covert global empire, and the situation was dangerous. We are “on the edge of blowing up the world over Crimea or Taiwan or Bakhmut,” he warned.

He said the US had a long history of creating needless conflicts for its own advantage, and it is continuing to do that, taking us to the edge of nuclear catastrophe.

It’s still worth speaking out

Although he is a hero to many, Ellsberg was always hard on himself for delaying the release of information. He sat on the secretly copied Vietnam document for a year—and the China invasion story for five decades.

The media, he believed, was now complicit in US government wrongdoing, and whistleblowers have less chance of making a real difference. Those who speak out may simply ruin their own lives.

But he continued to believe that it was worth trying. In 2011, he wrote: “The personal risks are great. But a war’s worth of lives might be saved.”

“Ephraim surrounds me with lies, and the house of Israel with deceit” Hosea 11:12a

“I have seen a horrible thing in the house of Israel; there is the whoredom of Ephraim, Israel is defiled,” Hosea 6:10

“Woe to the crown of pride, to the drunkards of Ephraim, whose glorious beauty is a fading flower, which is on the head of the fat valleys of them that are overcome with wine!” Isaiah 28:1

China Plans Military Base In Cuba

•June 24, 2023 • Leave a Comment

China Plans Military Base In Cuba In Response To US Support For Taiwan. While China has zero combat troops in the Western Hemisphere, the United States has more than 350,000 deployed across the Pacific region, including more than 100 on Taiwan, an island it formally recognizes as being Chinese territory. Washington says it is safeguarding the “rules-based international order” by doing so.

ZeroHedge by Tyler Durden • June 21, 2023 // Sputnik International

Chinese troop stationed on America’s doorstep? The Wall Street Journal is reporting Tuesday that China is in negotiations with the Cuban government to establish a a new joint military training facility on the island.

For Israel hath forgotten his Maker, and buildeth temples; and Judah hath multiplied fortified cities. But I will send a fire upon his cities, and it shall devour the palaces thereof” Hosea 8:14

“For the day of the Lord is near upon all the nations. As thou hast done, it shall be done unto thee: thy reward shall return upon thine own head” Obadiah 1:15

The newspaper says the two sides are already in advanced negotiations about opening the facility, which would reportedly be in northern Cuba, sparking fears among US officials that it could eventually host a permanent Chinese troop presence. The Biden administration is seeking to intervene with Cuban officials, attempting to block the possibility. 

It’s also believed that China would expand its espionage capabilities and activities given the military foothold would be a mere 100 miles off Florida’s coast. This comes on the heels of widespread reports earlier this month that China wants to use Cuba as a base of spy operations, to potentially sweep up communications of American military installations across the southeast United States.

Biden administration officials then in follow-up admitted that China has had a spy base in Cuba since at least 2019 (though without specifying whether this is a standalone base or consulate). 

The new WSJ revelation is based on anonymous US intelligence sources and documents. “Discussions for the facility on Cuba’s northern coast are at an advanced stage but not concluded, U.S. intelligence reports suggest,” the publication writes. “The Biden administration has contacted Cuban officials to try to forestall the deal, seeking to tap in to what it thinks might be Cuban concerns about ceding sovereignty.”

But the report underscores that US intelligence itself is less than certain regarding an impending joint Chinese-Cuban military base:

US officials said reference to the proposed new training facility in Cuba is contained in highly classified new US intelligence, which they described as convincing but fragmentary. It is being interpreted with different levels of alarm among policy makers and intelligence analysts.

According to further details in the WSJ report:

Most worrying for the US: The planned facility is part of China’s “Project 141,” an initiative by the People’s Liberation Army to expand its global military base and logistical support network, one current and one former US official said.

China and Cuba already jointly run four eavesdropping stations on the island, according to US officials. That network underwent a significant upgrade around 2019, when a single station expanded to a network of four sites that are operated jointly, and Chinese involvement deepened, according to the officials.

We emphasized in our earlier commentary on deepening China-Cuba relations that from Beijing’s perspective, Cuba is ‘fair game’ given Washington’s longtime presence in Taiwan. The level of US military and intelligence infrastructure in place across the South China Sea and among Washington’s regional allies not far off China’s coast, even firmly entrenched on the island of Taiwan, are already immense and growing. Of course for Americans, Monroe Doctrine assumptions are still alive and well, and deeply ingrained. 

US intelligence and the WSJ are catching on and belatedly acknowledging this crucial factor…

“Some intelligence officials say that Beijing sees its actions in Cuba as a geographical response to the US relationship with Taiwan: The US invests heavily in arming and training the self-governing island that sits off mainland China and that Beijing sees as its own,” WSJ writes. “The Journal reported that the US has deployed more than 100 troops to Taiwan to train its defense forces.”

And additionally, the report spells out the following:

Taiwan is roughly 100 miles from mainland China, about the same distance Cuba is from Florida.

China has no combat forces in Latin America, according to US officials. Meanwhile, the US has dozens of military bases throughout the Pacific, where it stations more than 350,000 troops. Chinese officials have pointed this out when they push back on American efforts to counter their military expansion outside of the Indo-Pacific.

Indeed both China and Russia have long pointed out such Washington hypocrisy when it comes to expanding troops presence and military infrastructure abroad. 

Perhaps with that in mind, Secretary of State Antony Blinken tried to calm Beijing’s worst fears when he stressed in a press briefing at the end of his two-day Beijing trip where he met with President Xi Jinping, “We do not support Taiwan independence.”

And yet, by trip’s end it became clear that little progress was made toward mending US-China relations, given for example Xi refused to resume direct military communication with Pentagon officials. He even shut the door on restoring a military crisis hotline, which helps to two sides avoid inadvertent conflict in places like the South China Sea, where both frequently patrol.

For more about the South, a prophecy of Esau or Edom, see Obadiah

For more on the enemy from the South, see A Sword from the South!

SS #02 The Word from the Targum

•June 23, 2023 • Leave a Comment

The Targum is an indispensable source of understanding the Bible. Started by Ezra for those returning Jews from Babylon and for these returnees they could only understand the Sacred Text in Aramaic; hence the Targum is as if Ezra is speaking to them in ancient times from the Sacred Text.

The Targum, whose origin was in the Aramaic language, could be traced to Ezra speaking to the returning exiles who couldn’t understand Hebrew, but was expounded to them in a language they could understand.

“For Ezra had prepared his heart to seek the law of the Lord and to do it, and to teach in Israel statutes and judgements,” Ezra 7:10. This process gave birth to the Targum; hence it is as if Ezra is speaking to them in ancient times and to us today from the Sacred Text.

Ezra had prepared his heart to seek the Lord and to teach in Israel His laws, statutes and judgments. He was so highly regarded that he was appraised as the second Moses.

The earliest Targums date from the time after the Babylonian Exile when Aramaic had superseded Hebrew as the spoken language of the Jews back in Judea. During the Babylonian the use of Hebrew was displaced by Aramaic as a spoken language; although Hebrew was still remained the learned and sacred language. Thus the Targums were designed to meet the needs of unlearned Jews to whom the Hebrew of the Old Testament was unintelligible.

For it was in the synagogue that the practice of reading from the Old Testament became widely observed, along with the custom of providing these readings with a translation into Aramaic. When Scripture was read aloud in the synagogue, it was translated aloud by a meturgeman, or professional interpreter (hence the name Targum), for the benefit of the congregation.

The translator tried to reproduce the original text as closely as possible, but since his object was to give an intelligible rendering of the biblical text, the Targums eventually took on the character of paraphrase and commentary, leaving literal translation behind.

To prevent misconceptions, a meturgeman expanded and explained what was obscure, adjusted the incidents of the past to the ideas of later times, emphasized the moral lessons to be learned from the biblical narratives, and adapted the rules and regulations of the Scriptures to the conditions and requirements of the current age.

The method by which the text was thus utilized as a vehicle for conveying homiletic discourses, traditional sayings, legends, and allegories is abundantly illustrated by the later Targums, as opposed to the more literal translations of the earlier Targums.

The status and influence of the Targums became assured after the Second Temple was destroyed in AD 70, when synagogues replaced the Temple as houses of worship.

Though written Targums gradually came into being, it was the living tradition of oral translation and exposition that was recognized as authoritative throughout the Talmudic period of the early centuries of the Christian Era.

The official recognition of a written Targum, and therefore the final fixing of its text, belongs to the post-Talmudic period of the 5th century AD. The best known, most literal, and possibly the earliest Targum is the Targum of Onkelos on the Pentateuch, which appeared in its final revision in the 3rd century AD. Other Targums include the Targum of Pseudo-Jonathan and the Targum of Jonathan ben Uzziel.

Not surprisingly, the endtime church, that of the churches of the Laodiceans, they have five characteristics beside being neither cold nor hot; and they are (1) WRETCHED (2) MISERABLE (3) POOR (4) BLIND (5) NAKED Revelation 3:14-17

For they ignored the fact that It was a righteous scribe, Ezra, whose work gave rise to the Targum, translating the Hebrew Text to Aramaic so that the rank and file could understand. He was a righteous priest and “a scribe skilled in the law.”

“For Ezra had prepared his heart to seek the law of the Lord and to do it, and to teach in Israel statutes and judgments.” Ezra 7:10

The Voice translated this same verse as “He (Ezra) was a second Moses, and tenaciously studied, practiced, and taught the Eternal’s law to Israel.”

Hence to study the Scriptures, the Targum is an indispensable source of understanding of what the Lord God has intended for any serious student to use, study and understand.

“I know thy works, that thou art neither cold nor hot; I would thou wert cold or hot. So then because thou art lukewarm, and neither cold nor hot, I will spew thee out of My mouth.” Revelation 3:15-16.

Spewing out of His mouth is used metaphorically to describe rejection, disgust, or divine judgement and is usually meant spewing into the fire, which is a serious consequence of a judgement, but Laodiceans have no understanding, and most don’t care!

“Ye shall therefore keep all My statutes and all My judgments, and do them, that the land whither I bring you to dwell therein spew you not out.” Leviticus 20:22. “That the land spew not you out also when ye defile it, as it spewed out the nations that were before you.” Leviticus 18:28

Here, spewing out usually mean to be expelled into exile, into captivity; becoming slaves. The length of the house of Judah’s captivity of in Babylon was directly related from the length of time they neglected to observe the land Sabbath according to II Chronicles 36:19-21:

And they burned the house of God, and broke down the wall of Jerusalem, and burned all the palaces thereof with fire and destroyed all the goodly vessels thereof. 20 And those who had escaped from the sword carried he away to Babylon where they were servants to him and his sons until the reign of the kingdom of Persia,

21 to fulfill the word of the Lord by the mouth of Jeremiah, until the land had enjoyed her Sabbaths; for as long as she lay desolate she kept Sabbath, to fulfill threescore and ten years, II Chronicles 36:19-21: ‘by the mouth or spoken by Jeremiah’ this is a reference to the seventy years of captivity as spelt out in Jeremiah 25:11.

From the above, it could be established that the length of captivity is linked directly to the length of time to Israel’s neglect in their observance of the Sabbath, and in this case the observance of the land Sabbath.

If only the Orthodox Jews have consulted the Targum along with their other studies, they would have identified that the Messiah had already came in the name of Yeshua as a human, fulfilling the first part of prophecy as a suffering servant, and He will come again, to fulfil the second half as a conquering Son of God. 

But they are blind, hence they grope under the sunlight:

“And thou shalt grope at noonday, as the blind gropeth in darkness, and thou shalt not prosper in thy ways.” Deuteronomy 28:29

And similarly the Worldwide Church of God and today at the tail end by its Laodicean splinters: the Church of God Communities are also described as blind, wretched and naked as regards to their understand of the timing of Passover (Pesach) and the counting towards Pentecost (Shavuot). By not consulting the Targum, they gravitate toward the Samaritan’s way of worshipping the God of Israel.

China and Cuba close to Military Deal

•June 23, 2023 • Leave a Comment

China and Cuba close to military base deal – WSJ

RT World News • June 20, 2023 // ZeroHedge by Tyler Durden

US intelligence now claims that joint spy facilities on the island were just the beginning

“For the day of the Lord is near upon all the nations. As thou hast done, it shall be done unto thee: thy reward shall return upon thine own head” Obadiah 1:15

Beijing and Havana are in negotiations to establish a military training facility in Cuba, the Wall Street Journal reported on Tuesday, citing current and former US officials who spoke on the condition of anonymity.

Talks about the base on Cuba’s northern coast are “at an advanced stage but not concluded,” the WSJ claimed, based on what the officials described as “convincing but fragmentary” and highly classified US intelligence reports.

One current and one former official said the facility would be part of ‘Project 141’, a Chinese military initiative to set up bases and logistical support around the world. If true, this “could provide China with a platform to potentially house troops permanently on the island” and potentially expand intelligence-gathering against the US, they said.

The Journal’s report comes shortly after US Secretary of State Antony Blinken visited China in order to “halt a downward spiral in relations” between Washington and Beijing. He was even received by Chinese President Xi Jinping.

The same outlet had alleged the existence of a “Chinese spy base” in Cuba earlier this month. After first denying the report as “inaccurate,” the White House revealed intelligence reports that claimed four Chinese intelligence-collection facilities have been in Cuba since at least 2019.

Cuba called the original WSJ report “totally mendacious and unfounded,” while the Foreign Chinese Ministry said on June 9 that the US was an “expert in chasing shadows” in other countries and meddling in their affairs. Beijing also noted that Washington had blockaded Havana for over 60 years and maintains its own military base in Guantanamo Bay.

The White House declined to comment on the new WSJ story. According to the unnamed officials, President Joe Biden’s administration has reached out to Cuba to block the deal, citing “what it thinks might be Cuban concerns about ceding sovereignty.”

Other officials speculated that China’s move might be a counter to the US sending over 100 troops to Taiwan, to train the local military, earlier this year. The Journal noted that Taiwan was roughly the same distance from the Chinese mainland as Cuba from the US. It neglected to note that the US recognizes the island as Chinese under the ‘One China’ policy, while Cuba has been an independent state since 1902.

For more about the South, a prophecy of Esau or Edom, see Obadiah

For more on the enemy from the South, see A Sword from the South!

Ortega Green Lights Arrival Of Russian Military

•June 22, 2023 • Leave a Comment

Ortega Green Lights Arrival Of Military Personnel And Aircraft From Russia, Cuba, And Venezuela

Today Nicaragua • June 3, 2023

TODAY NICARAGUA (EFE) Daniel Ortega, the president of Nicaragua, has given permission for the entry of troops, ships, and aircraft of the Russian Armed Forces, as well as those from the United States, Cuba, and Venezuela, into Nicaragua from July 1, 2023, as reported in the official media.

Nicaraguan army showing off their 50 Russian T-72B1 tanks in a parade

The decree issued by the Sandinista leader, an ally of Russian President Vladimir Putin, allows an undefined number of foreign military personnel to enter Nicaragua for “exchange purposes and humanitarian assistance for mutual benefit, in case of emergency situations” in the second half of 2023.

The decree also authorizes personnel from Mexico, Venezuela, the United States, Cuba, and the Conference of Central American Armed Forces (Guatemala, El Salvador, Honduras and the Dominican Republic) to transit or station in Nicaragua.

In addition to this, Ortega has authorized Russian personnel to participate in “training and exchange exercises in humanitarian aid operations, search, rescue, and rescue missions in emergency situations or natural disasters” with the Humanitarian and Rescue Unit of the Nicaraguan Army.

Furthermore, he has allowed the entry of Russian troops to “carry out the exchange of experiences, training, operations against illegal acts in maritime spaces in the Caribbean Sea and jurisdictional waters in the Pacific Ocean of Nicaragua, with the Nicaraguan Naval Force.”

Consequently, from July 1 to December 31 of this year, an undefined number of Russian soldiers, ships, and aircraft can enter Nicaragua to take part in “exchange of experience and training in security work.”

Booming “Cheal Parner” between Vladimir Putin and Daniel Ortega

Cuba, Mexico, Venezuela and the United States

In the same presidential decree, Ortega authorized the entry into Nicaragua for six months starting in July of Mexican personnel, ships, and aircraft for humanitarian exercises and training, as well as fifty Venezuelan military personnel for security and humanitarian aid exercises.

Cuban soldiers have also been allowed entry.

Additionally, Ortega authorized “the entry into national territory, previously planned and coordinated with the Nicaraguan Army, of personnel from the Armed Forces, ships and aircraft of the United States of America, in order to dock at ports and land at national airports to carry out humanitarian aid operations and search, rescue and rescue missions in emergency situations or natural disasters, by air, sea and land.”

“For the day of the Lord is near upon all the nations. As thou hast done, it shall be done unto thee: thy reward shall return upon thine own head” Obadiah 1:15

For more about the South, a prophecy of Esau or Edom, see Obadiah

For more on the enemy from the South, see A Sword from the South!

Iran: That “Great Satan!” 

•June 21, 2023 • Leave a Comment

My Eyes Are Open: Iran Was Right About That “Great Satan” Thing

The Unz Review by AJ Smuskiewicz • June 11, 2023

When I was a young guy in the late 1970s and early 1980s, I laughed when the Iranian revolutionaries condemned the United States as “The Great Satan.” America was the land of freedom, democracy, and Ronald Reagan, right? What the heck were those insane Islamists shouting about?

Well, hell, I’m not laughing anymore. Over the last few years, I’ve finally come to understand that those Iranians were right. I’ve never been religious, but I can see the clear evidence that Satan—that is, a very powerful force of evil—is ruling the United States of America at all levels today, including the federal and state governments, big corporations and all other large established institutions, and much of the American population itself. The United States has probably been in this crappy condition for many decades, but it didn’t sink in deep into my consciousness until the past few years.

Look around if you have eyes, and put two and two together if you can. America is in an obvious state of advanced social, cultural, moral, ethical, political, and economic decline and decay. Yet, Americans, as a whole, apparently are blind and incapable of doing the simple math. They continue to view themselves as vastly superior to the rest of the world, clinging to the delusion that they—sitting on their rickety rusty old perch that is about to fall out under their sick swollen asses— have the right to tell the entire world how to live.

The sophisticated, insidious, omnipresent propaganda of the giant elitist institutions of American government, corporations, and media have thoroughly brainwashed Americans, along with much of the rest of the world, into this delusional mindset. Most people do not realize that they have been transformed into the mindless zombie slaves of these institutions. And, in their zombified conditions, they don’t even notice the stinking cesspool of a culture with which they’ve allowed these institutions to surround themselves.

In other words, as my mom used to say about ignorant people, they don’t know their ass from a hole in the ground.

Excuse my limited biblical knowledge, but doesn’t the Bible or some other religious text say something about Satan deceiving a gullible world with a smiling face and charming demeanor? That is the United States these days—deceiving huge segments of the domestic and global population into believing that it is a force for good, while it is actually spreading its evil, chaos, corruption, and cultural decadence to everything that its influence touches. Hail Great Satan!

Government-corporate-media Conglomerate

Do not be deceived by the smiling, charming propagandist who just wants to enslave and control you. Detach yourself from the propaganda of the US-based government-corporate-media globalist Conglomerate, which controls all aspects of American society and much of the rest of the Western world. Ignore the endless streams of lies, focus clearly on the truth, and be brave enough to speak the truth even as the Conglomerate seeks to silence you. I try to do that with my writings and music. I acknowledge that my writings are more professional, but my music, though amateurish, is more fun.

We who have open eyes can see how individual freedom is under constant assault by the Conglomerate. Since the fabulous phenomenal frauds of the COVID plandemic, the 2020 rigged election, the Ukraine warmongering, and the other bullshit of recent years, thousands of people who have had the guts to publicly disagree with the Conglomerate’s agendas and narratives have been silenced and persecuted. They have been blocked from social media platforms and other outlets of expression, they have been fired from their jobs and have had their incomes cut off, they have had their livelihoods and their lives destroyed, they have been arrested and incarcerated (such as the January 6 and vaccine-mandate protestors), and they have been killed (including from confrontations with police and adverse effects from forced vaccination).

The Conglomerate is determined to remain in control through any means necessary. So, it uses various strategies to deal with any prominent leaders of dissent who pose any danger to its control. It kicks Tucker Carlson off of his popular television platform. It relentlessly persecutes and prosecutes Donald Trump. It tries to silence Robert Kennedy Jr with a mainstream media blackout.

The tool of mass hysteria

One of the main tools that the Conglomerate uses to control the population is purposefully manufactured mass hysteria, such as the Trump Derangement Syndrome, COVID, and Ukraine hysterias. Most of the public mindlessly goes along with this—as if they are incapable of independent thought or free will while being held captive by Satan’s magnetic power. Those who do not go along with the hysteria are crushed.

Maintaining an endless series of mass hysterias is crucial for the US-centered elitist globalist agenda of power accumulation and population control. I believe that it has previously been said that Satan seeks to conquer the world by controlling the population—by controlling the minds, hearts, and souls of the people. That is exactly what is happening. Mass hysteria, mass psychosis, moral panic, group think—whatever you call it, this is what is happening to us today, and it is a very effective form of control that is pure evil.

“I was the CIA director. We lied, we cheated, we stole,” former CIA director and Secretary of State Mike Pompeo said on April 15, 2019 at a forum at Texas A&M University. “It was like – we had entire training courses. It reminds you of the glory of the American experiment.”

Interestingly, a Christian religious news broadcaster that described Pompeo’s words with such precision as follows: “that’s not the resume of the Secretary of State… that’s the resume of Satan.”

The hysteria is effective because it is designed to generate fear, which the Conglomerate then claims that only it can alleviate. All you have to do to feel better is trust the Conglomerate and faithfully obey its directives—regardless of how stupid and perverse those directives may be. Wear your masks, get your vaccines, take your pills, post your little Ukraine flags, call Trump a crook, call Kennedy a nut, and agree that men can be women, that two plus two equals five, and that shit tastes delicious especially when topped with puke. If you comply, you will be on the right side, the side of good, and you will be smart, and, best of all, you will always be safe. However, if you do not comply, you will be severely punished, and there is not a fucking thing that you can do about it. Comply, submit, and accept. Or the Conglomerate and its loyal followers will kill you in one way or another.

Needless to say, we are now unmistakably living in the twisted upside-down society described in Orwell’s Nineteen Eighty-Four.

The Conglomerate issues the command: “Be afraid of Russia. Russians are evil. We are good. We will protect you from them.” These are the lies that America uses as it provokes and prolongs a horrible war in Ukraine for the benefit of its military-industrial complex and its “woke” globalist agenda. American leaders even act as if they want to provoke a nuclear war with Russia, and, what the hell, China too. That is about as evil as a nation can get, is it not? But Satan loves and lusts for war—especially an elite globalist war that is waged against one nation (Russia) that is seeking to uphold its right to security as a nation-state and its values as an independent conservative culture. Satan hates nation-states. They get in the way of his unholy crusade for global governance—a one-world government aggressively pursuing an authoritarian decadent agenda. Satan—and America—will not tolerate the traditional, conservative culture of Russia blocking the progress of the great global crusade for gay and trans cultural domination!

Causing chaos and confusion

Post-World War II history shows that the United States loves creating war, chaos, confusion, destruction, and death around the world to advance its imperialist, globalist, corporatist, and now woke ambitions. Its military actions have killed millions of innocent people and destroyed countless lives in numerous war-waging adventures within the past several decades, including in Vietnam, Iraq, Afghanistan, Libya, Africa, the Palestinian lands, Eastern and Central Europe, Central and South America, and elsewhere. Iran, of course, was subjected to the Western-imposed gross injustices of the Pahlavi dictatorship, which is what the Iranian revolutionaries were so pissed off about in 1979.

But, unlike Russia, the US never gets punished with international sanctions or multinational business closings or preachy condemnations from airhead pop stars—because the US is the key crusader for the globalist movement. Thus, all the other globalists (EU, UN, WHO, multinational corporations, Hollywood, etc) are on the US establishment side.

“I was the CIA director. We lied, we cheated, we stole.”

Rising multipolar threat to Satan

Despite the scary doom-and-gloom reality of our current times, there are some encouraging signs that this US dominance is finally coming to an end, especially with the planned expansion of the BRICS group and the group’s creation of a new currency to challenge the previously almighty US dollar. Satan surely does not like the rising multipolar world that is going to relegate the US to the sidelines. That new world should reduce his influence quite a bit, hopefully. We will see.

The developing multipolar world poses a serious threat to the perpetual American quest to spread international chaos for the benefit of its powerful elite classes, who have their sticky tentacles grabbing at stuff all around the globe. But there is little threat to the continued spread of Satanic chaos within America itself. We see how genuine democracy—like free speech and free, honest elections—is in an advanced rotting gangrenous condition in the United States—even as the American authoritarians claim to be defending nonexistent “democracy” in Ukraine.

Domestic decadence, twisted technology

The American people cannot escape from the social and cultural decadence that now permeates all aspects of our domestic society. Social divisions and individual hatreds are purposefully stoked and aggravated by obsessions with the most intimate personal matters—skin color, genes, and sexuality. The education system is primarily concerned with political indoctrination. Traditional organized religions (which I do not subscribe to, but which have in the past provided at least some common moral and ethical ground for people) have been corrupted and polluted to such a massive extent that most people have seemingly rejected not only those religions, but also all types of traditional morals, ethics, and sane concepts of right and wrong.

Traditional values that have been systematically extinguished as Satan has grown in power include the support and love of the traditional family (father, mother, children), real in-person social interaction, basic kindness and decency, and psychologically essential contact with the outside natural world. All these important facets of normal, healthy human life have become casualties of US-created-and-promoted electronic technologies, which keep people addicted and enslaved to artificial “devices” and confine them like self-imprisoned convicts to artificial indoor environments. The results have been chronically pervasive neuroses and psychoses and the fundamental altering of human behavior and cognition. Electronic technology, in my opinion, has been the proudest achievement of Satan. (I’ve always thought that modern technology is basically evil, and I always agreed with Ted Kaczynski’s motives though not his methods.)

Satan is currently in a state of masturbatory ecstasy over all those ubiquitous, always-advancing, instant-gratification “pleasure” technologies—smartphones, computers, apps, Internet, virtual reality, artificial intelligence, and other things that I’m delighted to admit I don’t even know about. He also loves spreading the pleasures of US-promoted hedonistic pop culture and never-satisfied materialism. All you need to enjoy these pleasures is a credit card and an Amazon account. And you don’t ever need to pay off your credit card balance as you bury yourself under a mountain of endless debt. Who cares? It is the accepted American way, for both citizen and government.

As the Great American Satan keeps accumulating power, the millionaires and billionaires keep getting richer, and the majority of people keep getting intellectually dumber, emotionally more immature, and economically and spiritually poorer. But the people are so addicted to and hypnotized by their magic electronic devices that they will remain satiated with overwhelming pleasure even as their lives plummet deeper into Hell, their souls and minds become ever more vacuous, and their nature-derived freedoms are methodically stripped away by the Conglomerate’s authorities. Their drug addictions combine with their technology addictions to make them oblivious to any pain, guilt, or remorse. Satan smiles.

Reject the evil, speak the truth

Of course, the Iranian revolutionaries were not literally correct. The United States is not literally Satan. But the entrenched powers-that-be in the United States are the most prominent and influential forces of evil and destruction in the world today. And any American who supports or tolerates this situation is a dirty, guilty tool of Satan.

Therefore, any and all decent, moral people who are still around need to boldly reject this evil force—whether they are American dissidents living with the government-corporate bullshit at home or people in other countries struggling with the onslaught of American bullshit. Reject it, and reject it loudly for other people to hear and learn from.

After you open your eyes to reality, open your mouth and tell Satan to go back to Hell and stay there. We don’t want him anymore in our country or in our world.

A personal note

I originally wrote a version of this essay in early 2022 for Intellectual Conservative. The new essay here on The Unz Review is a revised and updated version. If you compare the old version with the new, you will see that my convictions have strengthened. Instead of thinking that Iran may have been correct in calling the US Satan, I now am sure that Iran was correct.

Early this year, I basically renounced and rejected my own country in very strong language. Nevertheless, I am still finding tiny causes for American hope that are occasionally popping up, like the quixotic presidential campaign of RFK Jr. I fully expect to eventually be disappointed in those pitiful little hopes. But, despite my cognitive, rational conclusion that America is forever dead as a free country and firmly in the grasp of Satan, I guess there remains some emotional or spiritual element deep inside me that refuses to give up totally. Perhaps my eyes still require some additional opening.

“Woe to the crown of pride, to the drunkards of Ephraim, whose glorious beauty is a fading flower, which is on the head of the fat valleys of them that are overcome with wine!” Isaiah 28:1

“I have seen a horrible thing in the house of Israel; there is the whoredom of Ephraim, Israel is defiled,” Hosea 6:10

“Ephraim surrounds me with lies, and the house of Israel with deceit” Hosea 11:12a

Passover During the Millennium • Ezekiel

•June 20, 2023 • Leave a Comment

In Hebrew the letter vav ו‬ is a symbol, or a letter indicative of a conjunction, but it doesn’t tell us what that conjunction is when we compare it to our English language. Conjunctions, as you know, are joining words to connect two or three thoughts: and, but, so, etc.

Passover during the Millennium

ו (vav) could be translated as ‘and’, ‘but’, ‘now’,  ’then’ — i.e. a conjunction translated as “and” such as in Genesis 1:2-31; but – Gen 2:17; now – Gen 3:1; so – Deu 1:15,43,46; yet – Deu 1:26,32; then – Gen 20:9, Deu 1:29,41; moreover – Deu 1:39

Genesis 1 (KJ21) – all start with a ו except the first verse. Also in, Deuteronomy 34 – all except verse 11.

1 In the beginning God created the heaven and the earth.

2 And the earth was without form and void, and darkness was upon the face of the deep. And the Spirit of God moved upon the face of the waters.

ב  וְהָאָרֶץ, הָיְתָה תֹהוּ וָבֹהוּ, וְחֹשֶׁךְ, עַל-פְּנֵי תְהוֹם; וְרוּחַ אֱלֹהִים, מְרַחֶפֶת עַל-פְּנֵי הַמָּיִם.

Chapters 40 to 48 of Ezekiel are a scene of the Millennium. It also tells us how the Passover is to be observed.

In Ezekiel 45:21 there isn’t a ו to connect the clauses! “‘In the first month, on the fourteenth day of the month, ye shall have the Passover, a feast of seven days. Unleavened bread shall be eaten.

That is, Passover is a feast of seven days, during which unleavened bread is to be eaten. It is a composite feast!

How plain is this! Yet the Chruch is blind, wretched and naked! Lukewarm, neither cold nor hot. And if not repented of, the Church will be spewed into the FIRE! (Revelation 3:16)

SS #01 The Written Word from Moses to King James

•June 19, 2023 • Leave a Comment

What are the Oracles of God?

What are the Oracles of God committed to the Jews? What are Oracles anyway?

“What advantage then hath the Jew? Or what profit is there in circumcision? 2 Much in every way; chiefly because unto them were committed the oracles of God. 3 For what if some did not believe? Shall their unbelief make the faithfulness of God without effect? 4 God forbid! Yea, let God be true, but every man a liar” Romans 3:1-4a

One minister says “the Bible doesn’t require extra-biblical interpretation nor do we need any from the Oral Law,” or another who claims “we believe in the original Protestant declaration, Solo Scriptura — that is we only need “the Scriptures only!”

Really? What does it mean when they claim, “the Scriptures only?”

To answer this question, let’s start with the writing of Moses:

Exodus 24

1 And He said unto Moses, “Come up unto the Lord, thou and Aaron, Nadab and Abihu, and seventy of the elders of Israel, and worship ye afar off.

And Moses alone shall come near the Lord; but they shall not come nigh, neither shall the people go up with him.”

And Moses came and told the people all the words of the Lord and all the judgments; and all the people answered with one voice and said, “All the words which the Lord hath said will we do.” — this they readily and hastily promise, because they were not aware of their own weakness, and because they did not understand the comprehensiveness and rigidity of God’s law.

And Moses wrote all the words of the Lord, and rose up early in the morning and built an altar under the hill, and twelve pillars according to the twelve tribes of Israel. — notice: the phrase “Moses wrote all the words of the Lord” but he wrote them at that time, in paleo-Hebrew

— the words Moses wrote were in Paleo-Hebrew alphabet; not modern Hebrew; and Moses wrote them without vowels, without spaces, and without any punctuation.

The Lord gave Moses the tablets of stone, all written in paleo-Hebrew

And he sent young men of the children of Israel, who offered burnt offerings and sacrificed peace offerings of oxen unto the Lord.

And Moses took half of the blood and put it in basins, and half of the blood he sprinkled on the altar.

And he took the Book of the Covenant and read in the audience of the people; and they said, “All that the Lord hath said will we do, and be obedient.” — the book of the covenant; that is, the book which he had written overnight, the collection of laws, commandments and all the judgments.

And Moses took the blood and sprinkled it on the people, and said, “Behold the blood of the covenant which the Lord hath made with you concerning all these words.” — and sprinkled it on the people; thus symbolising sealing the covenant between God and the people;

Then went up Moses and Aaron, Nadab and Abihu, and seventy of the elders of Israel;

10 and they saw the God of Israel. And there was under His feet as it were a paved work of a sapphire stone, and as it were the body of heaven in his clearness.

11 And upon the nobles of the children of Israel He laid not His hand. Also they saw God, and ate and drank.

12 And the Lord said unto Moses, “Come up to Me onto the mount, and be there; and I will give thee tablets of stone, and a law and commandments which I have written, that thou mayest teach them.” — notice: this was the original tablets of stone, created or made by God and given to Moses;

13 And Moses rose up with his minister Joshua, and Moses went up onto the mount of God. — Moses rose up, and attendant Joshua; the close connection of Joshua with Moses is here, for the first time, indicated; his employment as a general against Amalek earlier, (Exodus 17:9-13).

14 And he said unto the elders, “Tarry ye here for us until we come again unto you; and behold, Aaron and Hur are with you. If any man have any matters to arbitrate, let him come unto them.” — Moses said unto the elders; he understood that his stay in the mount was about to be a prolonged one;

15 And Moses went up onto the mount, and a cloud covered the mount. — and Moses went up into the mount; to the top of it, and as it seems alone, leaving Joshua behind in a lower part of the mountain;

16 And the glory of the Lord abode upon Mount Sinai, and the cloud covered it six days; and the seventh day He called unto Moses out of the midst of the cloud.

— and the glory of the Lord abode upon Mount Sinai; the divine Shekinah or Majesty, some visible token of it, an exceeding great brightness and splendour for six days;

— and on the seventh day he called unto Moses out of the midst of the cloud; in which the glory of God was, and which seems to favour the first sense of the preceding clause, that it was the glory of God the cloud covered.

17 And the sight of the glory of the Lord was like devouring fire on the top of the mount in the eyes of the children of Israel. — the sight of the glory of the Lord; to the Israelites in the plain below, the appearance on the top of the Mount was “like devouring fire.” A light like that of a conflagration rested on the top of the Mount all the time that Moses was away.

18 And Moses went into the midst of the cloud, and got himself up onto the mount; and Moses was on the mount forty days and forty nights. — forty days and forty nights, the whole time without eating and drinking (Deuteronomy 9:9). The number forty was certainly significant, since it was not only repeated on the occasion of his second protracted stay upon Mount Sinai.

This is an unorthodox approach to studying the Oracles of God. But first, we ask what are the components of the Oracles or the Scriptures? And how did Moses “Moses wrote all the words of the Lord” but he wrote them at that time, besides being in paleo-Hebrew.

For a change, we will start by reading just a portion of a chapter in the Bible that we are all familiar with

(a) Exodus 20:1-6 (first two commandments)

1 And God spoke all these words, saying:

“I m th Lrd thy Gd, wh hv brght th t f th lnd f gypt, t f th hs f bndg.

“Th shlt hv n thr gds bfr M.

“Th shlt nt mk nt th ny grvn mg, r ny lknss f nythng tht s n hvn bv, r tht s n th rth bnth, r tht s n t r ndr th rth.

Th shlt nt bw dwn thyslf t thm, nr srv thm; fr I, th Lrd thy Gd, m jls Gd, vstng th nqty f th fthrs pn th chldrn nt th thrd nd frth gnrtn f thm tht ht M,

nd shwng mrcy nt thsnds f thm tht lv M nd kp y cmmndmnts.

Now without the vowels, starting and ending sentences, capital letters, spaces and punctuations:

Exodus 20:2-6

mthlrdthygdwhhvbrghtthtfthlndfgypttfthhsfbndgthshlthvnthrgdsbfrmthshltntmkntthnygrvnmgrnylknssfnythngthtsnhvnbvrthtsnthrthbnthrthtsntrndrthrththshltntbwdwnthyslftthmnrsrvthmfrthlrdthygdmjlsgdvstngthnqtyfthfthrspnthchldrnntththrdndfrthgnrtnfthmththtmndshwngmrcyntthsndsfthmthtlvmndkpmycmmndmnts

(b) Genesis 1 (21st Century King James Version).

And we’ll try to read it without the vowels. It’s possible, let’s try:

Gnss 1:1-10 (21st Cntry Kng Jms Vrsn)
n th bgnnng Gd crtd th hvn nd th rth.
nd th rth ws wtht frm nd vd, nd drknss ws pn th fc f th dp. nd th Sprt
~ f Gd mvd pn th fc f th wtrs.
nd Gd sd, “Lt thr b lght”; nd thr ws lght.
nd Gd sw th lght, tht t ws gd; nd Gd dvdd th lght frm th drknss.
nd Gd clld th lght Dy, nd th drknss H clld Nght. nd th vnng nd th
~ mrnng wr th frst dy.
nd Gd sd, “Lt thr b frmmnt n th mdst f th wtrs, nd lt t dvd th wtrs frm
~ th wtrs.”
nd Gd md th frmmnt, nd dvdd th wtrs whch wr ndr th frmmnt frm th
~ wtrs whch wr bv th frmmnt; nd t ws s.
nd Gd clld th frmmnt Hvn. nd th vnng nd th mrnng wr th scnd dy.
nd Gd sd, “Lt th wtrs ndr th hvn b gthrd tgthr nt n plc, nd lt th dry lnd
~ ppr”; nd t ws s.
nd Gd clld th dry lnd rth; nd th gthrng tgthr f th wtrs clld H Ss; nd Gd
~ sw tht t ws gd.

In the beginning of God’s creation of the heavens and the earth.
בְּרֵאשִׁ֖ית בָּרָ֣א אֱלֹהִ֑ים אֵ֥ת הַשָּׁמַ֖יִם וְאֵ֥ת הָאָֽרֶץ:
Hebrew text with vowels
בראשית ברא אלהים את השמים ואת הארץ
Hebrew text without vowels

Below is the same Genesis 1:1-10 — without vowels, without spaces and punctuations.

nthbgnnngGdcrtdthhvnndthrth
ndthrthwswthtfrmndvdnddrknsswspnthfcfthdpndthSprtfGdmvdpnthfc
~fthwtrs
ndGdsdLtthrblghtndthrwslght
ndGdswthlghtthttwsgdndGddvddthlghtfrmthdrknss
ndGdclldthlghtDyndthdrknssHclldNghtndthvnngndthmrnngwrthfrstdy
ndGdsdLtthrbfrmmntnthmdstfthwtrsndlttdvdthwtrsfrmthwtrs
ndGdmdthfrmmntnddvddthwtrswhchwrndrthfrmmntfrmthwtrswhchw
~rbvthfrmmntndtwss
ndGdclldthfrmmntHvnndthvnngndthmrnngwrthscnddy
ndGdsdLtthwtrsndrthhvnbgthrdtgthrntnplcndltthdrylndpprndtwss
ndGdclldthdrylndrthndthgthrngtgthrfthwtrsclldHSsndGdswthttwsgd

“For there shall arise false christs and false prophets and shall show great signs and wonders, insomuch that, if it were possible, they shall deceive the very elect” Matthew 24:24

‏1:1 בראשית ברא אלהים את השמים ואת הארץ

‏1:2 והארץ היתה תהו ובהו וחשך על פני תהום ורוח אלהים מרחפת על פני המים

‏1:3 ויאמר אלהים יהי אור ויהי אור

‏1:4 וירא אלהים את האור כי טוב ויבדל אלהים בין האור ובין החשך

‏1:5 ויקרא אלהים לאור יום ולחשך קרא לילה ויהי ערב ויהי בקר יום אחד

‏1:6 ויאמר אלהים יהי רקיע בתוך המים ויהי מבדיל בין מים למים

‏1:7 ויעש אלהים את הרקיע ויבדל בין המים אשר מתחת לרקיע ובין המים אשר מעל לרקיע ויהי כן

‏1:8 ויקרא אלהים לרקיע שמים ויהי ערב ויהי בקר יום שני

‏1:9 ויאמר אלהים יקוו המים מתחת השמים אל מקום אחד ותראה היבשה ויהי כן

‏1:10 ויקרא אלהים ליבשה ארץ ולמקוה המים קרא ימים וירא אלהים כי טוב

Above is Genesis 1:1-10 in Hebrew without vowels but with word and sentence breaks.

Below is the same Genesis 1:1-10. And this is how Moses would have written the Torah if in English — without vowels, spaces, punctuations, capitalization nor sentence/paragraph breaks.

nthbgnnnggdcrtdthhvnndthrthdthrthwswthtfrmndvdnddrknsswspnthfcfthdpndthsprtfgdmvdpnthfcfthwtrsndgdsdltthrblghtndthrwslghtndgdswthlghtthttwsgdndgddvddthlghtfrmthdrknssndgdclldthlghtdyndthdrknsshclldnghtndthvnngndthmrnngwrthfrstdyndgdsdltthrbfrmmntnthmdstfthwtrsndlttdvdthwtrsfrmthwtrsndgdmdthfrmmntnddvddthwtrswhchwrndrthfrmmntfrmthwtrswhchwrbvthfrmmntndtwssndgdclldthfrmmnthvnndthvnngndthmrnngwrthscnddyndgdsdltthwtrsndrthhvnbgthrdtgthrntnplcndltthdrylndpprndtwssndgdclldthdrylndrthndthgthrngtgthrfthwtrsclldhssndgdswthttwsgd (Gnss1:1-10; mgnthsrHbrwcnsnntsthtMsswldhvwrttnfrthTrhfnnglshwthtvwlsspcspncttnscptlztnnrsntnc/prgrphbrks — imagine these are Hebrew consonants that Moses would have written for the Torah if in English; without vowels, spaces, punctuations, capitalization nor sentence/paragraph breaks)

So when it is written that Moses wrote all the words of the LORD as stated in Exodus 24:4, his written texts (except of course, he wrote from right to left in paleo Hebrew scripts instead of the modern ‘square’ alphabets) were only making sense to himself, but to an outsider, they were just unreadable. [Note: this Bible study is greatly simplified as cantillation and other numerous peculiar details of the Sacred Text are not discussed here]

A Fragment of the Dead Sea Scrolls: Created 300 BC to AD 100; no dots and dashes but there are word and sentence breaks

For well over two thousand years until the appearance of the Aleppo Codex in the tenth Century, scribes, priests and Levites with the Scriptures would have to memorise where the vowels and other punctuations were located so that the Scriptures would make sense to those who hear them.

The Aleppo Codex is an ancient, bound manuscript of the Hebrew Bible, written by scribes called Masoretes in Tiberias, Israel, around AD 930. The Masoretes were Orthodox rabbis who made it their special work to copy and maintain the text of the Old Testament during the Babylonian captivity and beyond.

As a Masoretic manuscript, the Aleppo Codex was written in modern Hebrew to incorporate vowel marks, cantillation signs (to guide pronunciation when chanting the text), and interpretive marginal notes. The last and most prominent member rabbi from Tiberias was Aaron ben Moses ben Asher; hence the tradition of ben Asher has become the one accepted for the Hebrew Bible.

Aleppo Codex in the tenth Century, with vowels (dots and dashes) incorporated

The Karaite Jewish community of Jerusalem purchased the codex about a hundred years after it was made. When the Crusaders conquered Jerusalem in 1099, the synagogue was plundered and the codex was held for a high ransom, which was paid with money coming from Egypt, leading to the codex being transferred there. It was preserved at the Karaite synagogue, then at the Rabbanite synagogue in Old Cairo, where it was consulted by Maimonides, who described it as a text trusted by all Jewish scholars. It is rumoured that in 1375 one of Maimonides’ descendants brought it to Aleppo, Syria, leading to its present name.

The Aleppo Codex is so called because, for centuries, the book was kept and zealously guarded for some 600 years in a basement chapel of the Central Synagogue of Aleppo, Syria. Anti-Jewish riots in Aleppo in 1947 resulted in the Aleppo Codex being smuggled out of Syria, and the codex eventually made it to Israel about 10 years later.

In the process, about 200 pages of the codex went missing and are presumed destroyed. Today, the Aleppo Codex now resides in the Shrine of the Book in the Israel Museum in Jerusalem.

The Aleppo Codex now resides in the Shrine of the Book in Israel Museum, Jerusalem

Another manuscript of the Hebrew Bible from the same time period as the Aleppo Codex is the Leningrad Codex, kept in the Russian National Library in St. Petersburg, Russia. Scholars consider the Aleppo Codex to be superior to the Leningrad Codex because it displays an amazing accuracy and attention to detail, earning its title “the Crown of Aleppo,” and leading many to consider it the most authoritative text of the Hebrew Bible.

Today the vast majority which would be no less than 99.99 percent of professing Christianity still maintain that we could read just the Written text of Moses without any input from the Oral Torah, which makes this a fundamental error. This false foundation differs greatly from the original Nazarenes where they understood what the Oracles as given to the Jews (Romans 3:1-4) would mean.

One example: Gog vs Agag

Gog and Magog is found in Ezekiel 38 to 39; the general understanding is that Gog is the chief, the chief of a confederacy against Israel at the endtime; whereas Agag was the king of the Amalekites whom the Lord had asked King Saul to kill, which he didn’t. Without the vowels Gog and Agag would be using the same consonents gg.

Thus the term chief or title “Gog” be be translated as Agag or as the Amalekitish kings instead? The name Gog occurs only in connection with Magog, except in 1 Chronicles 5:4.

In Numbers 24:7 it was translated as “Gog” in the Septuagint in place of Agag. It has been suggested that “Agag” was a dynastic name of the kings of Amalek, a grandson of Esau; just as Pharaoh was used as a dynastic name for the ancient Egyptians; Caesar of Rome and of more modern times, the Czar of Russia;

There shall come a man out of his seed, and he shall rule over many nations; and the kingdom of Gog shall be exalted, and his kingdom shall be increased. Numbers 24:7 (Septuagint) “Agag” in the Masoretic; throughout history there is no concept of any “kingdom of Gog” but a “kingdom of Agag” could be conceptualized as the kingdom of the Amalekites.

In summary, unless trained in both the Written and Oral Torah, the children of Israel would not be able to read the Sacred Text, which only had consonants written. This means our modern understanding of what our Scriptures, like our King James Version, say have a huge portion of the Oral Law incorporated. To think otherwise is porous thinking, built on loose sands.

First edition King James Bible, 1611

The written Torah, when originally written, were just the consonants but the Oral Knowledge were memorised. Torah means instructions, teachings and knowledge, and these accumulated knowledge is known as the Oral Law and is not necessarily the legalistic concept of law we know today.

What does this “nthbgnnnggdcrtdthhvnndthrth” mean? A learned scribe would know it was “In the beginning God created the heaven and the earth” by adding his Oral Torah to make the meaning clear. Thus when the Aleppo Codex was written in the tenth century, vowels were embedded. For the Hebrew Sacred text to be readable by the common people, it also means that the Oral Law were intrinsically embedded into the Written Torah.

Many hundred years later, in 1611, the English King James version of the Bible arrived. And like it or not, it had similarly incorporated the Oral Torah with the Written Torah. For the churches to say that our Scriptures are the written Word of God and we don’t need the Oral Torah is just misguided, deceived. And being puffed up and deceived they go about deceiving others.

My people hath been lost sheep; their shepherds have caused them to go astray. They have turned them away on the mountains; they have gone from mountain to hill; they have forgotten their resting place.
All who found them have devoured them; and their adversaries said, ‘We offend not, because they have sinned against the Lord, the habitation of justice, even the Lord, the hope of their fathers’ Jeremiah 50:6-7

The first Church after the apostolic age was the Roman Catholics and they are the most populous today. Others in the West, many sprang from the British Isles or the United States. Such deceptions are so deeply embedded and entrenched that this truth would sound strange, unorthodox and foreign.

Today many Christians believe they will go into a Place of Safety when tribulation comes – but they will only achieve it in their fantasies.

It’s far more likely that lightnings and thunderstorms would begin at His sanctuary (Ezekiel 9:6), that is, dark days lie ahead for these professing Christians. “Slay utterly old and young, both maids and little children and women; but come not near any man upon whom is the mark; and begin at My sanctuary.”

“I will take away the remnant of the house of Jeroboam, as a man taketh away dung, until it be all gone” (1 Kings 14:10b)

“Ephraim compasseth me about with lies, and the house of Israel with deceit” Hosea 11:12

“Manasseh, Ephraim; and Ephraim, Manasseh; and they together shall be against Judah. For all this His anger is not turned away, but His hand is stretched out still” Isaiah 9:21

Thus saith the Lord God: Behold, I am against the shepherds; and I will require My flock at their hand and cause them to cease from feeding the flock, neither shall the shepherds feed themselves any more. For I will deliver My flock from their mouth, that they may not be meat for them. Ezekiel 34:10

China and Honduras – Coup Attempt on the Way Again?

•June 17, 2023 • Leave a Comment

On Monday, the growing international influence of China was again rubberstamped, with the signing of a comprehensive bilateral cooperation deal between Beijing and Honduras, both countries having only established formal relations in the past two months.

Honduran President Xiomara Castro’s visit to Beijing on June 12, 2023

Global Research by Gavin OReilly • June 14, 2023

Coming only three months after a Chinese-brokered deal established a rapprochement between former Gulf rivals Iran and Saudi Arabia, and a similar deal organised by Russia led to Riyadh restoring ties with Syria, Honduran President Xiomara Castro’s official visit to Beijing is yet another development in the emergence of the new multipolar world.

Going by historical trends related to Honduras and the wider Latin American region, it may also indicate that a Washington-organised coup attempt targeting the country, intended to maintain US hegemony, is on its way.

In 2009, husband of Xiomara Castro and then-President Manuel Zelaya was overthrown and exiled by the Honduran military in a dispute over proposed changes to the country’s constitution relating to the length of Presidential terms.

Investigative website WikiLeaks would later reveal that although the US Embassy in Honduras privately recognised Zelaya’s removal from power as a military coup d’etat, then-Secretary of State Hillary Clinton refused to acknowledge it publicly, which would have resulted in the US being legally mandated to suspend all support for the new post-coup Honduran government of Roberto Michelleti; the reasoning for this being her view of Zelaya as a troublesome Hugo Chávez-style leader, one who wouldn’t comply easily with demands related to Washington’s interests in the region.

Indeed, Honduras had served as a strategic US military outpost during the 1980s, with thousands of US troops stationed in the country for the purpose of providing arms and training to Contra rebels, who were then sent on to wage war against the Sandinista government of neighbouring Nicaragua, previously under the leadership of US-backed Anastasio Somoza until his overthrow in 1979.

Honduras officially joins China-proposed BRI as bilateral ties develop rapidly

This would be part of a Cold War US policy in the region which involved the arming and training of anti-communist groups in order to prevent the Soviet Union gaining a foothold in Latin America; with perhaps the most notorious implementation of this policy being Operation Condor.

A covert CIA programme in the same vein as Operation Cyclone which would play out later in Afghanistan, Operation Condor saw the US throw its support behind numerous military juntas in Latin America in order to maintain regional hegemony, with the most well-known being the 1973 coup d’état which saw General Augusto Pinochet come to power in Chile.

In 1970, the election of Socialist candidate Salvador Allende as President of Chile, and his subsequent nationalisation of the lucrative copper mining and telecommunications industries, would lead to the multinational ITT placing pressure on Washington to oust the Chilean leader from power, with the communications giant holding a 70% stake in Chile’s telecom infrastructure.

In order to protect corporate interests and to maintain Washington’s influence in the region, a violent CIA-backed coup would be launched in Chile on the 11th of September 1973.

Involving the seizure of key sites around the country by the Chilean military, the coup would end with the bombing and seizure of the La Moneda Presidential Palace. Allende, who refused to flee in exile, would die amidst the chaos, his death initially reported as a suicide, though with foul play strongly suspected.

The post-coup junta of Pinochet would see the introduction of neoliberal market reforms which would allow US corporate interests to again take a foothold in Chile, and which endeared him to the subsequent British and US governments of Margaret Thatcher and Ronald Reagan. His rule, which saw the state-sponsored executions of 3,000 political dissidents and the forcible exiling of 200,000 more, would last until 1990, with the Cold War coming to an end the following year.

The cessation of hostilities between western free market capitalism and eastern communism wouldn’t result in an end to US interference in Latin America however.

As recently as 2020, Operation Gideon, a Bay of Pigs-style coup attempt involving US mercenaries and likely given covert authorisation by the White House, took place in Venezuela in an attempt to remove the government of Nicolás Maduro – like his predecessor Hugo Chávez, a long-time target of the regime-change lobby owing to the pairs nationalisation policies in the oil-rich nation.

Now, with Honduras establishing diplomatic ties with China amidst the new multipolar world, it may only be a matter of time until Tegucigalpa is again subjected to something similar. 

“For the day of the Lord is near upon all the nations. As thou hast done, it shall be done unto thee: thy reward shall return upon thine own head” Obadiah 1:15

How the BRI train took off

•June 16, 2023 • Leave a Comment

How the BRI train took the road to Shangri-La

The Cradle by Pepe Escobar • June 12, 2023

In less than a decade, China’s BRI has fundamentally transformed global geopolitics. It is already far too late for the west to compete.

“China is a sleeping giant . . . when she wakes up, it will shake the world” Napoleon.

It is important to recognize that the US/NATO proxy war against Russia in Ukraine is simultaneously a war designed to interrupt the progress of China’s Belt and Road Initiative (BRI).

As we approach the 10th anniversary of the BRI, to be marked by the third Belt and Road Forum later this year in Beijing, it is clear the original Silk Road Economic Belt – announced by President Xi Jinping in Astana, Kazakhstan, in September 2013 – has traveled a long way.

By January this year, 151 nations had already signed up to the BRI: No less than 75 percent of the world’s population that represents more than half of the global GDP. Even an Atlanticist outfit such as the London-based Center for Economic and Business Research admits that the BRI may increase global GDP by a whopping $7.1 trillion a year by 2040, dispensing “widespread” benefits.

Included in the Chinese Constitution since 2018, BRI constitutes the de facto overarching Chinese foreign policy framework all the way to 2049, marking the centenary of the People’s Republic of China.

The BRI advances along several overland connectivity corridors – from the Trans-Siberian to the “middle corridor” along Iran and Turkiye and the China-Pakistan Economic Corridor (CPEC) all the way to the Arabian Sea. Meanwhile, on the waterways front, the Maritime Silk Road offers a parallel network from southeast China to the Persian Gulf, the Red Sea, the Swahili Coast, and the Mediterranean Sea.

All that is mirrored by the Russian-driven Northern Sea Route, connecting the eastern and western sides of the Arctic, and reducing to and fro sailing time from Europe to Asia from one month to less than two weeks.

Such a massive Make Trade Not War project, centered on connectivity, infrastructure building, sustainable development, and diplomatic acumen – focusing on the Global South – could not but be interpreted by western elites as a supreme geopolitical and geoeconomic threat.

And that’s why every geopolitical turbulence across the chessboard is directly or indirectly linked to BRI. Including Ukraine.

“A brand new choice”

At the Lanting Forum in Shanghai last month, Chinese Foreign Minister Qin Gang was at ease presenting to a select foreign audience the key outlines of “modernization, the Chinese way” and how it can be applied across the Global South.

For their part, Global South experts had a chance to dwell on the motives underneath the collective west’s constant “threat” paranoia. The bottom line is that for the US and its vassal allies, it is anathema that Beijing – based on its own success – is offering an alternative development model compared to the sole product on the market since 1945.

Former Brazilian President Dilma Rousseff, currently the new president of the Shanghai-based New Development Bank (NDB) – the BRICS bank – explained to the forum how neoliberalism was forced onto Latin America as a false path towards economic success. The Chinese model, on the other hand, as she stressed, now offers a “brand new choice,” which respects national peculiarities.

Zhou Qiangwu, the Chinese vice president of NDB, expects that this will push the IMF and the World Bank to give the Global South more say in their decision-making as part of new “governance solutions.”

Yet that’s unlikely to happen because the US and its vassals are not mentally prepared to get rid of their baggage of centuries-old prejudice and sit down at the same table with Global South representatives and accept them as equals as well as qualified stakeholders.

The Global South though, waits for no one. Round tables are already following each other at dizzying speed. A key case was the May 18-19 China-Central Asia summit in the former imperial capital, Xi’an, when President Xi met with the presidents of Kazakhstan, Kyrgyzstan, Tajikistan, Turkmenistan, and Uzbekistan – the five former USSR republics in the Heartland.

That followed Russian President Vladimir Putin meeting the same five “stans” in Moscow on the extremely significant 9 May, Victory Day.

Diplomatically, that suggests an already evolving 5+2 axis uniting Russia, China, and the five stans operating via their own secretariat in a slightly different manner from BRI, the Shanghai Cooperation Organization (SCO), and the Eurasia Economic Union (EAEU).

And why is that? Because of a problem that will be afflicting all of these new multilateral Global South-led organizations: Internal frictions.

And that brings us to the presence of India inside the SCO, an organization that privileges consensus in every decision.

That’s a huge issue when in contrast with the intractable India-Pakistan conflict, and even more sensitive when it comes to New Delhi’s wobbling stance regarding Quad and AUKUS. At least the Indians have not totally submitted to NATO in its hybrid war against Russia-China and its dream of dictating terms in the Indo-Pacific.

“A large-scale Eurasian partnership”

Xi and Putin have fully understood the strategic energy stakes: Increased shipments of Russian oil and gas to China equal way more transit across the Heartland. So a fully integrated strategy is a must. And it will have to be integrated at the level of BRI and EAEU interaction, even if there may be a “gap” inside the SCO.

Practical examples include accelerating the construction of the ultra-strategic Xinjiang-Kyrgyzstan-Uzbekistan railway, which has been delayed for years: That will boost further connectivity with Afghanistan, Pakistan, and Iran.

In parallel, CPEC will be extended to Afghanistan: That was finally decided on during an AfPak-China ministerial meeting in Islamabad on 5 May. Although a very thorny dossier still remains: How to deal with, cajole, and satisfy the Taliban leadership in Kabul.

Xi and the Heartland leaders in Xi’an forcefully committed to preventing “foreign interference” and proverbial color revolution attempts. These are all engineered to disturb BRI.

Now compare it with the G7 meeting in Hiroshima – which was yet another thinly disguised exercise about  “containing” China. The Hiroshima communiqué, issued on May 20, a day after Xi and Central Asia in Xi’an, was heavy on “de-risking” – the new Western mantra that replaces “decoupling.”

The EU had already telegraphed the move via notorious European Commission President Ursula von der Leyen: Deception rules, because the concept that really matters, “economic coercion,” persists. Yet no serious Global South player thinks he’s being “coerced” to join BRI.

Comic relief was offered via the G7 committing to raise a whopping $600 billion in funding to build “quality infrastructure” via a so-called Global Infrastructure Investment Partnership: Call it the white man’s burden answer to BRI.

The fact remains that no one – from the western-monikered “Indo-Pacific” to ASEAN and the Pacific Islands Forum (PIF) – is demonstrating any sign of being “coerced” by China, not to mention showing any interest in ditching or antagonizing a wealth of trade and connectivity prospects.

At the EAEU summit in Moscow in late May, it was up to Putin to cut to the chase by emphasizing Russia’s active cooperation with BRICS, SCO, ASEAN, GCC, and multilateral organizations in Africa and Latin America.

Putin explicitly referred to “building new sustainable logistics chains” and developing the key connection between the EAEU and the International North-South Transportation Corridor (INTSC).

It gets better. He also emphasized working with China to “link the integration processes” of the EAEU and BRI, thus “implementing the large-scale idea of building a large-scale Eurasian partnership.”

It’s all here: Everything that makes Atlanticist elites howl in desperation. Old fox Belarusian President Alexander Lukashenko, who has seen it all since his USSR days, summed it up thus: Combining integration efforts – EAEU, SCO, BRICS – “will contribute to the creation of the largest coalition of states.”

And he came up with the money quote that will surely reverberate all across the Global South: “If we lose time – we will never make up for it. The one who runs faster now will be in the vanguard for a couple of decades.”

The jade tiger pounces

All that brings us to Shangri-La, East Asia’s premier dialogue platform in Singapore, this past weekend.

The real highlight was State Councilor and Defense Minister General Li Shangfu explaining China’s “New Security Initiative” in detail.

Li stressed the concept of “common, comprehensive, cooperative and sustainable security.” Remember: That’s exactly what Moscow was proposing to Washington in December 2021, which was met with a non-response response.

He noted that China is “ready to work with all parties” to strengthen the awareness of an “Asia-Pacific community with a shared future” (Note: Asia-Pacific is the denomination everyone in the region understands, not “Indo-Pacific”).

And then he got to the nitty-gritty: Taiwan is China’s Taiwan. And how to solve the Taiwan question is the Chinese people’s business. The message could not be more straightforward:

“If anyone dares to split Taiwan from China, the Chinese military will resolutely safeguard China’s national sovereignty and territorial integrity without any hesitation, at all cost, and not fearing any opponent.”

The Chinese delegation at the Shangri-La totally dismissed the “so-called ‘Indo-Pacific strategy’” as a tawdry Hegemon rant.

What Shangri-La unveiled was, in fact, Beijing’s clear, concise response to all those dismissals of BRI, all that carping about “debt trap” and “economic coercion,” all that “de-risking” rhetoric, and all those mounting intimations of false flags in Taiwan leading to the “real” war that the neocons in charge of US foreign policy dream about.

Obviously, intellectually shallow Beltway types won’t get the message. Especially because Li Shangfu was as polished as a jade tiger – elegantly pouncing over an avalanche of lies. You wanna mess with us? We’re ready. The barbarians predictably will keep rattling at the gate. The jade tiger awaits.

“China rocks in my opinion” Elon Musk

China Spying in Cuba?

•June 15, 2023 • Leave a Comment

Why wouldn’t China draw Cuba into the new Cold War with the United States?

RT World News by Timur Fomenko • June 13, 2023

Reports of Beijing’s planned ‘spy base’ on Washington’s doorstep are unsubstantiated but not unrealistic.

Last week an unnamed-sources-based story in the Wall Street Journal claimed that China is set to pay Cuba to build a “secret spy base” in the country.

The island, adjacent to the United States, has long been a huge geopolitical flashpoint following the Communist Revolution in the country in 1960, which brought it to the highest point of Cold War tensions – the Cuban Missile crisis.

Although there is no tangible evidence as to whether this spy-base story is true or not, it is however clear that as US-China tensions rise, the Caribbean country is yet again becoming a geopolitical football as a means of getting at the US.

As a communist state situated right on America’s doorstep, one which Washington is overwhelmingly hostile against and has long sought to subjugate, why wouldn’t China take the opportunity to use Cuba to the US’ annoyance? It would be foolish not to do so.

Still, there is some context to consider. First of all, the US is currently gripped by extreme paranoia regarding China. Almost all things pertaining to Beijing in recent months have been accused, almost always without evidence, of being a covert means for espionage of some sorts.

There are no rational limits to what may come under the crosshairs, and the bar for the definition of “spying” is so low it might as well not exist.

But that doesn’t mean China doesn’t have good reasons to do so. For all the paranoia, it is the US that is currently pursuing a full militarization of China’s periphery. It is pushing countries for more military bases and defence agreements, it is flying reconnaissance flights against Beijing almost daily, it is sailing warships through the South China Sea and the Taiwan Strait.

The US believes it has a divine right to spy on and confront China, and if the Chinese retaliate, well, they are the bad guys.

Secondly, the US has long baselessly accused China of constructing secret bases in third-party countries, often in a bid to undermine its relationship with those countries. This includes a so-called “naval base” in Cambodia, a base in the Solomon Islands, a base in Equatorial Guinea in West Africa, a base in the United Arab Emirates and so on.

This would make it logical for allegations of a Chinese base in Cuba to be a perfect McCarthyist fantasy: one communist state the US is irrationally paranoid about using another communist state it is also obsessed with as a means to undermine Washington. It’s a Marco Rubio wet dream.

Therefore, if you were China, why wouldn’t you take advantage of the existence of Cuba and give the US a taste of its own medicine? Cuba of course overtly welcomes the rise and role of China. Havana is subject to a 60-year-long economic blockade by the US that has tried to impoverish and crush the country, as well as to remove its government.

Following the end of the Cold War, the demise of the Soviet Union isolated and weakened Cuba. It is, given the events of the past few decades, nothing short of a miracle that the US did not decide to openly invade the country during its unipolar era, with several other “hostile” regimes during that period meeting such a fate.

Thus, the rise of another long-term communist friend as an economic superpower is a huge benefactor for Cuba, because it finally gives it a new option as a source of trade, investment and, of course, a geopolitical guarantee of protection. 

Cuba has become a critical partner in China’s Belt and Road Initiative (BRI), which has involved China modernizing the country’s ports, building telecommunication infrastructure and collaborating on energy.

Latin American states as a whole have strengthened their relationships with China precisely because it allows them to escape US hegemony, which has long unilaterally subjected the region to its preferences.

But Cuba especially gives China leverage over the US, given the provocative way Washington is interfering with Taiwan, so the idea of a “spy base” is realistic. Although Beijing’s relationship with Havana will never become a military alliance, and likely never replicate the events of the last Cold War, it is an important strategic partner in responding to and containing the US.

Cuba of course is not a threat to the US, but it is a nuisance and a menace ideologically, and what better way is there to respond to the US than by ensuring that its attempts to strangle, contain and stop Cuba from thriving never succeed? Beijing believes Havana should succeed through economic development and, spy base or not, that’s what it will do here.

“For the day of the Lord is near upon all the nations. As thou hast done, it shall be done unto thee: thy reward shall return upon thine own head” Obadiah 1:15

Chinese Universities Ranked ahead by Nature Index

•June 14, 2023 • Leave a Comment

Chinese universities ranked ahead of Oxbridge, Caltech in quality research output by Nature Index.

Nature Index • May 19, 2023 // South China Morning Post • June 12, 2023

“China is a sleeping giant . . . when she wakes up, it will shake the world” Napoleon.

Some universities that are little known outside China are rapidly surpassing their more established counterparts in the West – including Oxford, Cambridge, Princeton and Caltech – in high-quality scientific research, according to the latest Nature Index.

Sun Yat-sen University overtakes Oxford with 22 per cent more contributions to world research in the past year, rankings show.

Sun Yat-sen University, based in Guangzhou, southern China, was placed 10th on the Nature Index, ahead of Oxford

Seven of the top 10 university contributors were from China in the updated list – maintained by the academic journal Nature – that tracks contributions to research articles published in 82 of the world’s most influential natural science journals.

The index was based on scientific research output between February 1, 2022 and January 31, using “simple, transparent and current metrics that demonstrate high quality research and collaboration,” according to Nature.

For the first time, China has overtaken the United States as the number one ranked country or territory for contributions to research articles published in the Nature Index group of high-quality natural-science journals.

Data on author affiliations from the 82 journals tracked by the Nature Index show that China had a Share of 19,373 from January to December 2022, compared with 17,610 for the United States (see ‘Role reversal’).

A country’s Share takes into account the percentage of authors from that nation on each paper published in Nature Index journals; an article published entirely by China-based researchers would yield a Share of 1 for China.

The Chinese Academy of Sciences’s Ming’antu observing station in China’s Inner Mongolia autonomous region

Since the Nature Index was first introduced in 2014, China’s Share has been rapidly gaining ground, and it was the leading country in the physical sciences and chemistry in 2021.

The latest data — a snapshot of the database taken in April, ahead of the full release of 2022 data in the 2023 Nature Index annual tables — suggest that China also overtook the United States in Earth and environmental sciences for the first time. This leaves only one natural-sciences category — life sciences — in which it is still trailing.

“China rocks in my opinion” Elon Musk

China’s most powerful warship radar: scientists

•June 8, 2023 • Leave a Comment

China is building the most powerful warship radar on record: scientists

South China Morning Post by Stephen Chen • June 7, 2023

Chinese scientists have revealed that construction has begun of a radar system that could shift the balance of naval power in the world’s oceans with its ability to detect incoming missiles from thousands of kilometres away.

A Chinese military vessel equipped with the radar would be able to detect a ballistic missile from up to 4,500km (2,800 miles) away – about the distance from southern China to northern Australia, according to scientists involved in the project.

The radar can also track multiple targets within 3,500km, or about the distance to Guam, the researchers said, in a peer-reviewed paper published on May 31 by the Chinese-language journal Electric Machines and Control.

The team of scientists and engineers, led by associate professor Sun Donyang from the Harbin University of Science and Technology, said the radar is suitable for installation on new Chinese warships, with the first system already in construction.

While the line of sight can be affected by the Earth’s curve, the unprecedented boost in search and tracking capabilities could give the PLA Navy a major advantage, the researchers said.

Radars in most military vessels have a working range of a few hundred kilometres, limited by the immense power required to extend their capability. The researchers said they overcame the problem, making the system suitable for newer ships with electric propulsion systems.

According to the paper, the new-generation active phased array radar is made up of “tens of thousands” of transceivers, an order of magnitude far greater than featured in more usual devices, the researchers said.

Each transceiving array unit can send and receive signals as an independent radar. When working together, these units can generate pulse electromagnetic signals as powerful as 30 megawatts – enough to wreck the electrics of any warship in existence.

A Beijing-based radar scientist who was not involved in the project said that until recently the idea of putting a 30 megawatt radar on a battleship was “more or less science fiction.”

But China is under enormous pressure to develop better radars for its warships because of the increasing US military activities in Asia, said the scientist, who asked not to be named due to the issue’s sensitivity.

“The more powerful our naval radar becomes, the more likely it is that we can suppress the US in the South China Sea.”

“The children of Ephraim, being armed and carrying bows, turned back in the day of battle” Psalm 78:9

Size can be a problem when developing long-range radar systems. For instance, Florida’s 32-megawatt AN/FPS-85 radar – the world’s most powerful, according to its owner the US Space Force – takes up more than 23,000 square metres (250,000 sq ft) of floor space, or three soccer fields.

Technological advances have significantly reduced the size of high-power radars, with some critical components available in larger quantities and at lower prices than ever before, thanks to the mass application of 5G technology.

But the power supply for their groundbreaking radar remained a challenge for Sun and his colleagues, who had to overcome the radar’s tendency to produce extremely strong electric shocks when generating its powerful signals in rapid pulses.

To prevent damage to the other electronic devices within the confined space of a vessel, Sun’s team had to separate the radar from the ship’s power network. This would require some large, high-performance capacitors to act as a buffer, they said.

The researchers turned to high-speed train manufacturer China Railway Rolling Stock Corporation (CRRC), the world’s largest maker of bullet trains that built the world’s first mass production line for super capacitors in 2013.

High-speed trains in China are driven by high-voltage current to reach an operational speed of up to 350km/h (217mph), with powerful and reliable capacitors ensuring a smooth and stable energy supply over long distances.

Sun’s team said test results suggested that customised capacitors made by CRRC for the radar could almost eliminate the power shocks it generates. And at slightly over 1 tonne, the entire power supply system with capacitors and other components is small enough to fit in a ship, they said.

It is also surprisingly efficient, according to the researchers. Even at full capacity, the radar would only impose a constant load of 235 kilowatts on the ship’s power supply network, which could be handled by the generators on mainstream warships, they said.

Electromagnetic radiation is also a major concern when developing large-scale radar systems. It remains unclear from the paper what effect the device could have on the sailors on board or marine life.

The radar’s development is unusual, in that cutting-edge technology is more commonly applied first in the defence industry before trickling down to civilian manufacturing sectors.

“It can also work the other way around, especially when we need to produce a large number of advanced weapons at a low cost,” the Beijing-based radar researcher said.

China has built more than 40,000km of high-speed railways – enough to circle the Earth – in less than 15 years, providing the industrial expertise that Sun’s team were able to draw on for their project.

The researchers were also able to take advantage of China’s embrace of 5G. By the end of last year, the country’s telecommunication companies had deployed 2.3 million base stations nationwide – significantly ahead of the US, which has about 175,000, according to some industry estimates.

China also dwarfs the US in shipbuilding capability, with 13 naval shipyards producing some of the world’s largest and most advanced warships.

US Navy Secretary Carlos Del Toro said in February that one of these shipyards has more capacity than all of the United States’ seven facilities combined. “That presents a real threat,” he said.

“The children of Ephraim, being armed and carrying bows, turned back in the day of battle” Psalm 78:9

Pentecost • Leviticus 23:16 • 50 vs 50th

•June 6, 2023 • Leave a Comment

Even unto the morrow after the seventh sabbath (וְ) shall ye number fifty (חֲמִשִּׁ֣ים) days; and ye shall offer a new meat offering unto the LORD.

In Hebrew there is a letter Va above, a conjunction, often translated as ‘and’ in some versions which is erroneous in this case but should be ”then” (or namely) the fiftieth [חֲמִשִּׁ֣ים] as Leviticus 25:10 “And ye shall hallow the fiftieth [הַחֲמִשִּׁים֙ H2572 ḥă·miš·šîm] year, and proclaim liberty throughout all the land unto all the inhabitants thereof. It shall be a jubilee unto you; and ye shall return every man unto his possession, and ye shall return every man unto his family.”

Or the fiftieth [חֲמִשִּׁ֣ים] year of Azariah in II Kings 15:23. “In the fiftieth year of Azariah king of Judah Pekahiah the son of Menahem began to reign over Israel in Samaria, and reigned two years.”

After the first festal day of Pascha (or, the day after the feast‑day of Pascha)

Hence a better translation for Leviticus 23:16 should be:

Even unto the morrow after the seventh sabbath shall ye then number the fiftieth days; and ye shall offer a new meat offering unto the LORD.

Or

Even unto the morrow after the seventh sabbath; namely, the fiftieth day, shall ye offer a new meat offering unto the LORD.

On when to start counting Pentecost the Targum has this to say in Leviticus 23:
And the Lord spake with Mosheh, saying: Speak with the sons of Israel, and say to them: When you have entered into the land which I give you, and you reap the harvest, you shall bring the sheaf of the first fruits of your harvest unto the priest; and he shall uplift the sheaf before the Lord to be accepted for you. After the first festal day of Pascha (or, the day after the feast‑day of Pascha) on the day on which you elevate the sheaf, you shall make (the sacrifice of a lamb of the year, unblemished a burnt offering unto the Name of the Lord: and its mincha, two tenths of flour, mingled with olive oil, for an oblation to the Name of the Lord, to be received with acceptance; and its libation, wine of grapes, the fourth of a hin. But neither bread nor parched corn (of the ripe harvest) nor new ears may you eat until this day, until the time of your bringing the oblation of your God: an everlasting statute unto your generations in all your dwellings.

That is, Pentecost is inherently linked to Pascha (Passover); the day after the first festal day of Pascha; and has nothing to do with any day of the week! Least of all on a Sunday or Whitsunday; on account of jealousy introduced and stirred up by the Samaritans to confused the Israelites!

“The first festal day of Pascha” is the night of the fifteenth; it is the time when the the children of Israel celebrate the eating of the Passover, not when the lamb was killed, which is on the fourteenth. How plain is this! Yet the Chruch is lukewarm, neither cold nor hot; blind, wretched and naked! And if not repented, will be spewed into the FIRE! (Revelation 3:16)

Weapon US gave Ukraine spotted in Mexico!

•June 3, 2023 • Leave a Comment

(I’m back! I was sick with inflammation of the lung spending time recovering in hospital for over three weeks! Time for humidity and detoxification. At least it is much better than Nebuchadnezzar who had lost his mind and spent the next seven years eating grass! Now I’m BACK!)

Weapon US gave Ukraine spotted in hands of Mexican cartel – media

RT World News • May 31, 2023

A militia member was filmed with what Milenio TV believes is a Javelin anti-tank missile

A militant wearing the insignia of Mexico’s notorious Gulf Cartel (Cartel Del Golfo, CDG) has been filmed in the state of Tamaulipas carrying a US-made anti-tank missile launcher. News channel Milenio TV identified the weapon as a Javelin, thousands of which were sent to Ukraine by the Pentagon over the last year.

Footage filmed in Matamoros on Monday and aired on Tuesday evening by the news channel showed a man with CDG patches armed with a Kalashnikov rifle and a missile they said was the Raytheon-made FGM-148.

Over 10,000 Javelins from Pentagon stockpiles have been sent to Ukraine since last February, to the point where the US military has begun to run out of the missiles itself.

Milenio presenter Azucena Uresti noted on Twitter that the estimated value of a Javelin launcher on the black market was anywhere from $20,000 to $60,000, while the average cost of a missile was about $30,000.

Keen-eyed military experts believe the weapon in the Milenio footage may actually be the AT-4, a Swedish-made disposable anti-tank launcher, which is also in use by the US military and likewise supplied to Ukraine by the thousands.

Russia has repeatedly warned the US and its allies not to “stuff” Ukraine with weapons and ammunition, both because this risked a direct confrontation and weapons ending up in the criminal underworld.

An RT investigation in July 2022 found a variety of Western-supplied weapons, including anti-tank rockets, for sale on the “dark web.” Several months later, Russian Foreign Ministry spokeswoman Maria Zakharova warned that $1 billion a month worth of Western weapons was ending up in the hands of “terrorists, extremists and criminal groups in the Middle East, Central Africa, and Southeast Asia.”

Kiev has denounced this as “propaganda” and insisted all shipments were accounted for.

The US outlet CBS censored a documentary on weapons supplies intended for Ukraine after the government in Kiev objected to its reporting. Last month, veteran investigative journalist Seymour Hersh said said the West was aware its weapons were ending up on the black market, but that most governments did not care because arming Ukraine mattered more to them.

The Gulf Cartel is based in the Mexican state of Tamaulipas, specifically in the border city of Matamoros, just across the Rio Grande from Brownsville, Texas. The militia dates back to the 1930s, but gained in notoriety in the late 1990s, when it spun off a notorious squad known as Los Zetas.

Pride before fall: President Biden is helped up after falling during the graduation ceremony at the United States Air Force Academy

The group has since broken off on its own. Though primarily known as a drug smuggling cartel, CDG has also been accused of racketeering, abductions, money laundering, and trafficking of people, sex slaves and weapons.

In March, the cartel apologized for one of its factions kidnapping four Americans and killing two of them, in what they said was a case of mistaken identity. Five members of that faction were handed over to the Mexican police.

“For the day of the Lord is near upon all the nations. As you have done, it shall be done to you; your dealings will return upon your own head” Obadiah 1:15

“Behold, therefore I will gather all thy lovers with whom thou hast taken pleasure, and all them that thou hast loved, with all them that thou hast hated. I will even gather them round about against thee and will uncover thy nakedness unto them, that they may see all thy nakedness” Ezekiel 16:37

A Study Index of Zechariah

•May 10, 2023 • Leave a Comment

Among the last of the Prophets, Zechariah’s writing is a prophecy of the coming Messiah, yet Jews pray everyday at the Wailing Wall for the coming of the Messiah. “Oh blind Guides!” Would God have any obligation to hear such prayers? Or, would he prefer to kindle a fire in the midst of them?

Chapter 1

— Thus saith the Lord of hosts: ‘Turn ye unto Me,
—‘and I will turn unto you,’ saith the Lord of hosts
— ‘Turn ye now from your evil ways and from your evil doings’
— but they did not hear, nor hearken unto Me, saith the Lord
— I saw by night, and behold, a man riding upon a red horse
— and behind him were there red horses, speckled, and white
— Then I lifted up mine eyes and saw, and behold, four horns
— “These are the horns which have scattered Judah, Israel and Jerusalem”

~ Chapter 2

— And he said unto me, “To measure Jerusalem to see what is the breadth thereof
— and what is the length thereof”
— “Run, speak to this young man, saying,
— ‘Jerusalem shall be inhabited as towns without walls’
— Come forth, and flee from the land of the north,” saith the Lord
— for he that toucheth you toucheth the apple of His eye
— “Sing and rejoice, O daughter of Zion; for lo, I come
— and I will dwell in the midst of thee,” saith the Lord

A Study of Chapters 1 and 2 HERE ~ —— ~

Chapter 3

— Joshua was clothed with filthy garments
— “Take away the filthy garments from him”
— “Behold, I have caused thine iniquity to pass from thee”
— For behold the stone that I have laid before Joshua
— upon one stone shall be seven eyes

~ Chapter 4

— “What seest thou?” And I said, “I have looked and behold, a candlestick
— all of gold with a bowl upon the top of it, and his seven lamps thereon
— and seven pipes to the seven lamps which are upon the top thereof
— and two olive trees, one the right side of the bowl, the other upon the left
— “This is the word of the Lord unto Zerubbabel
— saying, ‘Not by might nor by power, but by My Spirit,’ saith the Lord of hosts
— Who art thou, O great mountain? Before Zerubbabel thou shalt become a plain
— “The hands of Zerubbabel have laid the foundation of this house;
— his hands shall also finish it
— the Targum testifies that Zerubbabel is one sent the Father
— testifies that Zerubbabel is the Son of God, the Messiah

A Study of Chapters 3 and 4 HERE ~ —— ~

Chapter 5

— a flying roll, the curse that goeth forth over the face of the earth
— one side for one who steals, the other side for one who swears
— two categories of curses
— similar to what Ezekiel saw: of lamentations, mourning and woe
— the ephah was the measure of unrighteousness and of deceits
— a woman who sitteth in the midst of the ephah
— and behold, there came out two women
— to build it a house in the land of Shinar

~ Chapter 6

— there came four chariots out from between two mountains
— in the first chariot were red horses; of wars and bloodshed
— and in the second chariot black horses; north; of mourning and death
— and in the third chariot white horses; north; implying joy and victory
— and in the fourth chariot grizzled and bay horses; south
— these are the four spirits of the heavens

A Study of Chapters 5 and 6 HERE ~ —— ~

Chapter 7

— ‘the Unspoken Will of God
— When ye fasted and mourned in the fifth and seventh month
— even those seventy years, did ye fast at all unto Me, even to Me?
— execute true judgement, and show mercy and compassions
— and oppress not the widow nor the fatherless, the stranger, nor the poor
— and let none of you imagine evil against his brother in your heart
— “Therefore it has come to pass that as He cried and they would not hear,
— so they cried and I would not hear,” saith the Lord of hosts

~ Chapter 8

— “Thus saith the Lord of hosts: ‘I was jealous for Zion with great jealousy
— and I was jealous for her with great fury’
— “Thus saith the Lord: ‘I am returned unto Zion
— that the foundation of the house of the Lord of hosts was laid
— that the [Ezekiel] Temple might be built
— “Thus saith the Lord of hosts: ‘The fast of the fourth month, the fast of the fifth
— the fast of the seventh, and the fast of the tenth
— shall be to the house of Judah joy and gladness and cheerful feasts

A Study of Chapters 7 and 8 HERE ~ —— ~

Chapter 9

— the burden of the word of the Lord in the land of Syria and Damascus
— together with Damascus, Tyre and Sidon; cities of Phenicia
— Ashkelon and Gaza shall see Tyre’s destruction and fear; and be very sorrowful
— and the Lord will encamp about His house, His Temple
— and I will cause My glorious Shekinah to dwell in My Sanctuary
— O daughter of Jerusalem! Behold, thy King cometh unto thee!
— He is just and lowly, and riding upon an ass and upon a colt, the foal of an ass
— O Zion, against thy sons, O Greece; and shall go with whirlwinds of the South

~ Chapter 10

— there would be early spring and the latter autumn rain
— for the idol shepherd have spoken vanity, lies and false dreams
— the Targum says about His people, “they are scattered as sheep are scattered”
— “And I will strengthen the house of Judah and the house of Joseph”
— “And I will strengthen them in the Lord
— and they shall walk up and down in His name,” saith the Lord

A Study of Chapters 9 and 10 HERE ~ —— ~

Chapter 11

— Open thy doors, O Lebanon, that the fire may devour thy cedars
— saith the Lord my God: “Feed the flock for the slaughter
— give the flock the reasons why they would soon be suffering with captivity
— a shepherd with two staves (a) Pleasantness, like “Josiah, the anointed”
— and (b) Destroyers, like “Nebuchadnezzar, my servant” both are the Lord’s staves
— Three shepherds also I cut off in one month
— and my soul loathed them and their soul also abhorred me
— Could these three be Fred Coulter, Frank Nelte and John Ritenbaugh?

~ Chapter 12

— The burden of the word of the Lord for Israel
— I will make Jerusalem a cup of trembling unto all the people round about
— when they shall be in the siege both against Judah and against Jerusalem.
— And I will seek to destroy all the nations that come against Jerusalem
— And I will pour upon the inhabitants of Jerusalem the spirit of grace and of supplication
— and they shall look upon Me whom they have pierced
— and they shall mourn for Him as one mourneth for his only son
— and shall be in bitterness for Him as one who is in bitterness for his firstborn

A Study of Chapters 11 and 12 HERE ~ —— ~

Chapter 13

— “In that day there shall be a fountain opened
— to the house of David and to the inhabitants of Jerusalem
— and God will cause the prophets and the unclean spirit
— who speaks through the false prophets to pass out of the land
— “Awake, O sword, Smite the Shepherd
— and the sheep shall be scattered
— and I will turn Mine hand upon the little ones.
— “two parts therein shall be cut off and die
— And I will bring the third part through the fire
— and will refine them as silver is refined

~ Chapter 14

— Behold, the day of the Lord cometh
— For I will gather all nations against Jerusalem to battle
— Then shall the Lord go forth and fight against those nations
— And His feet shall stand in that day upon the Mount of Olives
— every one who is left of all the nations which came against Jerusalem
— shall even go up from year to year to worship the King, the Lord of hosts
— and to keep the Feast of Tabernacles

A Study of Chapters 13 and 14 HERE ~ —— ~

The America’s Empire is Bankrupt

•May 5, 2023 • Leave a Comment

The dollar is finally being dethroned

UnHerd by John Michael Greer • April 22, 2023

Let’s start with the basics. Roughly 5% of the human race currently live in the United States of America. That very small fraction of humanity, until quite recently, enjoyed about a third of the world’s energy resources and manufactured products and about a quarter of its raw materials.

This didn’t happen because nobody else wanted these things, or because the US manufactured and sold something so enticing that the rest of the world eagerly handed over its wealth in exchange. It happened because, as the dominant nation, the US imposed unbalanced patterns of exchange on the rest of the world, and these funnelled a disproportionate share of the planet’s wealth to itself.

There’s nothing new about this sort of arrangement. In its day, the British Empire controlled an even larger share of the planet’s wealth, and the Spanish Empire played a comparable role further back. Before then, there were other empires, though limits to transport technologies meant that their reach wasn’t as large.

Nor, by the way, was any of this an invention of people with light-coloured skin. Mighty empires flourished in Asia and Africa when the peoples of Europe lived in thatched-roofed mud huts. Empires rise whenever a nation becomes powerful enough to dominate other nations and drain them of wealth. They’ve thrived as far back as records go and they’ll doubtless thrive for as long as human civilisations exist.

America’s empire came into being in the wake of the collapse of the British Empire, during the fratricidal European wars of the early 20th century. Throughout those bitter years, the role of global hegemon was up for grabs, and by 1930 or so it was pretty clear that Germany, the Soviet Union or the US would end up taking the prize.

In the usual way, two contenders joined forces to squeeze out the third, and then the victors went at each other, carving out competing spheres of influence until one collapsed. When the Soviet Union imploded in 1991, the US emerged as the last empire standing.

Francis Fukuyama insisted in a 1989 essay that having won the top slot, the US was destined to stay there forever. He was, of course, wrong, but then he was a Hegelian and couldn’t help it. (If a follower of Hegel tells you the sky is blue, go look.)

The ascendancy of one empire guarantees that other aspirants for the same status will begin sharpening their knives. They’ll get to use them, too, because empires invariably wreck themselves: over time, the economic and social consequences of empire destroy the conditions that make empire possible. That can happen quickly or slowly, depending on the mechanism that each empire uses to extract wealth from its subject nations.

The mechanism the US used for this latter purpose was ingenious but even more short-term than most.

In simple terms, the US imposed a series of arrangements on most other nations that guaranteed the lion’s share of international trade would use US dollars as the medium of exchange, and saw to it that an ever-expanding share of world economic activity required international trade. (That’s what all that gabble about “globalisation” meant in practice.)

This allowed the US government to manufacture dollars out of thin air by way of gargantuan budget deficits, so that US interests could use those dollars to buy up vast amounts of the world’s wealth. Since the excess dollars got scooped up by overseas central banks and business firms, which needed them for their own foreign trade, inflation stayed under control while the wealthy classes in the US profited mightily.

Why did the Spanish Empire collapse?

The problem with this scheme is the same difficulty faced by all Ponzi schemes, which is that, sooner or later, you run out of suckers to draw in. This happened not long after the turn of the millennium, and along with other factors — notably the peaking of global conventional petroleum production — it led to the financial crisis of 2008-2010.

Since 2010 the US has been lurching from one crisis to another. This is not accidental. The wealth pump that kept the US at the top of the global pyramid has been sputtering as a growing number of nations have found ways to keep a larger share of their own wealth by expanding their domestic markets and raising the kind of trade barriers the US used before 1945 to build its own economy. The one question left is how soon the pump will start to fail altogether.

When Russia launched its invasion of Ukraine in February 2022, the US and its allies responded not with military force but with punitive economic sanctions, which were expected to cripple the Russian economy and force Russia to its knees.

Apparently, nobody in Washington considered the possibility that other nations with an interest in undercutting the US empire might have something to say about that. Of course, that’s what happened. China, which has the largest economy on Earth in purchasing-power terms, extended a middle finger in the direction of Washington and upped its imports of Russian oil, gas, grain and other products. So did India, currently the third-largest economy on Earth in the same terms; as did more than 100 other countries.

Then there’s Iran, which most Americans are impressively stupid about. Iran is the 17th largest nation in the world, more than twice the size of Texas and even more richly stocked with oil and natural gas. It’s also a booming industrial power. It has a thriving automobile industry, for example, and builds and launches its own orbital satellites. It’s been dealing with severe US sanctions since not long after the Shah fell in 1978, so it’s a safe bet that the Iranian government and industrial sector know every imaginable trick for getting around those sanctions.

Right after the start of the Ukraine war, Russia and Iran suddenly started inking trade deals to Iran’s great benefit. Clearly, one part of the quid pro quo was that the Iranians passed on their hard-earned knowledge about how to dodge sanctions to an attentive audience of Russian officials.

With a little help from China, India and most of the rest of humanity, the total failure of the sanctions followed in short order. Today, the sanctions are hurting the US and Europe, not Russia, but the US leadership has wedged itself into a position from which it can’t back down. This may go a long way towards explaining why the Russian campaign in Ukraine has been so leisurely. The Russians have no reason to hurry. They know that time is not on the side of the US.

For many decades now, the threat of being cut out of international trade by US sanctions was the big stick Washington used to threaten unruly nations that weren’t small enough for a US invasion or fragile enough for a CIA-backed regime-change operation.

Over the last year, that big stick turned out to be made of balsa wood and snapped off in Joe Biden’s hand. As a result, all over the world, nations that thought they had no choice but to use dollars in their foreign trade are switching over to their own currencies, or to the currencies of rising powers. The US dollar’s day as the global medium of exchange is thus ending.

It’s been interesting to watch economic pundits reacting to this. As you might expect, quite a few of them simply deny that it’s happening — after all, economic statistics from previous years don’t show it yet, Some others have pointed out that no other currency is ready to take on the dollar’s role; this is true, but irrelevant.

When the British pound lost a similar role in the early years of the Great Depression, no other currency was ready to take on its role either. It wasn’t until 1970 or so that the US dollar finished settling into place as the currency of global trade. In the interval, international trade lurched along awkwardly using whatever currencies or commodity swaps the trading partners could settle on: that is to say, the same situation that’s taking shape around us in the free-for-all of global trade that will define the post-dollar era.

One of the interesting consequences of the shift now under way is a reversion to the mean of global wealth distribution. Until the era of European global empire, the economic heart of the world was in east and south Asia. India and China were the richest countries on the planet, and a glittering necklace of other wealthy states from Iran to Japan filled in the picture.

To this day, most of the human population is found in the same part of the world. The great age of European conquest temporarily diverted much of that wealth to Europe, impoverishing Asia in the process. That condition began to break down with the collapse of European colonial empires in the decade following the Second World War, but some of the same arrangements were propped up by the US thereafter.

Now those are coming apart, and Asia is rising. By next year, four of the five largest economies on the planet in terms of purchasing power parity will be Asian. The fifth is the US, and it may not be in that list for much longer.

In short, America is bankrupt. Our governments from the federal level down, our big corporations and a very large number of our well-off citizens have run up gargantuan debts, which can only be serviced given direct or indirect access to the flows of unearned wealth the US extracted from the rest of the planet. Those debts cannot be paid off, and many of them can’t even be serviced for much longer.

The only options are defaulting on them or inflating them out of existence, and in either case, arrangements based on familiar levels of expenditure will no longer be possible. Since the arrangements in question include most of what counts as an ordinary lifestyle in today’s US, the impact of their dissolution will be severe.

In effect, the 5% of us in this country are going to have to go back to living the way we did before 1945. If we still had the factories, the trained workforce, the abundant natural resources and the thrifty habits we had back then, that would have been a wrenching transition but not a debacle.

The difficulty, of course, is that we don’t have those things anymore. The factories were shut down in the offshoring craze of the Seventies and Eighties, when the imperial economy slammed into overdrive, and the trained workforce was handed over to malign neglect.

We’ve still got some of the natural resources, but nothing like what we once had. The thrifty habits? Those went whistling down the wind a long time ago. In the late stages of an empire, exploiting flows of unearned wealth from abroad is far more profitable than trying to produce wealth at home, and most people direct their efforts accordingly.

That’s how you end up with the typical late-imperial economy, with a governing class that flaunts fantastic levels of paper wealth, a parasite class of hangers-on that thrive by catering to the very rich or staffing the baroque bureaucratic systems that permeate public and private life, and the vast majority of the population impoverished, sullen, and unwilling to lift a finger to save their soi-disant betters from the consequences of their own actions.

The good news is that there’s a solution to all this. The bad news is that it’s going to take a couple of decades of serious turmoil to get there. The solution is that the US economy will retool itself to produce earned wealth in the form of real goods and non-financial services.

That’ll happen inevitably as the flows of unearned wealth falter, foreign goods become unaffordable to most Americans, and it becomes profitable to produce things here in the US again. The difficulty, of course, is that most of a century of economic and political choices meant to support our former imperial project are going to have to be undone.

The most obvious example? The metastatic bloat of government, corporate and non-profit managerial jobs in American life. That’s a sensible move in an age of empire, as it funnels money into the consumer economy, which provides what jobs exist for the impoverished classes.

Public and private offices alike teem with legions of office workers whose labour contributes nothing to national prosperity but whose pay cheques prop up the consumer sector. That bubble is already losing air. It’s indicative that Elon Musk, after his takeover of Twitter, fired some 80% of that company’s staff; other huge internet combines are pruning their workforce in the same way, though not yet to the same degree.

The recent hullaballoo about artificial intelligence is helping to amplify the same trend. Behind the chatbots are programs called large language models (LLMs), which are very good at imitating the more predictable uses of human language. A very large number of office jobs these days spend most of their time producing texts that fall into that category: contracts, legal briefs, press releases, media stories and so on.

Those jobs are going away. Computer coding is even more amenable to LLM production, so you can kiss a great many software jobs goodbye as well. Any other form of economic activity that involves assembling predictable sequences of symbols is facing the same crunch. A recent paper by Goldman Sachs estimates that something like 300 million jobs across the industrial world will be wholly or partly replaced by LLMs in the years immediately ahead.

Another technology with similar results is CGI image creation. Levi’s announced not long ago that all its future catalogues and advertising will use CGI images instead of highly-paid models and photographers. Expect the same thing to spread generally. Oh, and Hollywood’s next.

We’re not too far from the point at which a program can harvest all the footage of Marilyn Monroe from her films, and use that to generate new Marilyn Monroe movies for a tiny fraction of what it costs to hire living actors, camera crews and the rest. The result will be a drastic decrease in high-paying jobs across a broad swathe of the economy.

The outcome of all this? Well, one lot of pundits will insist at the top of their lungs that nothing will change in any way that matters, and another lot will start shrieking that the apocalypse is upon us. Those are the only two options our collective imagination can process these days. Of course, neither of those things will actually happen.

What will happen instead is that the middle and upper-middle classes in the US, and in many other countries, will face the same kind of slow demolition that swept over the working classes of those same countries in the late 20th century. Layoffs, corporate bankruptcies, declining salaries and benefits, and the latest high-tech version of NO HELP WANTED signs will follow one another at irregular intervals.

All the businesses that make money catering to these same classes will lose their incomes as well, a piece at a time. Communities will hollow out the way the factory towns of America’s Rust Belt and the English Midlands did half a century ago, but this time it will be the turn of upscale suburbs and fashionable urban neighbourhoods to collapse as the income streams that supported them disappear.

This is not going to be a fast process. The US dollar is losing its place as the universal medium of foreign trade, but it will still be used by some countries for years to come. The unravelling of the arrangements that direct unearned wealth to the US will go a little faster, but that will still take time. The collapse of the cubicle class and the gutting of the suburbs will unfold over decades. That’s the way changes of this kind play out.

As for what people can do in response this late in the game, I refer to a post I made on The Archdruid Report in 2012 titled “Collapse Now and Avoid the Rush.”

In that post I pointed out that the unravelling of the American economy, and the broader project of industrial civilisation, was picking up speed around us, and those who wanted to get ready for it needed to start preparing soon by cutting their expenses, getting out of debt, and picking up the skills needed to produce goods and services for people rather than the corporate machine.

I’m glad to say that some people did these things, but a great many others rolled their eyes, or made earnest resolutions to do something as soon as things were more convenient, which they never were.

Over the years that followed I repeated that warning and then moved on to other themes, since there really wasn’t much point to harping on about the approaching mess when the time to act had slipped away.

Those who made preparations in time will weather the approaching mess as well as anyone can. Those who didn’t? The rush is here. I’m sorry to say that whatever you try, it’s likely that there’ll be plenty of other frantic people trying to do the same thing. You might still get lucky, but it’s going to be a hard row to hoe.

Mind you, I expect some people to take a different tack. In the months before a prediction of mine comes true, I reliably field a flurry of comments insisting that I’m too rigid and dogmatic in my views about the future, that I need to be more open-minded about alternative possibilities, that wonderful futures are still in reach, and so on.

I got that in 2008 just before the real estate bubble started to go bust, as I’d predicted, and I also got it in 2010 just before the price of oil peaked and started to slide, as I’d also predicted, taking the peak oil movement with it. I’ve started to field the same sort of criticism once again.

We are dancing on the brink of a long slippery slope into an unwelcome new reality. I’d encourage readers in America and its close allies to brace themselves for a couple of decades of wrenching economic, social, and political turmoil. Those elsewhere will have an easier time of it, but it’s still going to be a wild ride before the rubble stops bouncing, and new social, economic, and political arrangements get patched together out of the wreckage.

“And they shall come against thee with chariots, wagons, and wheels, and with an assembly of people, who shall set against thee buckler and shield and helmet roundabout; and I will set judgement before them, and they shall judge thee according to their judgements.

“And I will set My jealousy against thee, and they shall deal furiously with thee. They shall take away thy nose and thine ears, and thy remnant shall fall by the sword. They shall take thy sons and thy daughters, and thy residue shall be devoured by the fire” Ezekiel 23:24-25

Zechariah (Ch 13-14)

•May 4, 2023 • Leave a Comment

During the Millennium the Feast of Tabernacle is prophesied to be reinstated, but sacrifices, the foremost of which is the Passover, is also hinted at. The differentiations of nationalities are reduced in importance and so are the sexes—there wouldn’t be Gentiles nor Jews; or a Court for the Women and another for the Gentiles in the Ezekiel Temple in Jerusalem, but only designated as Inner Court or Outer Court.

Zechariah 13

1 “In that day there shall be a fountain opened to the house of David and to the inhabitants of Jerusalem, for sin and for uncleanness.

— the Lord declares, “On that day a fountain will be opened for David’s family and for those who live in Jerusalem to wash away their sin and stain.

2 And it shall come to pass in that day,” saith the Lord of hosts, “that I will cut off the names of the idols out of the land, and they shall no more be remembered; and also I will cause the prophets and the unclean spirit to pass out of the land.

— and it shall come to pass that God will cut off the names of the idols out of the land, so that the very names which had formerly been in the mouths of men everywhere were no longer mentioned, and they shall no more be remembered;

— and God will cause the prophets and the unclean spirit who speaks through the false prophets, to pass out of the land. This is one of the results of the preaching of the Truth, as we see also in the case of the people of Ephesus when Paul proclaimed the true God to them. Cf Acts 19:19.

3 And it shall come to pass that when any shall yet prophesy, then his father and his mother who begot him shall say unto him, ‘Thou shalt not live, for thou speakest lies in the name of the Lord’; and his father and his mother who begot him shall thrust him through when he prophesieth.

— if a man still prophesies presumptuously, his father and his mother, who gave birth to him, will say, ‘You don’t deserve to live because you speak lies in the name of the Lord.’ Then his father and his mother, who gave birth to him, will stab him when he still prophesies; this is in line with the command of the Lord in the Old Testament. Cf Deuteronomy 18:20.

4 And it shall come to pass in that day, that the prophets shall be ashamed every one of his vision when he hath prophesied; neither shall they wear a garment of hair to deceive.

— and if those prophets still assert presumptuously that they possess the power to prophesy, they shall be ashamed every one of his vision when he hath prophesied; neither shall they wear a rough garment, after the manner of Elijah to deceive, to impress men with their status as prophets, just as men nowadays affect the dress, speech and manners of certain professions in order to make an impression;

5 But he shall say, ‘I am no prophet; I am a husbandman, for man taught me to keep cattle from my youth.’ — but he shall say, ‘I am no prophet, I am an husbandman,’ vehemently disclaiming any connection with the prophetic profession; for man taught me to keep cattle from my youth, rather, “a man has purchased me from my youth.”

6 And one shall say unto him, ‘What are these wounds in thine hands?’ Then he shall answer, ‘Those with which I was wounded in the house of my friends.’

— and one shall say unto him, What are these wounds in thine hands? the scars which he bore as a result of his wounding himself in the service of idols, 1 Kings 18:28. Then he shall answer, in trying to evade the issue and to place the blame elsewhere;

— those with which he was wounded in the house of his friends, possibly when lie was chastised in his capacity as slaves; and may be taken as a warning in our days when men are turning to deceivers for counsel and guidance.

7 “Awake, O sword, against My Shepherd, and against the Man that is My fellow,” saith the Lord of hosts. “Smite the Shepherd, and the sheep shall be scattered; and I will turn Mine hand upon the little ones.

— awake, O Sword, against my Shepherd, concerning his Son, whom he calls “my Shepherd” the same one who addressed the people in Zechariah 11:12 (thirty pieces of silver),;

— and against the Man that is My Fellow, him who is also God, together with the Father, for the Messiah is the Son of God, who was in the bosom of the Father and by him begotten in the great scheme of things, who here summons the Sword for the Messiah’s Sacrifice, to carry out the infliction of suffering by which the redemption of mankind is to be carried out;

— smite the Shepherd and the sheep shall be scattered, to smite the Messiah even unto death; a word which Jesus applied to himself on the evening before his death, Matthew 26:31; and I will turn mine hand upon the little ones, literally, “I will bring back my hand upon the little ones” for he intended to redeem the wretched, the poor and lowly, for of these were to make up his Elect.

8 And it shall come to pass that in all the land,” saith the Lord, “two parts therein shall be cut off and die, but the third shall be left therein.

— and it shall come to pass that in all the land, saith the Lord, two thirds therein, the great majority of the people, shall be cut off and die, being offended in him and therefore rejected from his herd; but the third, only a small part, shall be left therein;

— “in all the land” Q, is this all Israel or all the earth? the context seems to indicate the later as this chapter and the next is concerning God dealing with all the nations. Just a thought, this would be something like 4 to 5 billion people dead! Could a soon new and vibrant Covid-2X (or a hybrid variant) do this job of killing thousands falling by the wayside? — as in Psalms 91 which prophesied what a Godsend pandemic could do

Nor of the pestilence that walk in darkness, nor of the destruction that lay waste at noonday. A thousand shall fall at thy side, and ten thousand at thy right hand, but it shall not come nigh thee. Psalms 91:6-7

9 And I will bring the third part through the fire, and will refine them as silver is refined, and will try them as gold is tried. They shall call on My name, and I will hear them. I will say, ‘It is My people’; and they shall say, ‘The Lord is my God.’”

— and God will bring the third part through the fire, the test of affliction and persecution as it soon came to the first congregation, and will refine them as silver is refined and will try them as gold is tried, Cf 1 Peter 1:6-7;

— they shall call on my name, and I will hear them, graciously giving them the attention which assured them of his certain assistance; God will say, ‘It is my people, and they shall say, Yehovah is my God.’ This has ever been the relationship obtaining between the God of the covenant and His Elect on earth, and this intimate communion is one of the miracles of the Chosen till the end of time. Cf John 14:23;

— they shall call on my name; my name is Yehovah (YHVH); God’s name is the four-letter Hebrew word יהוה‎ YHVH Yehovah (not Jehovah since the letter J wasn’t around but only after the sixteenth century; (more on this at the end)

“The Lord’s Day” is actually “the Day of Judgement” (Encyclopedia Biblica, “Lord’s Day”)

Zechariah 14

1 Behold, the day of the Lord cometh, and thy spoil shall be divided in the midst of thee. — behold, the day of the Lord cometh, the Day of Judgement or the Lord’s Day; there is a parallel in Revelation “the Lord’s Day” of Revelation 1:10;

— and thy spoil that gained by the enemies in overcoming Jerusalem, that shall be divided in the midst of thee, the enemies then being at leisure and secure in the conquered city;

— further on “the Lord’s Day” is actually “the day of Judgement” (Encyclopedia Biblica, article “Lord’s Day”); in later years, when the Roman Catholic Church were getting so powerful this was reinterpreted to mean the day of Christ’s resurrection, Sunday; hence today, “the Lord’s Day” has presumptuously being transformed into a day of worship on Sundays.

2 For I will gather all nations against Jerusalem to battle; and the city shall be taken, and the houses rifled, and the women ravished. And half of the city shall go forth into captivity, and the residue of the people shall not be cut off from the city.

— on the Day of Judgement, God will gather all nations against Jerusalem to battle, the enemies being recruited from all countries of the world; and the city shall be taken and the houses rifled and the women ravished, a picture of an apparent complete overthrow of the Judah such as she experienced before the Chaldean captivity;

— and half of the city shall go forth into captivity, yielding to the power inspired by a Destroyer, and the residue of the people shall not be cut off from the city, some at least would remain faithful to the true God despite the ravaging of the enemies.

3 Then shall the Lord go forth and fight against those nations, as when He fought in the day of battle. — then the Lord shall go forth and battle against those nations as he fought like “at the Red Sea” which the Targum adds and on the many occasions when he went forth to fight with them and for them as King David and many others did.

4 And His feet shall stand in that day upon the Mount of Olives, which is before Jerusalem on the east; and the Mount of Olives shall cleave in the midst thereof toward the east and toward the west, and there shall be a very great valley, and half of the mountain shall remove toward the north and half of it toward the south.

— and on that day, God’s feet shall stand upon the Mount of Olives, this location being considered the center of the earth and the throne of the Lord as he makes ready for judgement, which is before Jerusalem on the east;

— and the Mount of Olives shall cleave in the midst thereof toward the east and toward the west, an earthquake having this effect as the earth trembled under the footsteps of the Almighty;

— and there shall be a very great valley; and half of the mountain shall remove toward the north and half of it toward the south, thus opening a road from Jerusalem straight toward the east.

5 And ye shall flee to the valley of the mountains, for the valley of the mountains shall reach unto Azal. Yea, ye shall flee as ye fled from before the earthquake in the days of Uzziah king of Judah; and the Lord my God shall come, and all the saints with Thee.

— and ye shall flee to the valley of the mountains for safe hiding-places; see, Isaiah 2:19; for the valley of the mountains shall reach unto Azal, a small town east of Mount Olivet;

— yea, ye ‘shall flee, like as ye fled from before the earthquake in the days of Uzziah, king of Judah; and the Lord, my God, shall come; his advent being looked for by his elect ‘with joyful expectation, and all the saints, the holy angels, with thee.

6 And it shall come to pass in that day that the light shall not be clear nor dark. — on that day there shall be no light nor dark, cold nor frost, literally, “the glorious things will withdraw themselves,” evidently said of the lights of heaven, the sun, moon and stars;

7 But it shall be one day which shall be known to the Lord — neither day nor night; but it shall come to pass that at evening (‘e·reḇ) time it shall be light.

— and it will be a day unlike any other, for it will be one continuous day, known only to the Lord, and there will be no more day nor night for there will be light even during the evening; that is, from 6 pm to midnight.

8 And it shall be in that day, that living waters shall go out from Jerusalem, half of them toward the eastern sea and half of them toward the hinder sea; in summer and in winter shall it be.

— in both summer and winter, life-giving streams will flow from Jerusalem, half of them to the Dead Sea (but the Targum differs, saying it is the Persian Sea) in the east and half to the Mediterranean Sea in the west.

9 And the Lord shall be king over all the earth; in that day shall there be one Lord, and His name one.

— and the Lord will be the King of kings over all the earth. On that day there will be one Lord—his name alone will be worshiped; the Lord to be glorified wherever his Word is proclaimed.

10 All the land shall be turned as a plain from Geba to Rimmon south of Jerusalem; and it shall be lifted up and inhabited in her place, from Benjamin’s Gate unto the place of the First Gate unto the Corner Gate, and from the Tower of Hananeel unto the king’s wine presses.

— the land will stretch out spaciously around Jerusalem—from Geba in the north to Rimmon in the south, with Jerusalem towering at the center and the commanding city gates—Gate of Benjamin to First Gate to Corner Gate to Hananel Tower to the Royal Winery—ringing the city full of people;

11 And men shall dwell in it, and there shall be no more utter destruction; but Jerusalem shall be safely inhabited.

— and men shall dwell in Jerusalem and there shall be no more danger nor any destruction, but Jerusalem shall be safely inhabited; never again will Jerusalem be destroyed; but will be a safe city.

12 And this shall be the plague wherewith the Lord will smite all the people who have fought against Jerusalem: their flesh shall consume away while they stand upon their feet, and their eyes shall consume away in their holes, and their tongue shall consume away in their mouth.

— and when the vials are poured out there shall be more plagues, whereby the Lord will smite all the people that have fought against Jerusalem, those who oppose the Kingdom and its work;

— their flesh shall rot away while they stand upon their feet, so that they would rot away in a living death, and their eyes shall consume away in their holes, and their tongue shall consume away in their mouth, all these punishments making them unfit for further attacks upon the city of God.

13 And it shall come to pass in that day that a great tumult from the Lord shall be among them; and they shall lay hold every one on the hand of his neighbor, and his hand shall rise up against the hand of his neighbor.

— and on that day there will be a great tumult, a confusion and panic; there will be a revolution from the Lord; and everyone shall lay hold of his neighbor, and every hand fighting against another. Mass hysteria when that happens. Panic! fellow citizens became soldiers fighting and killing each other—total terror!

14 And Judah also shall fight at Jerusalem, and the wealth of all the heathen round about shall be gathered together: gold and silver and apparel in great abundance.

— and Judah also shall fight at Jerusalem, its citizens taking part in the warfare against the enemies threatening their lives; and the wealth of all the nations round about shall be gathered together, the treasures of the enemy, their most precious possessions, gold and silver and apparel, in great abundance.

— other translations say, even Judah shall fight against Jerusalem; this could only be possible if (a) there is a civil war; or (b) Jerusalem is composed of descending heavenly saints, of whom the Jews of Judea couldn’t even recognize the returning Messiah with his multitudes of Revelation 19; so they fight each other.

15 And so shall be the plague on the horse, on the mule, on the camel and on the ass, and on all the beasts that shall be in these tents, as this plague.

— and so shall be the plagues of the horse, of the mule, of the camel, and of the ass and all the livestock and beasts that shall be in their camps, as this plague so that the defeat of the enemy would be complete in every way; that is, all the enemies of the Kingdom of God who persist in their enmity will inevitably be destroyed.

16 And it shall come to pass that every one who is left of all the nations which came against Jerusalem, shall even go up from year to year to worship the King, the Lord of hosts, and to keep the Feast of Tabernacles.

— and everyone that survives of all the nations which came against Jerusalem, shall even go up from year to year to worship the King of kings, the Lord of hosts, and to keep the Feast of Tabernacles, to join with the Kingdom in its worship of the one true God.

17 And it shall be, that whoso will not come up of all the families of the earth unto Jerusalem to worship the King, the Lord of hosts, even upon them shall be no rain.

— and it shall be that whoever refuses to go up to Jerusalem to worship the King, the Lord of hosts, even upon them shall be no rain and all the other physical and spiritual blessings of the Lord being withheld from them.

18 And if the family of Egypt go not up and come not, upon whom there is no rain, there shall be the plague wherewith the Lord will smite the heathen who come not up to keep the Feast of Tabernacles.

— and if the family of Egypt, representative of anyone who still refuses to go up to Jerusalem to keep the Feast of Tabernacles, there should have no rain, or the lack of rain would be its plague or infliction; there shall be the plague whereby the Lord will smite the nations that refuse to be received into the Kingdom and take part in its worship.

19 This shall be the punishment of Egypt and the punishment of all nations that come not up to keep the Feast of Tabernacles.

— this shall be the punishment of Egypt all nations that refuse to come and keep the Feast of Tabernacles; in opposing his Kingdom and refusing to accept his Word, entrench themselves behind a wall of their own foolishness and shut themselves out from the highest physical and spiritual blessings, but to keep the Feast of Tabernacles;

— and not Easter, which is a form of worshipping Astarte, one of the titles of the Chaldean goddess, the queen of heaven, the ancient Mesopotamian goddess of war, fertility and sex. She is featured in the Epic of Gilgamesh, and the “Ishtar Gate” was part of Nebuchadnezzar’s Babylon;

— nor Mithra or Mitra (the Sun-God whose birthday many drunks honor and celebrate on December 25th which they christianised as Christmas); Zeus and others; called “gods of the earth” in distinction from the God of heaven; and men shall worship these earthly gods, acknowledging their supremacy, everyone from his place today, Protestants or Catholics alike;

— those who rebel and continue to resist will be horsewhipped! Nar, those who resist would suffer judgement by the sword, by famine, by pestilence and spending years in captivity to repent there (for more see Ezekiel 4 – 390/40 Years and A Sword from the South!).

20 In that day shall there be upon the bells of the horses: “Holiness Unto The Lord.” And the pots in the Lord’S house shall be like the bowls before the altar;

— on that day shall there be upon the bells of the horses, or “upon the trappings of the horses” as the Targum renders it; and this intends either the horses slain in war, whose bells or trappings should be devoted and applied to holy uses; or the horses that carried the people up to Jerusalem to worship there, or horses in common;

— holiness unto the Lord; and the “pots” in which they cooked the sacrifices shall be like “the bowls before the altar” which held the blood of the sacrifices to be sprinkled at the altar; yea, all festivals in Leviticus 23 will be reinstated as prophesied in Ezekiel 46;

— every pot that were used to remove the ashes, they too will be like gold and of silver, like the sprinkling basins that are before the altar; either like them for number; they shall be many because of the numerous nations coming to offer sacrifices like the Jews did, like them as the Targum paraphrases it, shall be many;

— Rashi: there will be upon the bells of the horses: On the bells that are hung on the horse for beauty between its eyes (Pesachim 50a). Those, too, will be consecrated to make service vessels: sprinkling basins for the blood and pots to cook the flesh of the many sacrifices.

21 yea, every pot in Jerusalem and in Judah shall be holiness unto the Lord of hosts, and all those who sacrifice shall come and take of them and boil therein. And in that day there shall be no more the Canaanite in the house of the Lord of hosts.

— yea, every pot in Jerusalem and in Judah shall be holiness unto the Lord of hosts, all the ceremonies of the Law for which the foremost is the Passover, which would still be kept as a memorial, not just by Jews but by all nations;

— and all they that sacrifice shall come and participate in the Jerusalem Temple, preparing for the sacrificial feasts demands extra utensils, hence pots would be used as bowl to collect blood for the altar and both would be deemed holy;

— and on that day there shall be no more differentiation of being Canaanite nor Jews in the house of the Lord of hosts, no godless people being permitted as members of the Kingdom of God, but are all Godly;

— the nearer the Kingdom approaches its perfection, the clearer is shown there is no cleavage between those who are in truth the servants of the Lord and those not, because all will bear the name of his people after the day of redemption; and those who were against the Lord Almighty would have collapsed long before the Last Day but during the Day of Judgement. Selah!

~~~

More on God’s name, Yehovah.

God’s name is the four-letter Hebrew word יהוה‎ YHVH Yehovah, which are embedded in the Masoretic text over 6000 times, yet when translated into our English language most had been translated as Lord, or LORD, which are titles, but not his name. His name is יהוה‎ Yehovah, or YEHOVAH (but there are no capital letters in Hebrew).

It wasn’t until 1524 that Gian Giorgio Trissino, an Italian Renaissance grammarian, invented the letter J that this new letter started to take a hold in the writings of western Europe. Even in 1611 when the English Bible the King James has our subject of study by the prophet Jeremiah, he was known as Ieremiah. So Jehovah is a very late comer.

The following verses with the LORD erred in translation. His name Yehovah should be used:

I am the LORD; that is My name. And My glory will I not give to another, neither My praise to graven images. Isaiah 42:8

And it shall come to pass, that whosoever shall call on the name of the LORD shall be delivered; for in Mount Zion and in Jerusalem shall be deliverance, as the LORD hath said, and in the remnant whom the LORD shall call. Joel 2:32

“I am sought of them that asked not for Me; I am found of them that sought Me not. I said, ‘Behold Me, behold Me,’ unto a nation that was not called by My name. Isaiah 65:1

When we call our God, the LORD, we err, because his name is not the LORD, which is a title. His name is YEHOVAH! May We all ask for his forgiveness, and may Our merciful God forgive us all.

Merkel: Many Nations Not Interested in Ukraine Solution

•May 3, 2023 • Leave a Comment

Merkel Says Many Nations Were Not Interested in Diplomatic Solution of Ukraine Conflict

Sputnik International • May 1, 2023

BERLIN (Sputnik) – Before the conflict in Ukraine escalated in February 2022, many countries were not interested in the diplomatic solution of the crisis, while diplomacy is still a necessity, former German Chancellor Angela Merkel said.

I used everything at my disposal to prevent this situation. The fact that I couldn’t do it does not prove me wrong to try,” Merkel said in an interview with the German daily, published on Saturday.

Merkel, who left office in 2021, defended her attempts to settle the Ukrainian crisis with the Minsk agreements in 2014. Diplomacy is still a necessity, she stated.

To my great disappointment, there were quite a few [officials] who was not so interested in it,” the former chancellor said.

While she was a chancellor, only France and Germany stood for the Ukraine conflict’s settlement in the Council of the European Union, and Ukrainian President Volodymyr Zelensky told her that the Minsk agreements were unfeasible, Merkel added.

It was important to me – and I always tried to achieve this – that we did not limit our ideas too much,” she said.

For instance, if someone thinks that negotiations must be reopened sooner or later, they should not be silenced right away, Merkel added.

In February, Zelensky admitted that he told Merkel and French President Emmanuel Macron that the Minsk agreements were impractical and that he had no intention to implement them. Merkel said that the Minsk agreements were an attempt to give Ukraine time to gain strength ahead of a full-scale military confrontation with Russia.

“And they shall come against thee with chariots, wagons, and wheels, and with an assembly of people, who shall set against thee buckler and shield and helmet roundabout; and I will set judgement before them, and they shall judge thee according to their judgements.

“And I will set My jealousy against thee, and they shall deal furiously with thee. They shall take away thy nose and thine ears, and thy remnant shall fall by the sword. They shall take thy sons and thy daughters, and thy residue shall be devoured by the fire” Ezekiel 23:24-25

Zechariah (Ch 11-12)

•May 2, 2023 • Leave a Comment

Chapter 11 contains a prophecy of the siege and destruction of Jerusalem and which took place just before our Lord’s return to glory and its redemption.

Under the symbol a shepherd with two staves (a) Pleasantness, like “Josiah, the anointed” and (b) Destroyers, like “Nebuchadnezzar, my servant” both are the Lord’s staves to deal with his People.

Zechariah 11

1 Open thy doors, O Lebanon, that the fire may devour thy cedars. — Open thy doors, O Lebanon, the region on the northernmost border of the Holy Land that the fire may devour thy cedars;

— instead of describing the destruction of the land outright, the prophet calls upon Lebanon for judgement, its border to open its doors; its people are found wanting, for which is the consuming fire;

— Jonathan renders: O peoples, open your gates; the Targum paraphrases this judgement, “and the fire shall consume your fortresses.”

2 Howl, fir tree, for the cedar is fallen, because the mighty are despoiled; howl, O ye oaks of Bashan, for the forest of the vintage is come down.

— howl, fir-tree; the fir-tree seems to denote the lower people, the uninitiated; who are bid to howl because even their superiors, signified by the cedar, could not withstand the storm;

— for the cedar is fallen, because the mighty are spoiled; even the cedars (the highest in the state) are not spared, by which are designed the princes, nobles and magistrates of the land: so the Targum interprets them of kings and princes;

— howl, O ye oaks of Bashan; governors of provinces and men of power and authority, for the forest of the vintage is come down; or rather “the fortified forest” could also mean the city of Jerusalem which was a fortified place and like a forest full of trees but now cut down and destroyed;

— see a parallel Scripture in Isaiah 10:16, “Therefore shall the Lord, the Lord of hosts, send among His fat ones leanness; and under His glory He shall kindle a burning like the burning of a fire.”

3 There is a voice of the howling of the shepherds, for their glory is despoiled; a voice of the roaring of young lions, for the pride of Jordan is despoiled.

— there is a voice of the howling of the shepherds, their shepherds; their religious and civil rulers; shepherds are governors, magistrates, and civil officers, together with priests and prophets, who are over the people as shepherds over the flocks;

— their glory, the fine pasture on which they depended is spoiled; a voice of the roaring of young lions for the pride of Jordan, young lions; their princes, so described on account of their cruel rapacity; the thickets along the river which offered excellent opportunities for dens is spoiled;

— the description is short and bold but comprehensive enough to indicate that the Lord is speaking of another desolation of the Holy Land by which everything that was great and mighty in the country would be overthrown and the Holy Land once more become a wilderness.

4 Thus saith the Lord my God: “Feed the flock for the slaughter, — thus saith the Lord of Zechariah to their chief priests, princes, and rulers, with regard to the congregation of Israel, ‘Feed the flock for the slaughter,’

— that is, give the flock the reasons why they would soon be suffering with captivity, oppression or death at a latter time, so that mentally they are well prepared for a coming slaughter; why they have to go through suffering with captivity,

5 whose possessors slay them and hold themselves not guilty; and those who sell them say, ‘Blessed be the Lord, for I am rich’; and their own shepherds pity them not.

— whose possessors, or captors, slay them and hold themselves not guilty, the buyers and masters of the covenant people dealing with them as they pleased, without incurring blame; and because, in multiple places (Jeremiah 25:9, Jeremiah 27:6, Jeremiah 43:10), God describes the one with his sword, Nebuchadnezzar, as “the king of Babylon, My servant,” three times actually;

— and they that sell them say, ‘Blessed be the Lord, for I am rich,’ the expression fitly describing the self-satisfaction felt by the hard-hearted masters in enriching themselves at the expense of the flock; and their own shepherds pity them not.

6 For I will no more pity the inhabitants of the land,” saith the Lord. “But lo, I will deliver the men every one into his neighbor’s hand, and into the hand of his king; and they shall smite the land, and out of their hand I will not deliver them.”

— for God will have no more pity upon the inhabitants of the land, no longer spare them after a last effort to save them; but, lo, God will deliver the men everyone into his neighbor’s hand, so that internal strife and dissension would ruin the country;

— and into the hand of his king as God’s servants, the foreign emperor or governor; and they shall smite the land, the house of Judah for 40 years and the house of Israel for 190 years (Ezekiel 4) oppressing it in various ways; and out of their hand, out of the power of such oppressors, God will not deliver them.

For more into another Captivity: see Ezekiel Timeline – 190/40 Years

For more about a prophecy of Esau or Edom, see Obadiah

For more on the enemy from the South, see A Sword from the South!

7 And I will feed the flock for slaughter, even you, O poor of the flock. And I took unto me two staves: the one I called Beauty, and the other I called Bands; and I fed the flock.

— and God will feed the flock of the slaughter, rather, “I fed the flock,” for the prophet here describes how he undertook the commission which the Lord gave him, even you, O poor of the flock, those in his charge being in a very sad condition, lacking in spiritual knowledge;

— and God took unto for himself two staves, or rods (Psalms 23:4), such as shepherds used in their work; the one I called Pleasantness (H5278 – nōʿam נֹעַם kindness, pleasantness, delightfulness, beauty, favour), or “loveliness, favor” or delight, like “Josiah, the anointed” such as the Lord intended to show His people through the work of his servants, the prophets: Isaiah, Hosea, Jeremiah, Micah, Ezekiel, Habakkuk, Amos, etc;

— and the other God called Destroyers, (H2254 – ḥāḇal חָבַל; to destroy, spoil, deal corruptly, offend, to pervert) like the second Personage in the Garden of Eden; or like “Nebuchadnezzar, my servant” or like wolves and foxes, allowing them to roam around as often the Lord’s people are stiffed-necked and needed a longer way (like taking an extra 40 years to reach the Promised Land);

— and harder (like spending 70 years in captivity in Babylon) to learn before they genuinely wanted to be his people and to feel the blessings over the oppression by all their enemies; and God fed the flock, performing his work as a true shepherd according to the intend of the first staff.

— Rashi: and one I called Destroyers: Rehoboam told his kingdom that his father hath chastised you with whips, but he would flog them with scorpions (I Kings 12:11). [Zechariah] calls their rulers staffs because it is customary to lead flocks with staffs.

8 Three shepherds also I cut off in one month; and my soul loathed them and their soul also abhorred me. — three shepherds also God cut off in one month; my soul loathed them; hated their treachery; these are wicked shepherds and the scribes of the nation being probably meant;

— who were removed from power in a very short time; for God loathed them, since he, the type of the one Good Shepherd and Ruler of his Kingdom, became impatient with their perverse impenitence, and their soul also abhorred God, the sheep foolishly refusing to follow the kind leadership of their shepherd;

— Zechariah 11:8 is one of the most intriguing verse in the Scriptures. Who are these three shepherds? Could one series of these three be Fred Coulter, Frank Nelte and John Ritenbaugh? (JR died May 28, 2023; ”Pentecost,” Sunday) All three have accused Ezra, a man of God, of forging the Scriptures, especially Deuteronomy 16. Forging God’s Word are serious charges, whose penalty is death (Revelation 22:18-19).

“For I testify unto every man that heareth the words of the prophecy of this book: If any man shall add unto these things, God shall add unto him the plagues that are written in this book.

“And if any man shall take away from the words of the book of this prophecy, God shall take away his part out of the Book of Life and out of the Holy City, and from the things which are written in this book,” Revelation 22:18-19.

But on the other hand, if Ezra isn’t guilty of forging, then these three accusers are wolves in shepherd clothings that are also destroyers at the beginning of verse eight above.

9 Then said I, “I will not feed you: that which dieth, let it die, and that which is to be cut off, let it be cut off; and let the rest eat every one the flesh of another.”

— because of the continual sins of Israel and Judah, said the Lord, ‘I will not feed you,’ declaring that he would no longer be their shepherd; that if the sheep die, let them die, he would let them rush to their own ruin since they refused to be guided by the good staff;

— and that that is to be cut off, let it be cut off, to be destroyed, let it be destroyed by the power of their oppressors; and let the rest eat everyone the flesh of another, that is, in a typical civil war, such as preceded the final destruction of Jerusalem; and as now, more and more intense talks of a second civil war looming over the United States.

10 And I took my staff, even Beauty, and cut it asunder, that I might break my covenant which I had made with all the people.

— and God took his staff, even Beauty, one of a gentle approach, one favoured, one of Pleasantness, and cut it asunder, to indicate the withdrawal of God’s favor from His people, ‘that I might break my covenant which I had made with all the people.’

11 And it was broken on that day, and so the poor of the flock who waited upon me knew that it was the word of the Lord. — and it was broken in that day, the covenant being annulled by Israel’s disobedience;

— and so the poor of the flock, sheep that were not fed, that waited upon the Lord, the lowly among the people, but knew that it was the word of the Lord. It was from among the poor and lowly, the uninitiated, that the Lord, the righteous among them who kept his statute understood; even in those latter days, they’ll understand.

12 And I said unto them, “If ye think it be good, give me my price; and if not, forbear.” So they weighed for my price thirty pieces of silver. — and God said unto them, to those destroyers of Israel, those not recognizing the things of peace, ‘If ye think it be good, if ye think good, give me my price;’

— give me my price; and if not, forbear, see Ezekiel 2:5, “And they, whether they will hear or whether they will forbear (for they are a rebellious house), yet shall know that there hath been a prophet among them.” So they weighed the value of a slave that had been killed, Exodus 21:32, the ordinary price of a female slave, Hosea 3:2. Cf Matthew 26:15.

13 And the Lord said unto me, “Cast it unto the potter” — a goodly price that I was prized at by them. And I took the thirty pieces of silver, and cast them to the potter in the house of the Lord.

— and the Lord said unto Zechariah, Cast it unto the potter, thereby rejecting the insult which they offered. A goodly price that Zechariah was prized at of them! this being said in impressive irony;

— and Zechariah took the thirty pieces of silver and cast them to the potter in the house of the Lord. This statement has no meaning in this connection, but it receives a meaning through its fulfillment, for the thirty pieces of silver which the rulers of the Jews weighed to Judas for his betrayal of the Lord were by him cast into the Temple, the money later being used for the purchase of a potter’s field. Cf Matthew 27:1-10 and Jeremiah 32:6-15.

14 Then I cut asunder mine other staff, even Bands, that I might break the brotherhood between Judah and Israel. — then God cut asunder his other staff, even Bands, the Destroyer, that God might break the gentle approach he used to shepherd the children of Israel,

— so that, by the punishment of God, which, in the latter days of the people, contributed much toward the numerous tribulations of each nation. Sin is a reproach to any people, but the height of folly is the denial and rejection of God, the staff called Beauty, then later the Bands, the one Shepherd using both a pationate Shepherd as well as a Destroyer that come with the Lord’s judgement for destruction and corrections.

15 And the Lord said unto me, “Take unto thee yet the instruments of a foolish shepherd. — and the Lord said unto Zechariah, Take unto thee yet the instruments of a foolish shepherd, of a wicked Destroyer, who bears the insignia of a true shepherd, wolves in sheep skin, but cares nothing for the sheep;

— the punishment of rejecting the Good Shepherd was to be not only the loss of him, but the substitution of an evil shepherd in his place; but who is he? a man like the Pope, or an anti-Christ?

16 For lo, I will raise up a shepherd in the land who shall not visit those that are cut off, neither shall seek the young one, nor heal that which is broken, nor feed that which standeth still; but he shall eat the flesh of the fat and tear their claws in pieces.

— for, lo, God will raise up a shepherd in the land, in the singular number, one pretending to function like that of a true shepherd, which shall not visit those that be cut off, paying no attention to those who perish;

— neither shall seek the young one, those that have gone astray, nor heal that that is broken, suffering with broken limbs, nor feed those that could stand still, those who are still strong, but in need of food; but he shall eat the flesh of the fat and tear their claws in pieces, in order to get even the last vestige of meat from the bones.

17 “Woe to the sham shepherd that leaveth the flock! The sword shall be upon his arm and upon his right eye; his arm shall be clean dried up, and his right eye shall be utterly darkened.”

— woe to the idol shepherd, or of no value, or the Destroyer, who calls himself the shepherd, ruler, or teacher of the people, but is in reality nothing less; those worthless shepherding that leaveth the flock, neglecting his chief duty toward its members;

— the Sword shall be upon the arm of the wicked shepherd, and upon his right eye, so that he’s blind; his arm shall be clean dried up; his secular power shall be taken away from him; and his right eye shall be utterly darkened, so he couldn’t see; his knowledge of the Scriptures, judgement in errors, and even the infallibility pretended by these shepherds will cease;

— it will hardly do to limit this prophecy to an earthly, temporal power. It seems rather that the Spirit of the Lord, looking forward in the history of Israel, outlined in a few strokes by the Destroyer, which originated in the Garden of Eden, in the midst of those who are willing to reject the Truth of God, indicating at the same time that this same power would still be promoted by the power of the same Destroyer, as it is evidenced in the “Churches” today.

Zechariah 12

1 The burden of the word of the Lord for Israel, saith the Lord who stretcheth forth the heavens, and layeth the foundation of the earth, and formeth the spirit of man within him:

— this is the Lord’s oracle about Israel; it is a prophetic revelation from the Lord—who spread out from the heavens;

— and layeth the foundation of the earth, which if it were not upheld by his power would wander from its orbit and fall into ruins; and formeth the spirit of man within him, controlling the thoughts and purposes of men so as to accomplish his own plans through them.

2 “Behold, I will make Jerusalem a cup of trembling unto all the people round about, when they shall be in the siege both against Judah and against Jerusalem.

— behold, God will make Jerusalem a cup of trembling, a vessel filled with the intoxicating beverage of his wrath, unto all the people round about, the neighboring nations, reeling and falling in hopeless weakness and misery;

— when the nations around shall be in the siege both against Judah and against Jerusalem, literally, “and also upon Judah shall it be in the siege of Jerusalem,” the entire country and its capital being involved in the severe trial which would come from among its neighbors.

3 And in that day will I make Jerusalem a burdensome stone for all people. All who burden themselves with it shall be cut in pieces, though all the people of the earth be gathered together against it.

— on that day God will make Jerusalem a stone too heavy for all the nations to lift; all who try to lift it will be severely injured. All the nations in the world will gather to fight against Jerusalem; all the powers of evil being united in an effort to overthrow the city of the Lord.

4 In that day,” saith the Lord, “I will smite every horse with astonishment and his rider with madness. And I will open Mine eyes upon the house of Judah, and will smite every horse of the people with blindness;

— on that day, God will smite every horse with panic and every rider with madness, all the warlike forces finding themselves at a loss to effect their evil purposes;

— and God will keep his watch upon the house of Judah with his protecting care and will smite every horse of the nations with blindness so that the hostile forces would not be able to find their way;

— the Targum paraphrases it, “and upon those of the house of Judah, I will reveal my power to do them good.”

5 and the governors of Judah shall say in their heart, ‘The inhabitants of Jerusalem shall be my strength in the Lord of hosts, their God.’

— and the leaders and princes of Judah shall say in their heart, the inhabitants of Jerusalem shall have God’s strength, a reliable source of confidence, in the Lord of hosts, our God, because the Lord has chosen this city, his Kingdom, and by virtue of this choice is bound to redeem his people.

6 “In that day will I make the governors of Judah like a hearth of fire among the wood, and like a torch of fire in a sheaf, and they shall devour all the people round about on the right hand and on the left; and Jerusalem shall be inhabited again in her own place, even in Jerusalem.

— on that day will God make the leaders and princes of Judah like an hearth of fire among the wood, so that they would consume their enemies like a basin of fire devouring wood; the Targum renders it, “as a garment of fire among wood;”

— and like a torch of fire in a sheaf, burning up the dry straw; and they shall devour all the people round about, on the right hand and on the left, so that none of the adversaries can hold out against them; and Judah shall be inhabited again in her own place, even in Jerusalem, so that the renewed people could fitly become the nucleus of the Kingdom of God in Jerusalem.

7 The Lord also shall save the tents of Judah first, that the glory of the house of David and the glory of the inhabitants of Jerusalem do not magnify themselves against Judah.

— the Lord also shall save the dwellings of the country outside of the capital of Judah first, with its stone palaces, that the glory of the house of David and the glory of the inhabitants of Jerusalem do not magnify themselves against Judah, the house of David being the royal family.

8 “In that day shall the Lord defend the inhabitants of Jerusalem; and he that is feeble among them at that day shall be as David, and the house of David shall be as God, as the angel of the Lord before them.

— as with a shield against their enemies on that day shall the Lord defend the inhabitants of Jerusalem, by a special strengthening against the foe; and he that is feeble among them, literally, “the stumbler,” one who can hardly hold himself up, being very weak;

— on that day shall be as David, to the Jew the highest type of strength and courage; and the house of David shall be as God, like a supernatural being, as the Angel of the Lord before them, like the Son of God in his Old Testament form, whose power lived in all his believers.

9 And it shall come to pass in that day that I will seek to destroy all the nations that come against Jerusalem. — on that day and using the second staff, God will seek to destroy all the nations who attack Jerusalem;

— even while Jerusalem was exalted to a degree of strength and glory far transcending anything in its past experience, God will destroy all the nations that come against Jerusalem.

10 And I will pour upon the house of David and upon the inhabitants of Jerusalem the spirit of grace and of supplication; and they shall look upon Me whom they have pierced, and they shall mourn for Him as one mourneth for his only son, and shall be in bitterness for Him as one who is in bitterness for his firstborn.

— and God will pour upon the house of David, the entire royal family, the royal priesthood of the Kingdom of God, and upon the inhabitants of Jerusalem, the members of his congregation in general, the spirit of grace and of supplications, him who works in the heart of man the certainty of the divine grace and urges him to seek forgiveness of sins by fervent prayers and fastings;

— and the house of Judah shall look upon me whom they have pierced (H1856 – dāqar דָּקַר to pierce, piercing through), as they nailed their Messiah to the cross, John 19:34; Revelation 1:7, or by piercing His side with a spear; and they shall mourn for him as one mourn for his only son, acknowledging their transgression in killing the Prince of Life, Acts 3:15, and shall be in bitterness for him as one that is in bitterness for his firstborn, almost the greatest grief and sorrow known to the Jews;

Rashi: as one mourns over an only son: As a man mourns over his only son. And our Sages expounded this in tractate Sukkah (52a) as referring to the Messiah, son of Joseph, who was slain;

Rashi rightly quoted the Targum Sukkah (52a) about the Messiah to come from one Yeshua, a son of Joseph, of the house of David, yet they are blindsided to him as the Son of God and as the fulfilment of the Messiah’s first coming; (reference to this “piercing” disappeared in the Masoretic Text, an example of the lying pen of the scribes: Jeremiah 8:8; or perhaps the lying tongues of their Sages).

11 “In that day shall there be a great mourning in Jerusalem, as the mourning of Hadadrimmon in the Valley of Megiddo.

— on that day, when the greatness of their crime in putting their own Messiah to death, would be brought home to some of the people, shall there be a great mourning in Jerusalem as is ever the case when men realize that their sins were the cause of Christ’s death;

— as the mourning of Hadadrimmon, when the men of Judah mourned so bitterly over the death of their King Josiah, who was mortally wounded near that place in the Plain of Esdraelon, II Chronicles 35:22 ff. in the Valley of Megiddon.

12 And the land shall mourn, every family apart: the family of the house of David apart, and their wives apart; the family of the house of Nathan apart, and their wives apart;

— and the land shall mourn, each family by itself: the family of David by itself, and the wives by themselves; the family of Nathan by itself, and the wives by themselves;

13 the family of the house of Levi apart, and their wives apart; the family of Shimei apart, and their wives apart; — the family of Levi by itself, and the wives by themselves; the family of Shimei by itself, and the wives by themselves;

14 all the families that remain, every family apart, and their wives apart. — all the families that remain, that is, the whole nation shall be born; every family apart and their wives separately. Nor would this sorrow of true repentance be in vain. Zechariah 13:1

— on that day there shall be a fountain opened to the house of David and to the inhabitants of Jerusalem, to the entire nation, as representative of the Kingdom of God in the Millennium, in whose members the blood of the Messiah, shed for the sins of the world, has prepared a water which thoroughly cleanses sinners from their uncleanness. Cf 1 John 1:7. It is the washing of regeneration and renewing of the spirits of God which is shed on us abundantly through Jesus Christ, or Yeshua the Messiah, Titus 3:5-6.

AUKUS red-faced after sub files found in pub’s toilet

•May 1, 2023 • Leave a Comment

“Don’t pick up the phone” might not be a formal agenda during meetings for the next Brics+ conference in South Africa comes August, 2023; but surely it will be a hot topic during coffee breaks! “So that you won’t be shouted down!”

But Australia has been an ally since the end of WWII, with the establishment of ANZUS, a 1951 security agreement between Australia, New Zealand and the United States, so Australia always pick up the phone; even if it is from a dangerous ally. For more see, hereDangerous Allies!”

Now Australia’s AUKUS partners are red-faced after their sub files are found in a pub’s toilet: the worst deal in history

The Sydney Moring Herald by Rob Harris • April 29, 2023 // RT World News

London: Australia’s partner in the $368 billion AUKUS defence deal has been left red-faced after official documents about one of its Astute-class submarines were found in the toilets of a local pub.

Files carrying details about HMS Anson were left in the Furness Railway in Cumbria, alongside a Royal Navy lanyard, and showed the inner workings of the nuclear-powered submarine and were used by submariners learning how to isolate and depressurise elements of its system.

The pub is a short distance from a BAE systems shipyard in Barrow-in-Furness, where Australian submariners will undergo training as part of the agreement with Britain and the United States over the cutting-edge nuclear submarines.

The Royal Navy has played down part of the report carried in Britain’s The Sun newspaper, which said the files, marked “official sensitive”, were discovered on the floor of a cubicle.

Government guidance says ­that information marked “Sensitive” must only be shared on “genuine need to know” and could have damaging ­consequences if lost, stolen or ­published.

The Royal Navy said it would investigate the breach, but said the papers were generic resources and did not contain any classified information.

“These are generic training documents that carry no classified information,” a Royal Navy spokesman said. “However, we take all security matters extremely seriously and will investigate the circumstances of their discovery.”

HMS Anson is the fifth of the new Astute-class attack submarines to join the Royal Navy fleet. The vessels are capable of firing tomahawk missiles and described as the “largest, most advanced and most powerful attack submarines” ever used.

Australian Prime Minister Anthony Albanese is anticipated to visit the secure facility when he travels the UK next week ahead of attending King Charles III’s coronation. In the past year, Defence Minister Richard Marles and Defence Industry Minister Pat Conroy have visited the base, as well as South Australian Premier Peter Malinauskas.

Last month it was revealed the first Australian-built nuclear-powered submarines, fitted with vertical launch systems to fire cruise missiles, would be British-designed and incorporate US technology.

The submarines will be developed by BAE Systems at its Barrow-in-Furness shipyard before Australia expands it capability at Osborne, west of Adelaide. The SSN-AUKUS class will replace the Royal Navy’s Astute-class boats when they enter into operation.

The AUKUS pact is intended to help Australia secure nuclear-powered submarines as part of a wider push to counter China’s military might, but will also eventually result in the three nations co-operating in other areas, such as artificial intelligence, quantum computing and cyber warfare.

Albanese has described AUKUS as the “single biggest leap” in Australia’s defence capabilities, but concerns remain about Australia’s reliance on the US and the maze of export controls that could slow the transfer of the nuclear-propulsion or other technology. But Paul Keating sas it is the worst deal in history.

“And they shall come against thee with chariots, wagons, and wheels, and with an assembly of people, who shall set against thee buckler and shield and helmet roundabout; and I will set judgement before them, and they shall judge thee according to their judgements.

“And I will set My jealousy against thee, and they shall deal furiously with thee. They shall take away thy nose and thine ears, and thy remnant shall fall by the sword. They shall take thy sons and thy daughters, and thy residue shall be devoured by the fire” Ezekiel 23:24-25

Depleted Uranium already in Ukraine

•April 30, 2023 • Leave a Comment

China is expected to stop the war in Ukraine, so says the German Foreign Minister, Annalena Baerbock, because in her mind, China is a permanent member of the UN, and thus should be a responsible member working for world peace.

But Baerbock doesn’t notice that the other two permanent members, the UK and the US, have been so irresponsible in speading depleted uranium in Ukraine.

Now, British depleted uranium is already in Ukraine. And that, Baerbock has no complaint!

How often has Baerbock been shouted down since being appointed as Foreign Minister of Germany?

British Army trains Ukrainian tank crews on Challenger 2

RT World News • April 26, 2023

The UK Ministry of Defence says it has no obligation to help clean up areas contaminated by the radioactive munitions

The UK government has already started shipments of depleted uranium ammunition to Ukraine, Armed Forces Minister James Heappey said, noting that the British military would not attempt to track where the weapons are used.

In response to questions from Scottish MP Kenny MacAskill, Heappey confirmed on Tuesday that DU munitions for the UK-made Challenger 2 tank had already arrived in Ukraine, though declined to comment on Kiev’s “usage rates for the rounds provided.”

“We have sent thousands of rounds of Challenger 2 ammunition to Ukraine, including depleted uranium armour-piercing rounds,” he saidadding the weapons “are now under the control of the Armed Forces of Ukraine (AFU)” and that the Defence Ministry “does not monitor the locations from where DU rounds are fired by the AFU in Ukraine.”

Asked whether the government has a responsibility to “help clear up depleted uranium rounds” used in Ukraine after the conflict, the minister stated it has “no obligation” to do so, instead stressing “Ukraine’s immediate needs.”

While Heappey has claimed that the health and environmental risks posed by depleted uranium are “low,” citing the “monitoring of UK military veterans” performed for a government study in 2007, more recent research suggests the munitions could carry health hazards after all. The US used DU ammunition heavily during its two wars in Iraq, with some researchers claiming the weapons could be linked to a spate of birth defects later observed in the country.

According to Doug Weir, an expert with the Conflict and Environment Observatory, when DU penetrators strike a target, “they fragment and burn, generating chemically toxic and radioactive DU particulate that poses an inhalational risk to people.” Both the US and UK governments have long disputed the alleged dangers, however.

READ MORE: UK’s depleted uranium plan threatens all of Europe – Moscow

In March, British and American advisers oversaw special training for Ukrainian troops for how to handle DU rounds, which will primarily be used for the Challenger 2 tank. London previously vowed to send a total of 14 of the tanks to Ukraine, though it is unclear whether any have reached the battlefield. 

Moscow has repeatedly urged against foreign arms shipments to Kiev, especially the British DU munitions, with the Foreign Ministry condemning London for “absolute recklessness, irresponsibility and impunity.” Last month, the Russian military also warned that the use of uranium shells is likely to “cause irreparable harm” to the health of Ukrainians and inflict “tremendous economic damage to the agro-industrial complex” in the region, citing the weapon’s impact in Iraq.

“I have seen a horrible thing in the house of Israel” Hosea 6:10

“And I will turn your feasts into mourning and all your songs into lamentation; and I will bring up sackcloth upon all loins and baldness upon every head; and I will make it as the mourning for an only son, and the end thereof as a bitter day” Amos 8:9-10

“The LORD shall smite thee with madness, and blindness, and astonishment of heart; and thou shalt grope at noonday, as the blind gropeth in darkness” Deuteronomy 28:28-29

Prayers: from 101 to 501

•April 29, 2023 • Leave a Comment

Prayers have layers of sophistication. For a point of reference, we’ll start with Daniel’s Prayer, as his prayer should be the cornerstone of the Study of Prayer.

Daniel’s Prayer

Daniel’s Prayer is an example for us to study and emulate, especially for forgiveness against the Law of Moses (Leviticus 26Deuteronomy 28); Daniel’s prayer was not merely praying for his comfort and protection in the darkness. His concern was to pray for God’s people, the acknowledgment of their sins and asking for forgiveness and mercies.

What Daniel admitted is unlike what Rabbi Tovia Singer and other rabbinic interpretation have in their teachings by shifting blames by assigning the “suffering servant” of Isaiah 53 to the nation of Israel “who silently endured unimaginable suffering at the hands of its gentile oppressors.” That is, to Rabbi Singer, Israel’s suffering is attributable to their wicked neighbours and not to themselves!

Or, from another shifting of blames from Jews for Judaism“when the nations, astonished and in terror, will feel ashamed for their oppression of the Jewish people.” Again, they have no faults of their own but shift their suffering to their wicked neighbours and not attribute to themselves!

Making no excuses, Daniel confessed his people’s sin and acknowledged the justice of God’s judgement, severe though it had been. “We have sinned, we have done wickedly” Israel suffers because of her own sins; Period! In response from God, Daniel was greatly praised by the angel Gabriel, who was sent with further revelation or prophecy and said to Daniel, “I have come to show thee, for thou art greatly loved.”

Daniel is greatly loved, his example of a Prayer should be emulated and studied today. For example:

(1) Daniel does not say “they” but instead he says “we” incorporating the reality that all have sinned and all need forgiveness;

(2) instead of justifying like King Saul did, Daniel freely knowledges his and his nation’s iniquities, wickedness and rebellion against the Most High;

(3) nowhere in Daniel’s prayer did he put the blame on the wicked Chaldeans nor on Nebuchadnezzar, but squarely on themselves; and

(4) asks, “Open Thine ear and hear,” asks “O Lord, forgive! O Lord,” for forgiveness and for His great mercies on behalf of his people.

Daniel’s Prayer would be highly rated Prayer; it should be at least a 401 Prayer in University Rating Standard. For details, click Daniel’s Prayer here.

Daniel’s Prayer is found in Daniel 9

2 in the first year of his reign I, Daniel, came to understand by books the number of the years, according to the word of the Lord as it came to Jeremiah the prophet, that He would spend seventy years in the desolations of Jerusalem.

— seventy years of captivity in Babylon, for the house of Judah had forgotten God’s warning: “And I will scatter you among the heathen, and will draw out a sword after you; and your land shall be desolate and your cities waste,” Leviticus 26:33.

3 And I (Daniel) set my face unto the Lord God, seeking by prayer and supplications, with fasting, and sackcloth, and ashes.

4 And I prayed unto the Lord my God, and made my confession and said, “O Lord, the great and fearsome God, keeping the covenant and mercy to them that love Him and to them that keep His commandments,

we have sinned and have committed iniquity, and have done wickedly and have rebelled, even by departing from Thy precepts and from Thy judgements.

— instead of justifying like King Saul did, Daniel freely knowledges his nation’s iniquities, wickedness and rebellion against the Most High, departing from His precepts and from His judgements.

6 Neither have we hearkened unto Thy servants the prophets, who spoke in Thy name to our kings, our princes, and our fathers, and to all the people of the land.

7 O Lord, righteousness belongeth unto Thee, but unto us confusion of faces, as at this day: to the men of Judah and to the inhabitants of Jerusalem, and unto all Israel who are near and who are far off, through all the countries whither Thou hast driven them, because of their trespass that they have trespassed against Thee.

8 O Lord, to us belongeth confusion of face, to our kings, to our princes, and to our fathers, because we have sinned against Thee.

To the Lord our God belong mercies and forgivenesses, though we have rebelled against Him;

10 neither have we obeyed the voice of the Lord our God to walk in His laws, which He set before us by His servants the prophets.

11 “Yea, all Israel have transgressed Thy law, even by departing, that they might not obey Thy voice; therefore the curse is poured upon us, and the oath that is written in the Law of Moses the servant of God, because we have sinned against Him.

— for not obeying God’s voice and transgressing upon His laws, Daniel freely admits “the curse is poured upon us” and Daniel offers no stupid excuses, unlike his latter-days pretenders and other stout-hearted;

— three times Nebuchadnezzar was described as “Nebuchadnezzar the king of Babylon, My servant,” (Jeremiah 25:9, 27:6, 43:10); a savaging Nebuchadnezzar was just an instrument being used by God to horse-whipped Israel into shape;

— Ezra also freely admitted it was their sin or their fathers’ sin, “But after our fathers had provoked the God of heaven unto wrath, He gave them into the hand of Nebuchadnezzar the king of Babylon, the Chaldean, who destroyed this house and carried the people away into Babylon,” Ezra 5:12

— by trying to divert sins is very much like what God’s anointed King Saul did. When asked why he disobeyed God by not destroying Amalek and all that they have, his defence was “but the people took of the spoil, sheep and oxen,” and as a result he lost God’s favor: he lost a sound mind, consulted a witch and his kingdom was taken away from him.

12 And He hath confirmed His words which He spoke against us and against our judges who judged us, by bringing upon us a great evil; for under the whole heaven hath not been done as hath been done upon Jerusalem.

13 “As it is written in the Law of Moses, all this evil is come upon us. Yet made we not our prayer before the Lord our God, that we might turn from our iniquities and understand Thy truth.

14 Therefore hath the Lord watched upon the evil, and brought it upon us; for the Lord our God is righteous in all His works which He doeth, for we obeyed not His voice.

15 “And now, O Lord our God, who hast brought Thy people forth out of the land of Egypt with a mighty hand, and hast made Thee a name, as at this day — we have sinned, we have done wickedly.

16 O Lord, according to all Thy righteousness, I beseech Thee, let Thine anger and Thy fury be turned away from Thy city Jerusalem, Thy holy mountain; because for our sins and for the iniquities of our fathers, Jerusalem and Thy people have become a reproach to all who are about us.

17 “Now therefore, O our God, hear the prayer of Thy servant and his supplications, and cause Thy face to shine upon Thy sanctuary that is desolate, for the Lord’s sake.

18 O my God, incline Thine ear and hear. Open Thine eyes and behold our desolations and the city which is called by Thy name; for we do not present our supplications before Thee because of our righteousnesses, but because of Thy great mercies.

19 O Lord, hear! O Lord, forgive! O Lord, hearken and do! Defer not, for Thine own sake, O my God; for Thy city and Thy people are called by Thy name.”

— nowhere in Daniel’s prayer did he put the blame on the wicked Chaldeans nor on Nebuchadnezzar, but squarely on themselves; the vicious and ravaging Chaldeans were just mere instruments used by God as three time Nebuchadnezzar was described as “Nebuchadnezzar the king of Babylon, My servant,” (Jeremiah 25:9, 27:6, 43:10) to carry out His will;

— at no instance did Daniel called upon God to take revenge. Gentiles are not lilywhites, but God’s will for the Gentiles is His business alone, and He will carry out His judgement and revenge in His own space and time.

Hezekiah’s Prayer

And Hezekiah prayed before the Lord, and said:

“O Lord God of Israel, who dwellest between the cherubims, Thou art the God, even Thou alone, of all the kingdoms of the earth. Thou hast made heaven and earth.

16 Lord, bow down Thine ear, and hear; open, Lord, Thine eyes, and see; and hear the words of Sennacherib, who hath sent him to reproach the living God.

17 Of a truth, Lord, the kings of Assyria have destroyed the nations and their lands,

18 and have cast their gods into the fire; for they were no gods, but the work of men’s hands, wood and stone. Therefore they have destroyed them.

19 Now therefore, O Lord our God, I beseech Thee, save Thou us out of his hand, that all the kingdoms of the earth may know that Thou art the Lord God, even Thou only.” II Kings 19:15-19

35 And it came to pass that night, that the angel of the Lord went out and smote in the camp of the Assyrians a hundred fourscore and five thousand; and when they arose early in the morning, behold, they were all dead corpses. — 185,000 soldiers dead overnight! II Kings 19:35

Some observation

Hezekiah wasn’t in captivity; he was just threatened and his trial was pretty short-lived, compared to Daniels; hence we’ll rate his as 301, one notch below Daniel’s.

For more details, click here

The Lord’s Prayer

Matthew 6

9 Our Father who art in Heaven, hallowed be Thy name.

10 Thy Kingdom come. Thy will be done on earth, as it is in Heaven.

11 Give us this day our daily bread.

12 And forgive us our debts, as we forgive our debtors.

13 And lead us not into temptation, but deliver us from evil. For Thine is the Kingdom, and the power and the glory for ever. Amen. Matthew 6:9-13

This Prayer, which Jesus gave as an example, has the context in the previous chapter (Matthew 5); after giving his sermon to the multitude, the vast majority who asked him are people from the countryside, farmers, fishermen, not too educated as those from Jerusalem.

The Context was: “And seeing the multitudes, He went up onto a mountain; and when he was set, his disciples came unto him.

And He opened His mouth and taught them, saying, “Blessed are the poor in spirit, for theirs is the Kingdom of Heaven” Matthew 5:1-3

Thus it was a start for beginners, like students staring their university studies, who ask how to pray; hence we’ll rate it as a foundational Prayer 101.

David’s Prayer

David, being convinced of his sin when prophet Nathan approached him, poured out his soul to God in prayer for mercy and forgiveness. His Prayer is recorded in Psalm 51:

1 Have mercy upon me, O God, according to Thy lovingkindness; according unto the multitude of Thy tender mercies, blot out my transgressions.

2 Wash me thoroughly from mine iniquity, and cleanse me from my sin. 3 For I acknowledge my transgressions, and my sin is ever before me.

4 Against Thee, Thee only, have I sinned and done this evil in Thy sight, that Thou mightest be justified when Thou speakest, and be clear when Thou judgest. 5 Behold, I was shaped in iniquity, and in sin did my mother conceive me.

— because in sin did my mother conceive me, therefore I was brought forth in iniquity;

— despite being a good prayer as a whole, especially coming with “a broken spirit; a broken and a contrite heart,” and David being described as a friend of God, he attempts shifting his sins to his mother being born into this world;

— that is, he was saying that his sin could be traced back to his “very birth” rather than to himself. There was no record that an angel was despatched to pat on his back, “this is such a good prayer” or something similar.

6 Behold, Thou desirest truth in my inward parts; in the hidden part Thou shalt make me to know wisdom. 7 Purge me with hyssop, and I shall be clean; wash me, and I shall be whiter than snow.

8 Make me to hear joy and gladness, that the bones which Thou hast broken may rejoice. 9 Hide Thy face from my sins, and blot out all mine iniquities.

10 Create in me a clean heart, O God, and renew a right spirit within me. 11 Cast me not away from Thy presence, and take not Thy holy Spirit from me. 12 Restore unto me the joy of Thy salvation, and uphold me with Thy free Spirit. 13 Then will I teach transgressors Thy ways, and sinners shall be converted unto Thee.

14 Deliver me from bloodguiltiness, O God, Thou God of my salvation, and my tongue shall sing aloud of Thy righteousness.

15 O Lord, open Thou my lips, and my mouth shall show forth Thy praise. 16 For Thou desirest not sacrifice, else would I give it; Thou delightest not in burnt offering.

17 The sacrifices of God are a broken spirit; a broken and a contrite heart, O God, Thou wilt not despise. 18 Do good in Thy good pleasure unto Zion; build Thou the walls of Jerusalem.

19 Then shalt Thou be pleased with the sacrifices of righteousness, with burnt offering and whole burnt offering; then shall they offer bullocks upon Thine altar. Psalm 51

Observation: David has the propensity to sin, and he committed many sins more hideous than even his predecessor, King Saul; only that he acknowledges his sins (adultery, murder, etc) and asks for forgiveness.

But what if God didn’t send a prophet to reveal David’s sin? Yet somehow David seems to justify himself in his prayer, “Behold, I was shaped in iniquity, and in sin did my mother conceive me,” sort of blaming his mother who conceive him. We’ll rate it as 201.

Solomon’s Prayer

Solomon’s Prayer is another example for us to study and emulate, especially what we should ask for if we are asking for something. When Solomon was “but a little child” his concern was already for God’s people, and he asked for wisdom to judge his people, which requires the ability of discernment.

“Give therefore Thy servant an understanding heart to judge Thy people, that I may discern between good and bad; for who is able to judge this Thy so great a people?” 1 Kings 3:9

His request was a wonderful thing: “an understanding heart to judge” that is, wisdom, instead of “long life, riches, nor the life of thine enemies,” and for this, he was rewarded those that he “hast not asked, both riches and honor, so that there shall not be any among the kings like unto thee all thy days.”

As Solomon was pretty sinless, yet as a child he knew how to ask for wisdom so as to serve his people in betterment of his countrymen; we would, perhaps, rate such a prayer as 301.

For more details, see Solomon’s Prayer here and here.

Ezra’s Prayer and Nehemiah’s Prayer

Ezra’s Prayer (Ezra 9:7-15):

7 “Since the days of our fathers we have been in a great trespass unto this day; and for our iniquities have we, our kings, and our priests, been delivered into the hand of the kings of the lands, to the sword, to captivity, and to a spoil, and to confusion of face, as it is this day. 8 And now for a little space grace hath been shown from the Lord our God, to leave us a remnant to escape, and to give us a constant and sure abode in His holy place, that our God may lighten our eyes, and give us a little reviving in our bondage.

9 For we were bondmen; yet our God hath not forsaken us in our bondage, but hath extended mercy unto us in the sight of the kings of Persia, to give us a reviving to set up the house of our God and to repair the desolations thereof, and to give us a wall in Judah and in Jerusalem.10 “And now, O our God, what shall we say after this? For we have forsaken Thy commandments.”

— note that both Grace and Mercy are mentioned in Ezra’s prayer: that is, they are not a NT thing, as many have falsely alleged;

11 Which thou hast commanded by thy servants the prophets, saying, The land, unto which ye go to possess it, is an unclean land with the filthiness of the people of the lands, with their abominations, which have filled it from one end to another with their uncleanness. 12 Now therefore give not your daughters unto their sons, neither take their daughters unto your sons, nor seek their peace or their wealth for ever: that ye may be strong, and eat the good of the land, and leave it for an inheritance to your children for ever.

13 And after all that is come upon us for our evil deeds, and for our great trespass, seeing that thou our God hast punished us less than our iniquities deserve, and hast given us such deliverance as this; 14 Should we again break thy commandments, and join in affinity with the people of these abominations? wouldest not thou be angry with us till thou hadst consumed us, so that there should be no remnant nor escaping?

15 O Lord God of Israel, thou art righteous: for we remain yet escaped, as it is this day: behold, we are before thee in our trespasses: for we cannot stand before thee because of this. Ezra 9:7-15

And Nehemiah’s Prayer (Nehemiah 1:4-10):

4 “And it came to pass, when I heard these words, that I sat down and wept, and mourned certain days, and fasted, and prayed before the God of heaven, 5 And said, I beseech thee, O Lord God of heaven, the great and terrible God, that keepeth covenant and mercy for them that love him and observe his commandments:

6 Let Thine ear now be attentive and Thine eyes open, that Thou mayest hear the prayer of Thy servant, which I pray before Thee now day and night for the children of Israel Thy servants, and confess the sins of the children of Israel which we have sinned against Thee. Both I and my father’s house have sinned.

7 We have dealt very corruptly against Thee, and have not kept the commandments, nor the statutes, nor the judgments which Thou commanded Thy servant Moses. Remember, I beseech thee, the word that thou commandedst thy servant Moses, saying, If ye transgress, I will scatter you abroad among the nations:

But if ye turn unto me, and keep my commandments, and do them; though there were of you cast out unto the uttermost part of the heaven, yet will I gather them from thence, and will bring them unto the place that I have chosen to set my name there. 10 Now these are thy servants and thy people, whom thou hast redeemed by thy great power, and by thy strong hand.

11 O Lord, I beseech thee, let now thine ear be attentive to the prayer of thy servant, and to the prayer of thy servants, who desire to fear thy name: and prosper, I pray thee, thy servant this day, and grant him mercy in the sight of this man. For I was the king’s cupbearer” Nehemiah 1:4-11

Both Ezra and Nehemiah coming out of Captivity, both didn’t make excuses, both expressing great gratitude to God for their release from Captivity; are excellent examples of great prayers: they would be rated as 401.

Further, on Nehemiah prayer; in fact, an imprecation (cursing):

4 “Hear, O our God; for we are despised: and turn their reproach upon their own head, and give them for a prey in the land of captivity;

5 “Therefore cover not their iniquity, and let not their sin be blotted out from before thee: for they have provoked thee to anger before the builders“ Nehemiah 4:4-5

MSG: Nehemiah prayed, “Oh listen to us, dear God. We’re so despised: Boomerang their ridicule on their heads; have their enemies cart them off as war trophies to a land of no return; don’t forgive their iniquity, don’t wipe away their sin—they’ve insulted the builders!”

14 “Remember Tobiah and Sanballat, O my God, according to these things that they did, and also the prophetess Noadiah and the rest of the prophets who wanted to make me afraid” Nehemiah 6:14

MSG: “O my God, don’t let Tobiah and Sanballat get by with all the mischief they’ve done. And the same goes for the prophetess Noadiah and the other prophets who have been trying to undermine my confidence.”

Jesus’ Prayer

Jesus’ Prayer could be found in all four Gospels: Matthew, Mark, Luke and John:

but for this purpose we’ll just study Matthew version here

The Prayer in the Garden; Matthew 26:

36 Then Jesus came with them to a place called Gethsemane, and said to the disciples, “Sit here while I go and pray over there.” 37 And He took with Him Peter and the two sons of Zebedee, and He began to be sorrowful and deeply distressed. 38 Then He said to them, “My soul is exceedingly sorrowful, even to death. Stay here and watch with Me.”

39 He went a little farther and fell on His face, and prayed, saying, “O My Father, if it is possible, let this cup pass from Me; nevertheless, not as I will, but as You will.”

40 Then He came to the disciples and found them sleeping, and said to Peter, “What! Could you not watch with Me one hour? 41 Watch and pray, lest you enter into temptation. The spirit indeed is willing, but the flesh is weak.”

42 Again, a second time, He went away and prayed, saying, “O My Father, if this cup cannot pass away from Me unless I drink it, Your will be done.” 43 And He came and found them asleep again, for their eyes were heavy.

44 So He left them, went away again, and prayed the third time, saying the same words. 45 Then He came to His disciples and said to them, “Are you still sleeping and resting? Behold, the hour is at hand, and the Son of Man is being betrayed into the hands of sinners. 46 Rise, let us be going. See, My betrayer is at hand.” Matthew 26:36-46

Unfortunately, Jesus’ request of “let this cup pass from me” wasn’t granted. The Father requires that he went through pains and death: the fate of humanity lies on his hand, and it was laid before the foundation of this world. Although his prayer wasn’t granted it was intense, sweats flow from his body. We’ll designate this prayer as 501.

The Son of God lead and end with a reward ending in style, “I am Alpha and Omega, the Beginning and the End, the First and the Last” Revelation 22:13

Zechariah (Ch 9-10)

•April 28, 2023 • Leave a Comment

And the Lord God shall blow the trumpet, summoning his people to the attack, and shall go with whirlwinds of the South, which were always the most violent of all — Q, Could this “whirlwinds of the South” be referring to a parable in Ezekiel 20:45-40 and 21:1-5?

To “all the tribes of Israel”

Zechariah 9

1 The burden of the word of the Lord in the land of Hadrach and Damascus, shall be the rest thereof, when the eyes of man, as of all the tribes of Israel, shall be toward the Lord.

— the words of burden to “all the tribes of Israel” the sentence of a heavy judgement of the Lord in the land of Hadrach, a term which seems to apply to the entire Medo-Persian empire as the world-power opposed to the people of God;

— and Damascus shall be the rest thereof, the Syrian capital being the place on which the burden of the Lord’s wrath rests, the Targum paraphrases it, “and Damascus shall be converted;” and closeby is Antioch where the Gospel was preached, and many converted, and a church, consisting of Jews and Gentiles, was formed; and here the disciples were first called Christians, Acts 11:26;

— when the eyes of man as of all the tribes of Israel, shall be drawn toward the Lord, both the house of Israel and the house of Judah being directed to the Lord at this evidence of his anger when he goes about to establish a more equitable proportion between peoples of the nations.

2 And Hamath also shall border thereby; Tyre and Sidon, though it be very wise. — and Hamath also shall border thereby, or “Hamath” the district bounding Palestine on the north, “which borders thereon,”

— this, together with Damascus, representing Syria; Tyre and Sidon, the cities of Phenicia, though it be very wise, or “because their inhabitants were wise in their own conceit,” multiplying wealth and power and trusting in them.

3 And Tyre did build herself a stronghold, and heaped up silver as the dust, and fine gold as the mire of the streets.

— and Tyre did build herself a stronghold, the city proper being on an island surrounded by a double sea-wall, which made it practically impregnable in those days, and heaped up silver as the dust and fine gold as the mire of the streets for the commerce of Tyre had made her immensely wealthy.

4 Behold, the Lord will cast her out, and He will smite her power in the sea; and she shall be devoured with fire.

— behold, the Lord will seize her through the agency of some earthly conqueror; in this case Alexander and God will smite her power in the sea as represented by her army and her navy; and she shall be devoured with fire so that everything on which her inhabitants depended was consumed and exterminated.

5 Ashkelon shall see it and fear; Gaza also shall see it and be very sorrowful, and Ekron for her expectation shall be ashamed; and the king shall perish from Gaza, and Ashkelon shall not be inhabited.

— Ashkelon shall see God’s judgement, they shall be “ashamed because of their iniquities” namely, the punishment descending upon them; and fear, Gaza also shall see God’s judgement and be very sorrowful, and be exceedingly troubled;

— and the king shall perish from Gaza, the ruler being removed entirely, and Ashkelon shall not be inhabited, its citizens being killed or dragged into captivity.

6 And a bastard shall dwell in Ashdod, and I will cut off the pride of the Philistines.

— and a bastard or mongrel, one of blemished birth shall dwell in Ashdod and God will cut off the pride of the Philistines, four of whose city-states are mentioned here as representative of the entire country.

Rashi: And the strangers shall dwell in Ashdod: And a strange people shall dwell in Ashdod. Those are the Israelites, who were strange in it.

7 And I will take away his blood out of his mouth, and his abominations from between his teeth; but he that remaineth, even he shall be for our God, and he shall be as a governor in Judah, and Ekron as a Jebusite.

— and the Lord will take away his blood out of his mouth; the Targum says, “I will destroy them that eat blood” or against those, [like Esau], who breathe out threats of slaughtering his elect or persecute the people of God;

Rashi: And I will remove his blood from his mouth: From the mouth of Esau; this is their house of Bamia [one of Edom’s principal deities, where they would sprinkle the blood of their sacrifices. . . . some interpret this to mean the bloodshed, that the [Edomites] would shed the blood of Israel.

— and his abominations from between his teeth, striking him down while he is engaged in such criminal behavior; but he that remaineth, even he, shall be for our God; the Targum paraphrases it, “and the proselytes that remain among them, they also shall be added to the people of our God;”

— and he shall be as a governor in Judah, like the prince of one of the tribes, the Targum says, “they [the Gentiles mentioned above, especially the Jebusites] shall be as the princes of the house of Judah” and Ekron, a Jebusite, for as the Jebusites were amalgamated with the children of Judah so these heathen nations and others, would be joined to the true people of God; the Targum says, “and Ekron shall be filled with the house of Israel, as Jerusalem.”

Remember that the Targum is another source of the Bible. Started by Ezra for those returning exiles from Babylon and for these returnees they could only understand in Aramaic; hence the Targum is as if Ezra is speaking to us from the verses quoted.

8 And I will encamp about Mine house because of the army, because of him that passeth by, and because of him that returneth; and no oppressor shall pass through them any more, for now have I seen with Mine eyes.

— and the Lord will encamp about his house; the Targum says, “and I will cause my glorious Shekinah to dwell in the house of my sanctuary, and the strength of the arm of my power shall be as a wall of fire round about it,”

— because of the army, because of him that passed by, and because of him that returned, enemies marching to and fro, looking for an opportunity to attack; in the times of the Ptolemies and Seleucidae, the kings of Egypt and Syria during whose commotions, their passing to and fro against each other and against them, were still continuing through numerous years;

— and no oppressor shall pass through them any more, no enemy daring to disturb the Lord’s people, his holy Kingdom; for now have I seen with my eyes, he was exercising his providential control and the power of his mercy.

9 Rejoice greatly, O daughter of Zion! Shout, O daughter of Jerusalem! Behold, thy King cometh unto thee! He is just and having salvation, lowly, and riding upon an ass and upon a colt, the foal of an ass.

— rejoice greatly, 0 daughter of Zion! the members of the Lord’s people; shout, O daughter of Jerusalem! with a shout of gladness. Behold, thy King cometh unto thee, the Messiah himself appearing in her midst;

— he is just, possessing righteousness as the first requisite of a true ruler, and having salvation, bearing the salvation which the Lord had planned, lowly, and riding upon an ass and upon a colt, the foal of an ass; this passage is quoted by Matthew 21:4, and John 12:15, as having been fulfilled when the Lord entered Jerusalem on the tenth of Nisan before Passover;

10 And I will cut off the chariot from Ephraim, and the horse from Jerusalem, and the battle bow shall be cut off; and He shall speak peace unto the heathen, and His dominion shall be from sea even to sea, and from the river even to the ends of the earth.

— and the Lord will cut off the chariot from Ephraim and the horse from Jerusalem; and the battle-bow shall be cut off; the Targum paraphrases it, “I will break the strength of those that make war, the armies of the people,” for the Lord does not build his kingdom with might of arms, but of peace;

— and he shall speak peace unto the nations, this being the gist of his Kingdom; and his dominion shall be from sea even to sea and from the river, the Euphrates, as the extreme eastern boundary of the then known world even to the ends of the earth, that is, the Kingdom of God would be established throughout the earth; it would be a universal kingdom.

11 As for thee also, by the blood of thy covenant, I have sent forth thy prisoners out of the pit wherein is no water. — as for thee also so the Lord addresses the entire nation of his people which afterward in the ideal sense merged into his Kingdom by the blood of thy covenant on account of the blood of the covenant, Exodus 24:8,

— by which Israel was separated from the rest of the nations and accepted into the most intimate fellowship with the Lord, for he has sent forth thy prisoners out of the pit where there is no water, delivering them from the oppression of the world-power from all the hostile forces of the earth.

12 Turn you to the stronghold, ye prisoners of hope; even today do I declare that I will render double unto thee, — turn you, or “return,” to the stronghold, the fortified city in opposition to the pit which had just been mentioned;

— ye prisoners of hope, that is, who in spite of afflictions, maintain hope in God; “that hope for redemption” as the Targum paraphrases it; even today do God declare that he will render double unto thee, namely, a double measure of glory instead of the tribulations endured.

13 when I have bent Judah for Me, filled the bow with Ephraim, and raised up thy sons, O Zion, against thy sons, O Greece, and made thee as the sword of a mighty man.

— when the Lord has bent Judah as a bow in his hand, filled the bow with Ephraim, as the arrows in his hand, and raised up thy sons, O Zion, stirring them up for war,

— against thy sons, O Greece, for here was another world-power with its hostility against the people of the Lord, and made thee as the sword of a mighty man, so that the Lord’s people are able to wage the Lord’s wars.

14 And the Lord shall be seen over them, and his arrow shall go forth as the lightning; and the Lord God shall blow the trumpet, and shall go with whirlwinds of the south.

— and the Lord shall be seen over them, appearing above them or at their head, as he who fights from heaven on their behalf, and his arrow shall go forth as the lightning, bringing instantaneous destruction to his foes;

— and the Lord God shall blow the trumpet, summoning his people to the attack, and shall go with whirlwinds of the South, which were always the most violent of all;

— Q, Could this “whirlwinds of the South” be referring to a parable in Ezekiel 20:45-40 and 21:1-5?

Ezekiel 20:45 Moreover the word of the Lord came unto me, saying,
46 “Son of man, set thy face toward the South, and drop thy word toward the South, and prophesy against the forest of the Southland.
47 And say to the forest of the South: ‘Hear the word of the Lord. Thus saith the Lord God: Behold, I will kindle a fire in thee, and it shall devour every green tree in thee and every dry tree. The flaming flame shall not be quenched, and all faces from the South to the North shall be burned therein.
48 And all flesh shall see that I, the Lord, have kindled it; it shall not be quenched.’”
49 Then said I, “Ah, Lord God! They say of me, ‘Doth he not speak parables?’”
Ezekiel 21:1 And the word of the Lord came unto me, saying,
2 “Son of man, set thy face toward Jerusalem, and drop thy word toward the holy places, and prophesy against the land of Israel;
3 and say to the land of Israel, ‘Thus saith the Lord: Behold, I am against thee, and will draw forth My Sword out of his sheath and will cut off from thee the righteous and the wicked.
4 Seeing then that I will cut off from thee the righteous and the wicked, therefore shall My Sword go forth out of his sheath against all flesh from the South to the North,
5 that all flesh may know that I, the Lord, have drawn forth My Sword out of his sheath. It shall not return any more.’

The Scriptures above are shrouded in coded language or hidden in a parable, and so the Q is: how would such scenarios be played out?

For more about a prophecy of Esau or Edom, see Obadiah

For more on the enemy from the South, see A Sword from the South!

15 The Lord of hosts shall defend them, and they shall devour and subdue with slingstones; and they shall drink and make a noise as through wine, and they shall be filled like bowls, and as the corners of the altar.

— the Lord of hosts shall be acting as their Shield against the weapons of the enemy; and they shall devour and subdue with sling-stones, treading down the enemy like pebbles of the brook, Cf Numbers 23:24;

— and they shall drink, consuming the blood of the enemies, and make a noise as through wine, noisy as though under the influence of wine; and they shall be filled like bowls, the vessels in which the priests caught the blood of the sacrifices, and as the corners of the altar.

16 And the Lord their God shall save them in that day, as the flock of His people; for they shall be as the stones of a crown, lifted up as an ensign upon His land.

— and the Lord, their God, shall save them in that day as the flock of his sheep, with the deliverance of the Messiah’s redemption; for they shall be as the stones of a crown, lifted up as an ensign upon his land, Zion’s sons and daughters being like jewels of a crown which sparkles over the Lord’s land as he proudly marches through the territory belonging to him.

17 For how great is their goodness, and how great is their beauty! Corn shall make the young men cheerful, and new wine the maids.

— for how great is their goodness, and how great is their beauty! Cf Psalms 45:3. Corn shall make the young men cheerful and new wine the maids, the reference being to the blessings of God as bestowed upon his people through the Word.

Zechariah 10

1 Ask ye of the Lord rain in the time of the latter rain; so the Lord shall make bright clouds, and give them showers of rain, to every one grass in the field. — ask ye of the Lord rain in the time of the latter rain, that is, the latter rain in its due time,

— there was the former spring and the latter autumn rain, of which see Hosea 6:3. making their appeal to him in all confidence as they were in need of his blessings;

— so the Lord shall make bright clouds, create lightnings and give them showers of rain, in a refreshing thunder-shower to every one grass in the field, all the crops of the field.

2 For the idols have spoken vanity, and the diviners have seen a lie and have told false dreams. They comfort in vain; therefore they went their way as a flock; they were troubled, because there were no shepherd.

— for the idols, to whom the children of Israel had formerly applied for help, have spoken vanity, their household oracles not being dependable, and the diviners have seen a lie, they have announced deceitful oracles;

— and have told false dreams, proclaiming their own inventions as revelations from above; they comfort in vain because their words are a hollow mockery; therefore they, the people who relied upon their words went their way as a flock, wandering astray, they were troubled because there were no shepherd, no reliable leader and guide; the Targum says, “they are scattered as sheep are scattered.”

3 “Mine anger was kindled against the shepherds, and I punished the goats; for the Lord of hosts hath visited His flock, the house of Judah, and hath made them as His goodly horse in the battle. — my anger was kindled against the shepherds, the rulers of Israel to whom he had entrusted the leadership;

— and the Lord punished the goats, visiting them with a severe punishment; they were not the Seleucidae, nor the successors of Alexander, signified by the he goat in Daniel 8:5 but rather the monks and friars, comparable to these for their filthiness and uncleanness; and because they pretend to be guides of the people, and yet use them ill and push them with their horns of power; wherefore God will punish them, and kill those children of Jezebel with death, Revelation 2:22;

— for the Lord of hosts hath visited his flock, the house of Judah, this denotes that the Jews, when converted, looking after them with tender care, and hath made them as his horse in the battle, like the glorious charger on which the general leads his troops to battle.

4 Out of him came forth the corner, out of him the nail, out of him the battle bow, out of him every oppressor together. — out of him, namely, Yehovah, came forth the corner,

— that is, “cornerstone” by which is meant a king or ruler, the corner-stone on which the entire building of the new Kingdom rests; out of him the nail; the Targum says, “out of him his Messiah” the pegs of the wall, from which the household utensils were suspended, types of the dependable men in a state;

— out of him the battle-bow, the means for carrying on the Lord’s wars; Christ makes war in righteousness; the armies of heaven follow him; out of him every oppressor together, every mighty ruler whom Judah would need in its wars against the enemies.

5 And they shall be as mighty men, who tread down their enemies in the mire of the streets in the battle; and they shall fight because the Lord is with them, and the riders on horses shall be confounded.

— and they, the Lord’s people, shall be as mighty men, which tread down their enemies in the mire of the streets, Cf Zechariah 9:15, in the battle; and they shall fight because the Lord is with them, always in the majority because of his help, and the riders on horses shall be confounded, cavalry being mentioned as the chief part of the enemy’s army.

6 “And I will strengthen the house of Judah, and I will save the house of Joseph, and I will bring them back to place them, for I have mercy upon them. And they shall be as though I had not cast them off, for I am the Lord their God and will hear them.

— and the Lord will strengthen the house of Judah, and he will save the house of Joseph, the southern and the northern kingdom together being typical of the Kingdom of God;

— and the Lord will bring them again to place them; there is but one word in the original text; it is composed of two words, of שוב, “to return,” and ישב “to sit” or “dwell” quietly, constantly and at ease; and the meaning is that these people, the full house of Jacob, should be returned from the state and condition and from each of the places they are in and be settled either in their own land, letting them dwell in safety;

— for the Lord has mercy upon them, his mercy is the one reason for his kindness toward them; and they shall be as though he had not cast them off, as in the time before the captivity; for he is the Lord, their God, and will hear them, they could be sure of his gracious attention to all their needs; the Targum says, “and I will receive their prayer.”

7 And they of Ephraim shall be like a mighty man, and their heart shall rejoice as through wine; yea, their children shall see it and be glad; their heart shall rejoice in the Lord.

— and they of Ephraim, the descendants of Joseph, the spiritual children of him who was given the right of the first-born in the house of Jacob, shall be like a mighty man, like a hero;

— and their heart shall rejoice as through wine, with a fierce exultation; yea, their children shall see it and be glad, a fact which indicates that the joy would be lasting; their heart shall rejoice in the Lord, giving all honor to Him who granted them such a glorious victory; the Targum says, “their heart shall rejoice in the word of the Lord.”

8 “I will whistle for them and gather them, for I have redeemed them; and they shall increase as they have increased. — the Lord will hiss for them, or “whistle for them” as a signal for them to assemble and gather them,

— for the Lord has redeemed them, both by entering into a covenant with them and by promising them the Redeemer; and they shall increase as they have increased, that is, the growth of the people of God in the Millennium would be like that of Israel when it first came to the Promised Land.

9 And I will sow them among the people, and they shall remember Me in far countries; and they shall live with their children and turn again.

— and the Lord will sow them among the people, as a token of their quick increase; and they shall remember me in in their scattered countries around the globe, wherever the children of Israel could be found;

— and they shall live with their children, enjoying the blessing of the Lord in a permanent flow of blessings, and turn again, returning to the fellowship of the Lord in His Kingdom.

10 I will bring them back also out of the land of Egypt, and gather them out of Assyria; and I will bring them into the land of Gilead and Lebanon, and a place shall not be found for them.

— the Lord will bring them again also out of the land of Egypt and gather them out of Assyria, the two world-powers being named as representative of two empires that have held the house of Israel in captivity as their enemies and oppressors;

— and the Lord will bring them into the land of Gilead, a land of green pastures, beside the still waters and Lebanon, a land of goodly mountain and hill of frankincense, and where cedars grew, to occupy the land on both sides of Jordan once more; and place shall not be found for them, there will not be sufficient room for them to expand, the number of the spiritual children of Israel being so great.

11 And He shall pass through the sea with affliction, and shall smite the waves in the sea, and all the deeps of the river shall dry up; and the pride of Assyria shall be brought down, and the scepter of Egypt shall depart away.

— and he shall pass through the sea with affliction, rather, “of distress,” in allusion to the affliction felt by the children of Israel when they passed through the Red Sea, and shall smite the waves in the sea, keeping them under control by His powerful word;

— and all the deeps of the river shall dry up, both the Nile (see also Isaiah 19:5 and Ezekiel 30:12), and the river Euphrates: Revelation 16:12 the drying up of which signifies the destruction of both the Egyptian and the Persian empires; and the Targum paraphrases it, “all the kings of the people shall be confounded.”

— and the pride of Assyria shall be brought down; the pride of the Ottoman empire, of which the old Assyria is a part, and which has been large and powerful, that shall be destroyed; and the scepter of Egypt shall depart away so that none of the former oppressors would remain.

12 And I will strengthen them in the Lord; and they shall walk up and down in His name,” saith the Lord.

— and the Lord will strengthen them in their faith in the Lord, their covenant and commitment with him, and they shall walk up and down in his name, so that they would live under his protection and in accordance with his will:

— those that are written, those that are spoken and even those that are unspoken. The entire connection brings out the characteristics of the Kingdom of God in the Millennium, whose members form a royal priesthood and find delight in walking in the ways of the Lord.

Sy Hersh: Ukraine Weapons End Up on Black Market

•April 27, 2023 • Leave a Comment

Sy Hersh: West Knows Ukraine Weapons End Up on Black Market

Sputnik International by Oleg Burunov • April 24, 2023

Western countries’ weapon supplies to Ukraine show no sign of abating, with Russia warning that such deliveries will only prolong the conflict.

The West knows the weapons they deliver to Ukraine are being sold on the black market, something mainstream media has tried to hush up, US investigative journalist Seymour “Sy” Hersh has told Russian media.

He said that he had not written about the topic but he “obviously heard about it.”

Hersh added that “very early, Poland, Romania, [and] other countries on the border were being flooded with weapons we’d been shipping for the war to Ukraine,” where the Russian special military operation is underway.

American hand held stinger missiles

“In other words, commanders of various […] levels – often they were generals or colonels and others – were given with shipments of some weapons [and] personally [they] re-sold or retailed them back to the black or dark market,” the Pulitzer Prize-winner stressed.

According to the journalist, the weapons included “hand missile guns” designed to down a warplane flying “at a considerable height.”

“There was a lot of concern about that and one time about six months ago, maybe more, CBS [News] wrote a story about it that they were forced to retract,” Hersh added.

He spoke after Russian Ambassador to the US Anatoly Antonov told reporters that Moscow has “serious concerns” that part of US military supplies to Ukraine will end up on the black market.

“Where will weapons pop up? Who will bear responsibility when the materiel falls into the hands of some terrorist groups and criminal organizations?” Antonov said, adding that such a policy jeopardizes the security of the entire Europe and increases the risk of a direct clash between Russia and NATO.

4 Stinger missiles on a Dutch Army Fennek reconnaissance vehicle

He was echoed by Russian Defense Minister Sergey Shoigu who said that part of the weapons supplied by the West to Ukraine are already spreading across the Middle East region.

Denis Pushilin, acting head of the Donetsk People’s Republic (DPR), which became part of Russia last year, likewise told Sputnik that foreign weapons being supplied to Ukraine, including the Javelin anti-tank systems, are now being sold on the black market. He added that “this kind of weaponry is being moved in large quantities to African [South American] countries, too.”

“And they shall come against thee with chariots, wagons, and wheels, and with an assembly of people, who shall set against thee buckler and shield and helmet roundabout; and I will set judgement before them, and they shall judge thee according to their judgements.

“And I will set My jealousy against thee, and they shall deal furiously with thee. They shall take away thy nose and thine ears, and thy remnant shall fall by the sword. They shall take thy sons and thy daughters, and thy residue shall be devoured by the fire” Ezekiel 23:24-25

Zechariah (Ch 7-8)

•April 26, 2023 • Leave a Comment

Surprisingly, there are unspoken Will of God existing today! Like parents, God have their secret wishes for their children. So God sometimes has human characteristics.

But how do we know God’s unspoken Will if they were unspoken? To be unspoken would also mean unwritten, so what are they? Do they really exist?

The 9th of Av: destruction of First and Second Temple, God’s dwelling place on earth!

Zechariah 7

1 And it came to pass in the fourth year of King Darius that the word of the Lord came unto Zechariah, in the fourth day of the ninth month, even in Chisleu,

— and it came to pass in the fourth year of King Darius, in the year 518 BC that the word of the Lord, by special inspiration, came unto Zechariah in the fourth day of the ninth month, in Chisleu, the ninth month of the Jewish ecclesiastical year;

— the year 518 BC is two years after the foundation of the Temple was laid, Haggai 2:10 and nearly two years before it was finished, Ezra 6:15 when the work was going forward, and there was a great deal of reason to believe it would be completed;

2 when they had sent Sherezer and Regemmelech and their men unto the house of God to pray before the Lord,

— when they send righteous Jews with Chaldean names Sherezer and Regemmelech and other men to pray before the Lord, they prayed in their half completed Temple, that is, by the returning exiles of Judea, these are first ones evidently having been born in exile and still bearing their strange names, to entreat Yehovah, literally, “to conciliate by caresses,”

3 and to speak unto the priests who were in the house of the Lord of hosts, and to the prophets, saying, “Should I weep (mourn and fast) in the fifth month, separating myself as I have done these so many years?”

— and to speak unto the priests who ministered the sanctuary as the Targum explains it, who offered sacrifices and who were still to be consulted in matters of religion, Malachi 2:7;

— and to the prophets, also servants of the true God in the more specific sense, saying, Should I mourn and fast in the fifth month, the month Ab: II Kings 25:8, the Temple was burnt by the Chaldeans; and according to Jeremiah 3:12, it was on the tenth of this month which day was kept by the Jews as a day of fasting and humiliation in commemoration of it;

— as I have done these so many years? for this fast had become a custom since the Babylonian captivity; and now that the Jews were once more living in Palestine, this question was asked because of its importance for all the Jews, both at home and abroad.

4 Then came the word of the Lord of hosts unto me, saying,

5 “Speak unto all the people of the land, and to the priests, saying, ‘When ye fasted and mourned in the fifth and seventh month even those seventy years, did ye fast at all unto Me, even to Me?

— speak unto all the people of the land and to the priests; his message concerning them all, saying, When ye fasted and mourned in the fifth and seventh month, the latter observation being in memory of the murder of Gedaliah, Cf Jeremiah 41;

— fifth month: 9th of Av, the destruction of the Temple, God’s dwelling place on earth; Exodus 25:8; God does want to be just the God who exists in the heavens, he is the God who wants to come down to dwell among men, in his Sanctuary; he wants to be with us but his dwelling place was destroyed;

— seventh month: 3rd of Tishri; when Gedaliah was assassinated; although Gedaliah was appointed by Nebuchadnezzar, this Babylon king was just an instrument in God’s hand; Jerusalem being his holy city and Judae being his holy land; allowing a Jewish Governor to rule over the land despite the majority of the people going into captivity;

— even those seventy years, during the entire captivity, did ye at all fast unto me, even to me? Had it really been done in God’s honor, for the purpose of serving him: Feeling the same pain as he has? Sympathy with him for not having a home with us on earth? Or an feeling that his holy land was in ruin and under the control of the heathens? (for more on this, see the Unspoken Will of God)

6 And when ye ate and when ye drank, did not ye eat for yourselves and drink for yourselves? — did not ye eat for yourselves and drink for yourselves? asked the Lord;

— is it merely for your own refreshment and pleasure, and not for the glory of God; though that ought to be the principal end in eating and drinking, 1 Corinthians 10:31.

7 Should ye not hear the words which the Lord hath cried by the former prophets, when Jerusalem was inhabited and in prosperity, and the cities thereof round about her, when men inhabited the south and the plain?’”

— should ye not hear the words who hath cried by the former prophets; as Hosea, Isaiah, Jeremiah, and others; suggesting that it would have been much better for them to have regarded the exhortations and instructions which the Lord sent them by his earlier prophets, which would have prevented their captivity; and so would have had no occasion of fasting and mourning;

— when men inhabited the south when Jerusalem and the cities about it were full of people and enjoyed all the blessings of life in great plenty; and similarily with the plain, the land of Judea;

8 And the word of the Lord came unto Zechariah, saying, — and the word of the Lord saying; giving him orders to repeat what the former prophets had said;

9 “Thus speaketh the Lord of hosts, saying, ‘Execute true judgement, and show mercy and compassions every man to his brother.

— thus speaketh the Lord of hosts, rather, “Thus spoke Yehovah,” in addressing the children of Judah in former days, before the exile, saying, Execute true judgement, literally, “judge the judgement of truth,”

— execute true judgement and check that the rich and mighty won’t escape judgement: see the on-going of today’s stories of Jeffrey Epstein, Virginia Giuffre, Ghislaine Maxwell, UK royal Prince Andrew with protection from Royalty; and those hovering around in Epstein’s private airplane: ex presidents Clinton and Trump; how are they going to face judgement from God?

— and show mercy and compassions every man his brother, those in poverty, the homeless, those in want of food, raiment or in whatsoever distress, whether of body or mind; so that kindness, mercy and compassion should be practiced at all times, Isaiah 58:6-7; Jeremiah 7:28;

10 And oppress not the widow nor the fatherless, the stranger, nor the poor; and let none of you imagine evil against his brother in your heart.’ — and oppress not the widow nor the fatherless, the orphans, the stranger nor the poor, these four classes ever being in the care of the Lord, Isaiah 1:17; Jeremiah 5:28;

— and let none of you imagine evil against his brother in your heart; thoughts of evil are sinful, and forbidden by the law of God, as well as actions, which agrees with our Lord’s sense of the law,

11 But they refused to hearken, and pulled away the shoulder, and stopped their ears, that they should not hear.

— but they refused to hearken, they were consistently rebellious, and pulled away the shoulder, like an ox who refuses to accept the yoke on his neck, and stopped their ears, Cf Isaiah 6:10, that they should not hear, like a backsliding heifer or a deaf adder.

12 Yea, they made their hearts as an adamant stone, lest they should hear the law and the words which the Lord of hosts hath sent in His Spirit by the former prophets. Therefore came a great wrath from the Lord of hosts.

— yea, they made their hearts as an adamant stone, like the hardest stone, impervious to every impression from without;

— lest they should hear the Law, the books of Moses, and the words which the Lord of hosts hath sent in his spirit, inspired by his spirit, by the former prophets, who were the instruments of God in making known his will; therefore came a great wrath from the Lord of hosts as shown in the captivity of Judah.

13 “Therefore it has come to pass that as He cried and they would not hear, so they cried and I would not hear,” saith the Lord of hosts.

— therefore it is come to pass, the Lord by the former prophets called them to repentance and obedience: that as God cried, in the exhortations of his prophets, and they would not hear, so when they called and cried when in trouble, now it was God’s turn not to hear, saith the Lord of hosts;

14 “But I scattered them with a whirlwind among all the nations whom they knew not. Thus the land was desolate after them, that no man passed through nor returned; for they laid the pleasant land desolate.”

— so I scattered them with a whirlwind, denoting the fierceness of his wrath, and the strength of his fury, among all the nations whom they knew not, strange to them in language, customs and religion;

— thus the land was desolate after them that no man passed through nor returned, all of Judea practically being a wilderness; especially after the Jews were carried captive into Babylon; for the rest, after the death of Gedaliah, fled into Egypt: for they laid the pleasant land desolate,

— the children of Judah themselves being to blame for the desolation which came upon the land, a land flowing with milk and honey; but later they received the just punishment of their sins, their land became desolate: they have but themselves to blame for their afflictions, though their pride would attempt to deny it;

— “scattered them . . . among all the nations” Judah was scattered only to Babylon, but this captivity together with Israel, is going to be like a whirlwind among all the nations “whom they knew not,” hence this is prophetic for the endtime, in our time.

“But I scattered them with a whirlwind among all the nations”

Zechariah 8

1 Again the word of the Lord of hosts came to me, saying, — the phrase, “to me” is not in the Hebrew text; but is implied there as the Masora observes; and undoubtedly it is to be understood; as it is by the Targum, “with me.”

2 “Thus saith the Lord of hosts: ‘I was jealous for Zion with great jealousy, and I was jealous for her with great fury.’

— thus saith the Lord of hosts, I was jealous for Zion with great jealousy “for Jerusalem and for Zion” as in Zechariah 1:14; I am jealous in a most vehement affection toward Jerusalem as in Zion.

Flashing Forward

3 “Thus saith the Lord: ‘I am returned unto Zion, and will dwell in the midst of Jerusalem; and Jerusalem shall be called a city of truth, and the mountain of the Lord of hosts, the Holy Mountain.’

— thus saith the Lord, I am returned unto Zion or as the Targum renders it, “I will return to Zion” once more occupying the dwelling-place of his honor in the midst of his people, which he had forsaken because of the wickedness of the idolatrous nation;

— and Jerusalem shall be called a city of truth, where the Lord’s truth is, the truth of his eternal Word, would once more be found; where his Temple stood, the holy mountain because it is the center of the true worship of God;

— the mountain of the Lord of hosts; which will be established upon the top of the mountains, Isaiah 2:2; and where the Lord will be seen and exalted in his glory, even the Lamb, with the hundred and forty four thousand with him.

4 “Thus saith the Lord of hosts: ‘There shall yet old men and old women dwell in the streets of Jerusalem, and every man with his staff in his hand because of great age.

— thus saith the Lord of hosts, there shall yet old men and old women dwell in the streets of Jerusalem, since they would not be torn away in the fullness of their strength by war and pestilence, and every man with his staff in his hand for very age, literally, “because of the multitude of his days.”

5 And the streets of the city shall be full of boys and girls playing in the streets thereof.’ — without any fear of any enemy, the streets of the city shall be full of boys and girls playing in the streets thereof;

— it is a beautiful picture representing the extremes of life dwelling in all security and happiness in the midst of the Holy City, the blessings of the Messianic Age.

6 “Thus saith the Lord of hosts: ‘If it be marvelous in the eyes of the remnant of this people in these days, should it also be marvelous in Mine eyes?’ saith the Lord of hosts.

— thus saith the Lord of hosts, If it be marvelous in the eyes of the remnant of this people in these days, in the eyes of those who had returned from captivity, should it also be marvelous in the eyes of the Lord.

7 “Thus saith the Lord of hosts: ‘Behold, I will save My people from the east country and from the west country;

— thus saith the Lord of hosts, Behold, I will save my people from the East country, from the rising of the sun, and from the West country, from the setting of the sun, so that Yehovah would rescue his people from all lands, as far as the sun shines;

After the Babylonian captivity, the Return was only from the East, but this includes the West, thus the Return must be prophetic for the endtime;

8 and I will bring them, and they shall dwell in the midst of Jerusalem. And they shall be My people and I will be their God, in truth and in righteousness.’

— and I will bring them and they shall dwell in the midst of Jerusalem; and they shall be my people and I will be their God, in truth and in righteousness. This is truly the glory of the Millennium when as John writes, we saw his glory, the glory as of the begotten Son and the Father.

9 “Thus saith the Lord of hosts: ‘Let your hands be strong, ye that hear in these days these words by the mouth of the prophets, who were in the day that the foundation of the house of the Lord of hosts was laid, that the temple might be built.

— thus saith the Lord of hosts, Let your hands be strong, full of good courage for doing the work of the Lord ye that hear in these days these words by the mouth of the prophets, namely, Haggai and Zechariah;

— which were in the day that the foundation of the house of the Lord of hosts was laid, that the Temple might be built. These prophets had begun their activity at the time when the foundation of the second Temple had already been built, hence this could be referenced the Ezekiel Temple among the returning exiles.

10 For before these days there was no hire for man nor any hire for beast, neither was there any peace for him that went out or came in because of the affliction; for I set all men, every one, against his neighbor.

— for before these days there was no hire for man nor any hire for beast, for the yield of the land at that time was so small as hardly to be called fair wages, Haggai 1:6-11;

— neither was there any peace to him that went out or came in because of the affliction, there was so much envy and hostility among the people themselves, and on account of jealousy stirred up by the Samaritans, that the ordinary life were continually being interfered with; for I set all men every one against his neighbor, as the account of Nehemiah shows.

11 But now I will not be unto the residue of this people as in the former days,’ saith the Lord of hosts. — but now, since their relationship was restored,

— the Lord will not be unto the residue of this people, to the small congregation which had returned from Babylon as in the former days, saith the Lord of hosts, being ready once more to gladden them with the rich blessings of His goodness and mercy.

12 ‘For the seed shall be prosperous; the vine shall give her fruit, and the ground shall give her increase, and the heavens shall give their dew; and I will cause the remnant of this people to possess all these things.

— for the seed shall be prosperous, or “there shall be a seed of peace” the vine shall give her fruit, and the ground shall give her increase, all crops showing great productivity;

— and the heavens shall give their dew, affording the necessary moisture to secure growth; and I will cause the remnant of this people to possess all these things, these being evidences of His goodness.

13 And it shall come to pass that as ye were a curse among the heathen, O house of Judah and house of Israel, so will I save you, and ye shall be a blessing. Fear not, but let your hands be strong.’ — note; the house of Israel included;

— and it shall come to pass that as ye were a curse among the nations, 0 house of Judah and house of Israel, Jeremiah 42:18, so will I save you and ye shall be a blessing, an example of God’s blessings of mercy. Fear not, but let your hands be strong.

14 “For thus saith the Lord of hosts: ‘As I thought to punish you when your fathers provoked Me to wrath,’ saith the Lord of hosts, ‘and I repented not,

— for thus saith the Lord of hosts, As I thought to punish you when your fathers provoked me to wrath, Jeremiah 31:28, and he could not, in point of fact, without denying his own holiness, fail to execute his judgement,

15 so again have I thought in these days to do well unto Jerusalem and to the house of Judah. Fear ye not.

— so again have I thought in these days, now that the covenant relation was once more established with Jerusalem and the house of Judah. Fear ye not, since God is gracious for the sake of the Messiah, therefore the men of Judah have no reason to fear as long as they put their trust in him.

16 These are the things that ye shall do: Speak ye every man the truth to his neighbor; execute the judgement of truth and peace in your gates;

— these are the things that ye shall do, as an evidence of the new relation which obtained between them and the God of the covenant, Speak ye every man the truth to his neighbor. In your gates so that all their dealings, particularly those pertaining to their courts of law, would be in agreement with God’s laws and principles,

17 and let none of you imagine evil in your hearts against his neighbor; and love no false oath. For all these are things that I hate,’ saith the Lord.”

— and let none of you imagine evil In your hearts against his neighbor, deliberately planning harm and love no false oath, for perjury makes the administration of justice impossible;

— for all these are things that the Lord hates. It is a most emphatic declaration, spoken with great solemnity and it holds true for all time. God hates and despises wickedness in every form and he wants those who are his children to wage continual warfare against every transgression of his Laws and Judgements.

18 And the word of the Lord of hosts came unto me, saying,

19 “Thus saith the Lord of hosts: ‘The fast of the fourth month, and the fast of the fifth, and the fast of the seventh, and the fast of the tenth, shall be to the house of Judah joy and gladness and cheerful feasts. Therefore love the truth and peace.’

— thus saith the Lord of hosts, The fast of the fourth month and the fast of the fifth and the fast of the seventh and the fast of the tenth, special days of fasting and affliction which the Jews had observed during their captivity in memory of certain dark days in the history of their nation, Cf Zechariah 7:3;

— shall be to the house of Judah joy and gladness and cheerful feasts, of highest happiness, but why? They are not commended fasts? Why would they burst out with joy and gladness?

(1) the fast of the fourth month: 17th of Tammuz; Jeremiah 52:6-30 the breaching of the walls of Jerusalem before its fall in 587 BC and in 70 AD (July 6, 2023)

(2) the fast of the fifth month: 9th of Av; II Kings 25:2-10 the destruction of the First Temple in 586 BC; the Second Temple in 70 AD on the same dates (July 27, 2023)

(3) the fast of the seventh month: 3rd of Tishri; Jeremiah 41 when Gedaliah was assassinated in 582/1 BC (September 18, 2023)

(4) the fast of the tenth month: 10th of Teveth; II Kings 25:1 the siege of Jerusalem by Nebuchadnezzar II of Babylon in 586 BC (December 22, 2023)

— those who keep those fasts above will burst out with “joy and gladness and cheerful feasts!”

— as to a hint of why these fasts are instituted, the Lord of Hosts asks,

“Speak unto all the people of the land, and to the priests, saying, ‘When ye fasted and mourned in the fifth and seventh month even those seventy years, did ye fast at all unto Me, even to Me?” Zechariah 7:5

For more on understanding such joy and blessings, and those who love the truth and peaces, see the Unspoken Will of God

20 Thus saith the Lord of hosts: ‘It shall yet come to pass that there shall come people and the inhabitants of many cities.

— thus saith the Lord of hosts, It shall yet come to pass that there shall come people, representatives of all nations and the inhabitants of many cities, of the foremost centers of the world;

21 And the inhabitants of one city shall go to another, saying, “Let us go speedily to pray before the Lord, and to seek the Lord of hosts. I will go also.”

— and the inhabitants of one city shall go to another in mutually encouraging and admonishing one another, saying, Let us go speedily, literally, “Going let us go, with speed and earnestness,”

— all nations to pray before the Lord and to seek the Lord of hosts in an invitation and exhortation to worship the one true God; I will go also, the vivid form of speech showing the alacrity with which men would respond.

22 Yea, many people and strong nations shall come to seek the Lord of hosts in Jerusalem, and to pray before the Lord.’

— yea, many people and strong nations, the foremost countries of the world shall come to seek the Lord of hosts in Jerusalem to become members of his holy congregation and to pray before the Lord, to worship Yehovah.

23 “Thus saith the Lord of hosts: ‘In those days it shall come to pass that ten men out of all the languages of the nations shall take hold, even shall take hold of the skirt of him that is a Jew, saying, “We will go with you, for we have heard that God is with you.”’”

— thus saith the Lord of hosts, In those days it shall come to pass that ten men shall take hold out of all languages of the nations, that is, men of all different nations, speaking so numerous tongues, even shall take hold of the skirt of him that is a Jew, in great eagerness;

— saying, We will go with you, casting their lot with the people of the Lord in every way, for we have heard that God is with you. This has been fortasted during the New Testament era, when people from various nations have actually come and begged Christian missionaries to come to them and preach the Kingdom of God. The glorious conversion of all nations in the age of the Millennium is here clearly foretold, and in a most graphic manner.

For more about the Calendar, see Is there a Calendar Omen?

For more details, see An Autopsy of JERUSALEM in the AD 70 INFERNO

Russia To Give N Korea Advanced Weapons If

•April 25, 2023 • Leave a Comment

“Don’t pick up the phone” might not be a formal agenda during meetings for the next Brics+ conference in South Africa comes August, 2023; but surely it will be a hot topic during coffee breaks! “So that you won’t be shouted down!”

Now, Russia Threatens To Give North Korea Advanced Weapons If Seoul Arms Ukraine

ZeroHedge by Tyler Durden • April 20, 2023

Former Russian President and current Deputy Chairman of the Security Council Dmitry Medvedev has threatened that the Kremlin could give advanced weapons to North Korea if South Korea moves to send military aid to Ukraine.

This comes in response to South Korean President Yoon Suk-yeol floating the possibility of a drastic policy shift. He’ll travel to the United States next week for an official visit. He said in a Reuters interview published Wednesday, “If there is a situation the international community cannot condone, such as any large-scale attack on civilians, massacre or serious violation of the laws of war, it might be difficult for us to insist only on humanitarian or financial support.”

“I believe there won’t be limitations to the extent of the support to defend and restore a country that’s been illegally invaded both under international and domestic law,” Yoon explained. “Considering our relationship with the parties engaged in the war and developments in the battlefield, we will take the most appropriate measures,” he added.

As Reuters notes, “It was the first time that Seoul suggested a willingness to provide weapons to Ukraine, more than a year after ruling out the possibility of lethal aid.”

Last year, US officials and Western media made accusations that North Korea was supplying Russia with artillery ammo and other defense items.

But if Russia actually gave advanced weapons to Pyongyang and the Kim Jong-Un regime, Washington would go ballistic, particularly at this sensitive moment of heightened tensions following repeat missile tests by the north.

But Medvedev is threatening just that, according to Russian media:

“I wonder what the residents of this nation would say when they see the newest example of Russian weapons in possession of their closest neighbors, our partners from the DPRK [Democratic People’s Republic of Korea]?” Medvedev wrote on social media.

The threat certainly ups the ante and is likely to impact Seoul’s decision-making. 

Some South Korean officials have reportedly mulled the possibility of indirectly aiding Ukraine, which would involve making the weapons available to a third-party country which in turn would arm Kiev. Likely this scenario is something the Biden administration would support.

“A third part of thee shall die with the pestilence, and with famine shall they be consumed in the midst of thee; and a third part shall fall by the sword round about thee; and I will scatter a third part into all the winds, and I will draw out a sword after them.” Ezekiel 5:11-12

“And I will show wonders in the heavens and in the earth—blood and fire and columns (pillars) of smoke” Joel 2:30

‘NATO Command Center’ Taken Out in Ukraine?

•April 24, 2023 • Leave a Comment

“Don’t pick up the phone” might not be a formal agenda during meetings for the next Brics+ conference in South Africa comes August, 2023; but surely it will be a hot topic during coffee breaks! “So that you won’t be shouted down!”

For an update and a longer analysis, see Unz Review by Ron Unz • May 8, 2023

Did Russian Kinzhal Missile Take Out ‘NATO Command Center’ in Ukraine? No major news outlets except Newsweek. Weird!

An inset photo of a Russian MiG-31 supersonic interceptor jet carrying a hypersonic Kinzhal (Dagger) missile at speed of Mach 12

Newsweek by Yevgeny Kuklychev • March 31, 2023

A Russian precision strike supposedly destroyed an underground “NATO command center” in Ukraine earlier this month, with “dozens” of Western officers and military personnel purportedly killed in the “Kinzhal” (or “Dagger) missile attack.

At least, that is the claim circulating on some social media channels, including those known for spreading pro-Kremlin talking points and Russian propaganda.

In some cases the claim was supported by a photo of the supposed strike site, showing large-scale devastation and a burned-down building.

But is there any factual basis to the claim? Newsweek Misinformation Watch pulled at the threads—and found that most of the elements and sources contained in the claim do not stand up to scrutiny.

Several Twitter and Telegram posts, totaling hundreds of thousands of views in late March 2023, purported that a NATO HQ in Ukraine was destroyed, with “up to 300 people” killed in the strike.

“A terrifying strike of the Russian supersonic missile ‘Dagger’ at a depth of 130 meters on the NATO command center in Ukraine!”: Greek Pronews writes about the huge losses among NATO officers as a result of the missile attack,” one post read.

“40 corpses, dozens more bodies remain under the rubble – details of the Russian “retaliation strike” on the NATO command center have appeared,” wrote the account named “Russian Victory is Inevitable.”

“Greek media: dozens of NATO officers are buried in a secret bunker destroyed by “Daggers” in Ukraine. According to the Greek portal Pronews, received by the editors from “American sources,” another post said.

MiG-31 supersonic interceptor jet with Kinzhal (Dagger) missile at Mach 12

Most of the posts on Twitter and Telegram appeared to base the claim on one of two sources: An obscure Greek news website ProNews and an outlet called “The Intel Drop.” The trustworthiness of both sources is highly questionable, however.

TheIntelDrop describes itself as “an unaligned news source for the intelligence and financial community,” but the awkward wording, basic grammar mistakes (“oversite”) and strange terminology, such as “black propaganda,” raise suspicions, indicating that it likely was not written by a native English speaker.

Is Ukraine’s army now the best in the world? Major countries compared

READ MORE Is Ukraine’s army now the best in the world? Major countries compared

There is also no information about the news outlet’s background or ownership. All of the website affiliation data has been “redacted for privacy,” according to domain checker WhoIS.

It lists an American conspiracy theorist Gordon Duff among its board members; Duff was previously the chairman of “Veterans Today,” a fringe conspiracy and anti-Semitic outlet. Duff himself said “about 30% of what’s written on Veterans Today, is patently false.”

TheIntelDrop’s report cites a number of unverified Twitter accounts and the ProNews article as its source for the claim.

ProNews did indeed publish such an article, though references to it misleadingly suggest this was a recent development, whereas the article was in fact published earlier this month, on March 12.

MiG-31 carrying a hypersonic Kinzhal (Dagger) missile at Mach 12

Back then the article was picked up and shared by pro-Russian users, including one claiming “NATO command and control HQ in #Kiev was struck by Kinzhal hypersonic missiles, many #Pentagon top officials perish in this strike.”

However, the Greek website, which has a history of publishing sensationalist and misleading material, such as one article claiming that Florida is seceding from the United States, offers very little in the way of evidence in the original story about the supposed strike.

“Dozens of dead NATO and Ukrainian officers,” the article opens, translated from Greek. “Russian hypersonic Kinzhal missile with a target impact speed of Mach 12 (twelve times the speed of sound) managed to hit the Ukrainian-NATO joint command, control and communications center installed at a depth of 130 meters!”

The author simply states: “The Russians say they have pulled 40 dead from the wreckage of the underground headquarters so far, but most will never be recovered as they were buried by the debris.”

No specific sources or outlets are mentioned anywhere in the story, which instead proceeds to quote Ukrainian officials, who make no mention of NATO casualties.

While it is unclear what “Russian” sources ProNews based its reporting on, a large-scale shelling of Ukraine did indeed take place on the night of March 9, 2023, as Newsweek reported at the time.

The attack, which Russia called retaliation for a reported sabotage incident that took place days earlier in Russia’s border region of Bryanks, involved a wide array of Russian missiles, including the aforementioned Kinzhals.

“And they shall come against thee with chariots, wagons, and wheels, and with an assembly of people, who shall set against thee buckler and shield and helmet roundabout; and I will set judgement before them, and they shall judge thee according to their judgements.

“And I will set My jealousy against thee, and they shall deal furiously with thee. They shall take away thy nose and thine ears, and thy remnant shall fall by the sword. They shall take thy sons and thy daughters, and thy residue shall be devoured by the fire” Ezekiel 23:24-25

Zechariah (Ch 5-6)

•April 24, 2023 • Leave a Comment

Zechariah Chapter 5 concerns two visions regarding the cleansing of God’s people; and the message conveyed is cryptic. The first is of a flying scroll, which signifies the curse of God; the other is the vision of an ephah, and a woman sitting in it, and a talent of lead cast upon the mouth of it, which signified wickedness. What do all these symbols mean?

Without the vowels, the consonents for these three words are the same

Second; on reading the passage with its literal meanings, the chapter doesn’t make much sense, but by stretching the meanings slightly, as the flying scroll signifies the curse of God, a warning is being conveyed; perhaps the woman signifies on fire; our modern missiles; the chapter makes more sense: that is, those missiles are loaded with an ephah: or nuclear weapons; and all about our modern warfare with the potential of nuclear bombs devastating the whole world, a coded and hidden warning of a world reaping a curse from God from its own wickedness. Such a new perspective makes more sense.

Zechariah 5: Could the symbolism in Zechariah 5 indicate that there would be nuclear war at the endtime?

Zechariah 5

1 Then I turned, and lifted up mine eyes and looked, and behold, a flying scroll. — after a time interval, Zechariah turned and lifted up his eyes and looked: behold a flying scroll, a book-scroll or parchment of great size or consisting of many large leaves fastened together;

— a parallel scene of a book-scroll of what Ezekiel saw, in Ezekiel 2, “and in it was written lamentations and mourning and woe.”

And I saw, and behold, a hand stretched out to me, and behold, in it was a scroll of a book.
And he spread it out before me, and it was inscribed before and behind, and there was written upon it lamentations and murmuring and woe. Ezekiel 2:9-10

2 And he said unto me, “What seest thou?” And I answered, “I see a flying scroll. The length thereof is twenty cubits and the breadth thereof ten cubits.”

— and the angel said unto Zechariah, What seest thou? And Zechariah answered, I see a flying scroll, a parchment loose or unrolled moving through the air; the length thereof is twenty cubits and the breadth thereof ten cubits, the dimensions approximately ten yards by five yards.

A flying scroll, one side for one who steals, the other side for one who swears

3 Then said he unto me, “This is the curse that goeth forth over the face of the whole earth; for every one who stealeth shall be cut off as on this side according to it, and every one who sweareth shall be cut off as on that side according to it.

— without waiting for a question on the part of the prophet, the angel then said unto Zechariah, This is the curse that goeth forth over the face of the whole earth, as written on the scroll;

— the two sins of theft and false swearing; for whosoever that steal shall be cut off as on this side according to it, and anyone who swears, especially modern politicians, White House officials that had taken a false oath to tell the truth shall be cut off as on that side according to it, that is, the sinners who refuse to repent, who persist in their wickedness, must be cut off and removed;

— the one being against the second, as two categories of curses; show that the curses of the law reaches all sorts of sins and sinners; pretty much similar to what Ezekiel saw: “of written lamentations and mourning and woe.” The message of Ezekiel is primarily a warning to the house of Israel (mentions 169 times); to Ephraim, the chief tribe.

For more, see ‘the US is the true ’empire of lies’ or, Who is Ephraim, a Chronic Liar?

4 ‘I will bring it forth,’ saith the Lord of hosts,‘ and it shall enter into the house of the thief and into the house of him that sweareth falsely by My name. And it shall remain in the midst of his house and shall consume it, with the timber thereof and the stones thereof.’”

— the Lord will bring it forth, namely, the curse and the judgement with it, saith the Lord of hosts, and it shall enter into the house of the thief and into the house of him that sweareth falsely by my name, these two classes of sinners being named as representatives of all unrepentant transgressors;

— and it shall remain in the midst of his house, lodging there, dwelling there permanently, and shall consume it with the timber thereof and the stones thereof, not leaving a vestige of it. These words are properly expressive of the curse and of the punishment of God upon these form of deliberate transgression; which would be like a consuming fire upon anyone and everyone who steal and swear falsely;

Rashi: I have brought it forth: to walk to and fro in the land and to wreak vengeance upon the thieves and the swearers of falsehoods from now on; and it shall come into the house of the thief, etc;

— and a saying goes: “a man that swears much shall be full of iniquity, and the plague shall not depart from his house,” and “if a man swears in vain, he shall not be innocent or justified, for his house shall be full of calamities.”

5 Then the angel who talked with me went forth and said unto me, “Lift up now thine eyes and see what is this that goeth forth.”

— then the angel that talked with Zechariah, and said unto Zechariah, ‘Lift up now thine eyes and see what is this that goeth forth,’ appearing before his eyes, something that Zechariah should observe very closely.

6 And I said, “What is it?” And he said, “This is an ephah that goeth forth.” He said moreover, “This is their resemblance through all the earth.”

— ‘This is an ephah that goeth forth,’ the ephah being a dry measure corresponding roughly to our peck; the object in the vision was evidently a receptacle having the shape of an ephah, and the ephah was chosen because it was often called the measure of unrighteousness and of deceits;

— the angel said, ‘This is their resemblance through all the earth,’ literally, ‘this their eye in all the land,” that is, this is the object of their gaze, all eyes are centered upon it.

7 And behold, there was lifted up a weighty piece of lead, and this is a woman who sitteth in the midst of the ephah. — first appearance of a woman, perhaps a church, one of wickedness, the Roman Church? Or a fire, the afterburner of a missile? the missile being covered by a layer of lead;

— and behold there was lifted up a talent of lead, a great round piece, weighing about a hundred pounds; and this is a woman that sitteth in the midst of the ephah, the female personification of wickedness held within the ephah by the great weight;

The afterburner of a Russian Naval Hypersonic Missile

— is God trying to convey to the people of the endtime, that there would be nuclear weapons carried by missiles caused by cheatings and false swearings that result in “great wickedness”?

8 And he said, “This is wickedness.” And he cast it into the midst of the ephah, and he cast the weight of lead upon the mouth thereof.

— and the angel said, ‘This is wickedness,’ Israel being imbued with false doctrines, and godlessness personified. And the angel cast it into the midst of the ephah, thus preventing her escape; and he cast the weight of lead upon the mouth thereof, this acting as a cover keeping her shut up within the measure.

9 Then I lifted up mine eyes and looked, and behold, there came out two women, and the wind was in their wings (for they had wings like the wings of a stork), and they lifted up the ephah between the earth and the heaven.

— fascinated by a further wonderful thing that happened, then lifted Zechariah up his eyes and behold, there came out two women, and the wind was in their wings, aiding them in their movement forward as they carried the ephah;

— two women appear; perhaps two entities: church and state? Or two missiles?

— for they had wings (missiles) like the wings of a bird; and they lifted up the ephah (with nuclear payload) between the earth and the heaven, carrying missiles or drones flying along quickly, all over the world, between the earth and the first heaven.

10 Then said I to the angel who talked with me, “Whither do these bear the ephah?” — then asked Zechariah the angel who talked with him, “Where do these bear the ephah?”

11 And he said unto me, “To build it a house in the land of Shinar; and it shall be established, and set there upon her own base.” — and the angel said unto Zechariah, ‘To build an house in the land of Shinar,’ typical from olden times as the land of rebellion against the Lord;

— that is, in the province of Babylon, as the Targum paraphrases it; for Babel, or Babylon, was in the land of Shinar; Genesis 11:1-9; and it shall be established and set there upon her own base; representative of the ungodly world, a mystery of iniquity, Revelation 17:5; wickedness was to have its place; a place of wickedness;

— to-day, from a spiritual point of view, Washington DC and New York city could be considered the greatest and most perverted cities in the world, politically (one side of the scroll a warning for those who swears falsely under oath before the Bible upon taking office) and economically (the other side of the scroll meant for those who steals through Wall Street tradings: insider tradings, share manipulations and more);

— and perhaps this reference to Babylon could be meant for these end-time godless cities; that is, either one, or both, of these modern Babylonian metropolises could be destined to be blown up by a nuclear conflagration; verse 3 above indicate both cities destroyed;

— and second, the United States is so far the only country that has used two nuclear weapons against another, perhaps this verse “as you have done, it shall be done to you;” of a prophetic boomerang effect could shed some light that could flared up not just the United States but would even engulf the whole world:

“For the day of the Lord is near upon all the nations. As you have done, it shall be done to you; your dealings will return upon your own head” Obadiah 1:15

— and then appear the four chariots of horses in the next chapter!

Zechariah 6

Four chariots came out from between two mountains: Red, Black, White, Grey

1 And I turned, and lifted up mine eyes and looked, and behold, there came four chariots out from between two mountains, and the mountains were mountains of brass.

— Zechariah lifted up his eyes and looked, there came four chariots out from between two mountains in the mountainous country near Jerusalem, very likely between Mount Zion and the Mount of Olives; and the mountains were mountains of brass, firm and immovable.

2 In the first chariot were red horses, and in the second chariot black horses, — in the first chariot, harnessed to it were red horses; and we would assigned them as signifying war and bloodshed; but the angel never elaborate further what the red horses are;

— Gill says: by these “red horses” must be designed the Babylonians and Chaldeans, so called because their soldiers were clothed in red, and their chariots were like flaming torches;

— red horses may signify bloody times, and for the endtime, a fiery execution of wrath, Revelation 6:4; and in Isaiah 63:1-4: “Who is this that cometh from Edom?”

1 Who is this that cometh from Edom, with dyed garments (with his garments stained crimson in other translations) from Bozrah, this that is glorious in His apparel, traveling in the greatness of his strength? “I that speak in righteousness, mighty to save.”

2 Why art thou red in Thine apparel, and Thy garments like him that treadeth in the wine vat?

3 “I have trodden the wine press alone; and of the people there was none with Me. For I will tread them in Mine anger and trample them in My fury; and their blood shall be sprinkled upon My garments, and I will stain all My raiment.

4 For the day of vengeance is in Mine heart, and the year of My redeemed is come. Isaiah 63:1-4

For more about a prophecy of Esau or Edom, see Obadiah

For more on the enemy from the South, see A Sword from the South!

— and in the second chariot black horses, the color of misfortune, of mourning, and of death;

3 and in the third chariot white horses, and in the fourth chariot grizzled and bay horses. — and in the third chariot white horses, implying Death and Hades; and in the fourth chariot grizzled and bay horses Cf Revelation 6:8;

— a black horses symbolizes famine and carries the scales; and the third white horses ride along with Death, accompanied by Hades;

— a chariot grizzled and bay horses? pestilences, like Covid-19 epidemics of coronal virus which we’re experiencing today; famines, and with hunger, and with death, and with the beasts of the earth;

Compare with Matthew 24:

And ye shall hear of wars and rumors of wars. See that ye be not troubled, for all these things must come to pass, but the end is not yet.

For nation shall rise against nation and kingdom against kingdom, and there shall be famines and pestilences and earthquakes in divers places.

4 Then I answered and said unto the angel who talked with me, “What are these, my lord?” — then Zechariah answered and said unto the angel, What are these?

— my lord (‘āḏôn not Yehovah יְהֹוָה) so the angel appeared as an ordinary angel to Zechariah.

5 And the angel answered and said unto me, “These are the four spirits of the heavens, which go forth from standing before the Lord of all the earth.

— and the angel answered Zechariah, ‘These are the four spirits of the heavens,’ the four winds as the instruments of the Lord’s will, which go forth from standing before the Lord of all the earth. Cf Psalms 104:4; Psalms 148:8. The agency of the winds in the work of destructive judgement is mentioned also elsewhere in the Bible Cf Revelation 7:1.

6 The black horses which are therein go forth into the north country, and the white go forth after them, and the grizzled go forth toward the south country.

— the black chariot horses (mourning, and of death) which are therein, that is, the chariot drawn by these horses, go into the North country, where the great world-powers, Assyria and Babylon; now represented bythe lost-10 tribes at the endtime, were situated;

— and the white chariot horses (Death and Hades) go forth after the North, too, victory following death and destruction; but the grizzled go toward the South country, where Idumea, Edom and Egypt were situated;

— a chariot grizzled horses? pestilences, like Covid-19 epidemics of coronal virus; famines with hunger and death?

7 And the bay went forth and sought to go, that they might walk to and fro through the earth.” And he said, “Get you hence, walk to and fro through the earth.” So they walked to and fro through the earth.

— and from the South the bay spread forth and sought to go that they might walk to and fro throughout the earth, visiting all the countries of the world with terrible wars and bloodshed, with death and destruction; and he said, Get you hence, walk to and fro through the earth. So they walked to and fro through the earth, carrying out the Lord’s command upon the various nations.

8 Then cried he unto me, and spoke unto me, saying, “Behold, these who go toward the north country have quieted my spirit in the north country.”

— then cried the angel in great excitement to Zechariah and spoke unto him, Behold, these that go toward the North, and after executing God’s judgement on them, have quieted my Spirit in the North and was satisfied with the extent of the punishment inflicted upon them.

9 And the word of the Lord came unto me, saying,

10 “Take from them of the captivity — even from Heldai, from Tobijah, and from Jedaiah, who have come from Babylon — and come thou the same day and go into the house of Josiah the son of Zephaniah.

— take the exiles living in Babylon, who had come up to Jerusalem at that time, from Heldai, Tobijah, and of Jedaiah, who have come from Babylon, as a committee of the Jews residing at Babylon.

11 Then take silver and gold and make crowns, and set them upon the head of Joshua the son of Jehozadak, the high priest,

— then take silver and gold, evidently of the precious metals sent by the Jews of Babylon, and make crowns, a double crown or one of several bands, and set them upon the head of Joshua, the son of Josedech, the high priest, as a type of the combined priesthood and kingdom which shall be conferred upon the Messiah;

12 and speak unto him, saying, ‘Thus speaketh the Lord of hosts, saying, “Behold the Man whose name is The Branch! And He shall grow up out of His place, and He shall build the temple of the Lord.

— and speak unto Zechariah, saying, Thus speaketh the Lord of hosts, saying, Behold, the man whose name is The BRANCH, and he shall grow up out of his place, Jeremiah 33:15, as a root out of a dry ground, Isaiah 53:2, and he shall build the Temple of the Lord, the real Sanctuary, the Kingdom of the New World;

— the Targum paraphrases the words, “behold the man Messiah is his name;” the Jews interprets this passage of a divine Person; who could only be the Son of God by whom no other than the Messiah could have meant;

13 Even He shall build the temple of the Lord; and He shall bear the glory, and shall sit and rule upon His throne. And He shall be a priest upon His throne; and the counsel of peace shall be between them both.”’

— even the Branch shall build the Temple of the Lord, accomplishing his great work in spite of the lowliness of his earthly origin; and he shall bear the glory, being adorned with kingly glory and honor, and shall sit and rule upon his throne as the true King of kings;

— and he shall be a Priest upon his throne, uniting in his person the offices of King and of Priest; and the counsel of peace shall be between them both, the two offices being united in one person. Psalms 110.

14 “And the crowns shall be for Helem and for Tobijah and for Jedaiah, and for Hen the son of Zephaniah, for a memorial in the temple of the Lord.

— and the crowns shall be for a memorial in the Temple of the Lord so that future generations would be reminded of the example of others before them.

15 And those who are far off shall come and build the temple of the Lord, and ye shall know that the Lord of hosts hath sent Me unto you. And this shall come to pass if ye will diligently obey the voice of the Lord your God.”

— and they that are far off, like the men who had in this case brought their offerings, shall come and build the Temple of the Lord, representatives of various nations joining in the upbuilding of the Lord’s great spiritual Temple, his holy Kingdom,

— and ye shall know that the Lord of hosts hath sent him unto Zechariah, as the Messiah himself says, John 3:16. And this shall come to pass, if ye will diligently obey the voice of the Lord, your God, this being added by way of admonition lest anyone deliberately lose the blessings which are offered in and by the coming of the Messiah. Thus the establishment and growth of the Kingdom of God.

For more about the South, a prophecy of Esau or Edom, see Obadiah

For more on the enemy from the South, see A Sword from the South!

For more into another Captivity: see Ezekiel Timeline – 190/40 Years

Fauci Lied About Gain Of Function Research

•April 23, 2023 • Leave a Comment

Watch: Former Director Of National Intelligence Admits That Fauci Lied About Gain Of Function Research

ZeroHedge by Tyler Durden • April 19, 2023 // Dr Anthony Fauci “Lied Under Oath”

Only two years ago numerous alternative media sources including Zero Hedge were accused of spreading “conspiracy theories” and false information relating to the origins of the Covid-19 virus. Specifically, anyone who dared to suggest that the Level 4 virology lab in Wuhan, China (right across town from covid ground zero) might be the source of the outbreak, faced outright censorship on social media. The question many people should have been asking is: “Why?” – Why was the censorship so aggressive over clearly reasonable investigations into Wuhan lab operations?

Not only that, but why were the denials and spin from officials like Anthony Fauci so swift?  Why not simply examine the evidence instead of dismissing it out of hand?

The real reason for the campaign to silence discussion on the Wuhan lab becomes evident as the connections between Fauci, the NIH and the lab are revealed. Elements of the US government including Fauci were in fact bankrolling gain of function research on coronaviruses at Wuhan, and shielding it from government oversight. It is undeniable. If one accepts that the most likely source for the covid pandemic was the Wuhan laboratory then one must also accept that Fauci and his associates helped to create the pandemic.

Fauci lied about these connections incessantly under oath. Here is Anthony Fauci defending his initial lie to Congress using further lies during questioning by Sen. Rand Paul:

Dr Anthony Fauci “Lied Under Oath”

Evidence of the research includes documents from the Department of Defense (obtained by Project Veritas) which confirm that  EcoHealth Alliance approached DARPA in 2018 about gain of function research on bat borne coronaviruses under a proposal called Project DefuseDARPA rejected the proposal on the grounds that it did not outline the risks of such experimentation and violated a moratorium on gain on function research.  EcoHealth then went to Fauci and the NIH for funding, and Fauci was quick to support it using the labs in Wuhan.

Documents from the NIH itself also show that the group engaged in gain of function research at Wuhan focusing on developing coronaviruses that could be transferred from animals to humans.  Fauci was aware of this research by at least 2021 (and was likely involved from the very beginning) and yet continued to lie about NIH involvement.

Meanwhile, the National Pulse – which has done multiple deep-dive investigations on the topic, uncovered in May of 2001 that the WIV scrubbed all mention of its partnership with the NIH from their website.

Scrutiny over Fauci’s disinformation campaign may be too little too late, and we have to wonder if the man will ever face consequences for his actions.  However, the exposure of Fauci and the NIH is so overwhelming that the former Director of National Intelligence now admits that Fauci misled Congress and the American public.

Hopefully, this revelation will help to discourage people from blindly following the claims of government bureaucrats during the next manufactured global crisis.

“I have seen a horrible thing in the house of Israel” Hosea 6:10

“And I will turn your feasts into mourning and all your songs into lamentation; and I will bring up sackcloth upon all loins and baldness upon every head; and I will make it as the mourning for an only son, and the end thereof as a bitter day” Amos 8:9-10

“The LORD shall smite thee with madness, and blindness, and astonishment of heart; and thou shalt grope at noonday, as the blind gropeth in darkness” Deuteronomy 28:28-29

What If The Dollar Falls?

•April 23, 2023 • Leave a Comment

What If The Dollar Falls? Can a bird fall in a snare upon the earth where no trap is for him? Shall one take up a snare from the earth, and have taken nothing at all? Amos 3:5

Helicopter Dollars Printing for the Last Seven Decades

The Mises Institute by Peter St Onge • April 14, 2023 // ZeroHedge

The past few weeks, major countries have been moving away from the US dollar, raising doubts about the dollar’s long-dominant role in the world. Eight weeks ago, it was just pariah nations like Iran or Russia trying to de-dollarize. Now it’s Brazil, France, even Saudi Arabia—the lynchpin of the decades-long “petrodollar” arrangement. [adds Asean, India, Kazakhstan, Pakistan, Malaysia, Laos and numerous African, the Middle East and Latin American countries]

If the dollar does lose its position as the global reserve currency, it will be catastrophic for the American economy. Catastrophic for the American people on whose backs 80 years of reserve status were built. And it will subject billions of foreigners, for whom the dollar has meant decades of being bullied, to history’s greatest bait and switch.

Dollar at Risk

In late March, Saudi Arabia announced it will price oil in Chinese yuan. Even CNN was worried, in a rare display of situational awareness, while Fox fretted about “Weimar”—hyperinflation.

The dollar has been the undisputed global reserve currency since the 1940s. Reserve currency status looks great on paper: You get to print stacks of green paper and foreigners give you cool stuff for it, like toasters, luxury cars, and copper mines [and even gold and rare earth]. The problem is who profits—who gets paid when foreigners crave the green paper?

Unfortunately, it’s not the American people; it’s whomever’s printing money: The Fed, meaning the Treasury, to whom they hand their ill-gotten profits, and—you guessed it—Wall Street. Commercial banks.

To see why, imagine foreigners didn’t want dollars. The Fed and banks could only print a little bit since printing a lot would create inflation, and voters would toss them out.

But if foreigners want a large number of dollars, the Fed and banks can print a matching amount. It’s like a river flowing into the money supply reservoir, matched up with a river flowing out to foreigners. The reservoir stays stable, and voters don’t riot.

But notice where the profits went. That river to foreigners didn’t go to we the dollar-holders—we are the reservoir; we are unchanged. The profits went right through us to the source of the river: the US Treasury and Wall Street.

So, like the rest of our crony financial system, it’s a hustle. The American people think they’re benefitting from reserve status, but the profits were sucked out and handed to the people who designed the institutional fleecing we call a financial system.

During the Weimar hyperinflation event of the early 1920s, wheelbarrows replaced wallets

Enter Weimar

Now, here’s the problem. What if foreigners suddenly don’t want dollars?

Maybe China’s paying them to sell oil in yuan, or maybe the Fed lost the plot and creates too much inflation; [what if all the BRICS plus 20 potential and hopeful members decide this August in South Africa to off-load their dollars?]

Demand dries up, the dollar starts to lose value, and foreigners start worry their life savings and corporate treasuries are melting. They sell out of the dollar. A little at first, more and more if it accelerates.

Now that river to foreigners reverses, it flows back into the reservoir. The dollar collapses. 70 years of Fed and Wall Street money printing comes rushing back like a tsunami running up a canyon. We’re talking double-digital inflation [more likely would be a triple-digits inflation], over multiple years, at a minimum.

If they screw this up, reserve currency status could turn out to be a trap, an absolute catastrophe for the American people.

What Are the Stages of De-dollarization?

So what happens if the dollar falls?

For starters, foreigners don’t need as many dollars. Meaning there are extra dollars nobody wants. This makes the price of the dollar fall—it gets weaker.

It’s usually slow at first, then picks up speed if it keeps going, a progressive rush for the exits. This is because the first ones out only lose a little bit, but the longer they waited, the more they’ll lose.

Who’s left holding the bag as the dollar becomes increasingly worthless? Easy: Americans. The only people on earth who are actually obligated to use the US dollar, thanks to an obscure law passed in 1862 as a wartime emergency that nevertheless managed to stick around for 151 years. [161 years]

So Americans have no choice: unless you swapped your dollars for gold, or Bitcoin, or goats, you go down with the ship.

What happens to those Americans? A falling dollar drives up the price of everything that comes into America. But it also drives up the price of anything traded on world markets. Meaning the raw materials and imported components that drive American factories and sustain American consumers.

The first to jump would be gasoline, heating fuel, and food prices—all of those are world markets. Along with prescription medicines since China has a creeping stranglehold thanks to our idiotic over-regulation—indeed, this is more or less true for every consumer product that China dominates: we shot ourselves in the foot, and now it’s coming back to bite us.

Next, those expensive commodities and input prices pour out through the supply chain. Yanking prices up in industry after industry—cars, construction materials like steel or concrete, clothes, furniture, TVs, computers, and medical devices.

Gone are the days of affordable luxuries—now you gotta work for them.

Inflationary banknotes: Everybody a billionaire?

The Main Event: Capital Flows

And that’s when the main event begins: capital flows.

If foreigners get nervous, they sell not only dollars, they sell assets denominated in dollars. Starting with the most liquid: stocks, bonds, and treasuries. These are easy to trade—IBM stock is easier to sell than a Taiwanese factory in Wisconsin—so they go first.

About 40% of American stocks are owned by foreigners and about one-third of corporate bonds. If foreigners start fleeing, both plunge. This could cut your 401k almost in half, and it could drive up borrowing costs for companies to impossible levels.

Leading to mass bankruptcies on top of the wave of bankruptcies the Fed’s already engineering to try and stop the inflation it started.

It doesn’t stop there: one-third of US treasuries are owned by foreigners—over $8 trillion in bonds. If foreigners start dumping those, it will either send US government debt service soaring by potentially hundreds of billions of dollars a year. Or, much more likely, it forces the Fed to step in and buy up all that foreign demand, flooding yet more trillions into the economy.

This would flip inflation overnight marching back towards double-digits; [more likely would be a triple-digits inflation; Argentina is already in a triple-digits inflation, and they don’t have all those rivers of reserve dollars flowing back].

Conclusion

There are ways to stop this. But given the Washington clown show to raise the debt ceiling yet again, paired with their obsession with sanctions that scare foreign countries off the dollar, Washington isn’t remotely close to the serious thinking it will take to right this ship.

Losing reserve currency status would savage the American economy, and it would savage the American people. No country needs reserve currency status—after all, it doesn’t benefit the people. But, like climbing a cliffside with no gear, once you go halfway, you better not let go.

For among My people are found wicked men; they lie in wait as he that setteth snares; they set a trap, they catch men.

How the hammer of the whole earth is cut asunder and broken! How Babylon hath become a desolation among the nations!

I have laid a snare for thee, and thou art also taken, O Babylon, and thou wast not aware; thou art found and also caught, because thou hast striven against the Lord.

The Lord hath opened His armory and hath brought forth the weapons of His indignation; for this is the work of the Lord God of hosts in the land of the Chaldeans, Jeremiah 5:26; 50:23-25.

The End of American Exceptionalism?

•April 22, 2023 • Leave a Comment

“Don’t pick up the phone” might not be a formal agenda during meetings for the next Brics+ conference in South Africa comes August, 2023; but surely it will be a hot topic during coffee breaks! “So that you won’t be shouted down!”

Now, failing banks, inflation, soaring interest rates and the flight from the petrodollar could become a disaster for ordinary Americans. Is this the End of American Exceptionalism?

The Unz Review by Philip Giraldi • April 18, 2023

Watching a once great nation commit suicide is not pretty.

President Joe Biden does not seem to understand that his role as elected leader of the United States is to take actions that directly or indirectly benefit the folks who voted for him as well as the other Americans who did not do so. That is how a constitutional democracy is supposed to work. Instead, Biden and the gang of introverts and neocon war criminals that the has surrounded himself with have done everything that can to inflict fatal damage on the economy through rash initiatives both overseas and at home.

A spending spree to buy support from the bizarre constituencies that make up the Democrat Party base while also fighting an undeclared war in Europe have meant that nearly two trillion dollars has been added to the national debt under Biden’s rule, a debt that was already unsustainable at nearly $30 trillion, larger than the United States’ gross national product. Plans to cancel student loan debts will add hundreds of billions of dollars more to the red ink.

And those actions undertaken overseas, to include continuing to expand the war in Ukraine against Russia, will do immeasurable more damage. Consider how the Democratic Party has long had it in for Russian Federal President Vladimir Putin, dating back to when Putin took power in 2000 and started kicking out the western scallywags who were looting his country. Subsequently, false intelligence and other innuendoes were contrived by Hillary Clinton and her team in 2016 to implicate Donald Trump as a Russian stooge who was secretly working for Putin.

When that didn’t work and Trump was elected, the Russians were accused by the media and Democrats of willy-nilly interfering in US elections more generally speaking, a much-exaggerated claim in contrast to the overwhelming silence surrounding the real electoral and policy interference, which has been coming from Israel and its fifth column inside the United States, who, not coincidentally, are the chief proponents of the war against Russia.

Placing a target on Vladimir Putin’s back appears to have an unfortunate consequence which Biden has yet to wake up to, namely the fact that the United States now has what might be described as a Ponzi scheme faux economy which is very vulnerable, particularly as much of the world has become disenchanted with the US style of global leadership.

Note for example the recent state visit by French President Emmanuel Macron to Beijing, where he embraced a “global strategic partnership with China” to bring about a “multipolar” world, freed of “blocs” that is not sheltering behind “Cold War mentality.” Macron also criticized the “extraterritoriality of the US dollar.”

And threats made by the Bidens against both China and Russia have accomplished little beyond drawing the two major political and military powers closer together. Beijing and Moscow entered into a trade agreement in their own currencies in 2014 and have openly taken steps to challenge US dominance of international currency exchanges, creating instead a global multipolar trading environment.

Europe aside, many nations are now eager to cut the tie that binds, which is the decades long American dominance of international financial mechanisms and also the general use of dollars to pay for oil and other energy supplies. The widespread use of petrodollars enables the buffoonish Janet Yellen at the US Treasury and the Federal Reserve banks to print unlimited unbacked fiat currency, knowing that there will always be a market for it.

Which brings us back to the Ukraine war, pursued “until we win” by Biden and his somnolent Secretary of State Antony Blinken. One of the first moves when Russia intervened in Ukraine was to block and eventually confiscate Russia’s 300 billion dollars-worth of foreign reserves in banks in the US and Europe. That sent a shock wave across currency markets all around the world.

Biden and Yellen had weaponized the US’s own national currency, which hitherto had been an untouchable step in international relations for nations that were not actually at war. Countries like China and India with large economies then realized that the US Treasury Department and the dominance of the dollar as an exchange currency had now become a weapon of war and a serious threat to the economies of all other nations.

As a consequence, the US Dollar is right now being rejected by many nations as the world’s reserve currency. Some nations all over the world have agreed to use the Chinese Yuan and Indian Rupee for any-and-all international currency transactions. Saudi Arabia continues to use the petrodollar but does not demand it.

Recently, Saudi Crown Prince Mohammed bin Salman and Chinese President Xi Jinping agreed to permit the Saudis to sell oil to China in Yuan. Saudi Arabia, the world’s largest oil exporter, is now allowing multiple currencies to be used to purchase its oil, a major attack on the primacy of the US dollar and it also has accepted Chinese mediation to mend fences with the US and Israel’s arch enemy Iran. And the Saudis have even more recently refused a Biden Administration request that it start pumping more oil to reduce energy costs, signaling that the shift is both political and economic in nature.

Japan, a major economy, has also started purchasing oil and gas directly from Russia against the US imposed energy embargo while Brazil, another major economy, has agreed to use the Yuan in its increasing trade with China. As fewer nations utilize the US dollar, America’s ability to export and ignore its burgeoning domestic debt and inflation to other countries is being diminished.

This might have a decisive impact on the US currency as the drive to break with the petrodollar continues to grow and could produce something like a “perfect storm” impacting on the US economy. It threatens to drastically lower the standards of living of nearly all Americans within the next several years as the dollar loses value and purchasing power. As the US economy is heavily interconnected with many European economies, Europe is also likely to be a victim of the coming disaster.

The good news, of course, is that the United States will no longer be able to afford its endless wars and international interventions. Lacking its economic power, it will no longer be able to declare itself “exceptional” and the enforcer of a “rules based international order.” It would mean an ending of the funding of developments like the Ukraine proxy war and the troops will have to come home from places like Syria and Somalia. And it might even mark the ending of sending billions of dollars annually to a wealthy Israel.

Ending dollar supremacy would inevitably have an immediate impact on what passes for US foreign policy, making it more difficult for Washington to initiate and sustain Treasury Department sanctions on countries like Iran and North Korea. It could also create economic turmoil for many countries until the situation resolves itself by producing greater volatility in currency markets worldwide.

The Federal Reserve Bank will no doubt respond to the unfolding crisis by acting as it always does by raising interest rates to astronomical levels, thereby hurting most the Americans who can least afford the shock therapy.

And it did not have to turn out this way. It could have been avoided. If the US, which had no horse in the race, had left Ukraine alone Vladimir Putin would not have become a symbol of defiance against the “Rules Based International Order” and he would not have worked with China to establish multipolarity in the way the financial world operates.

Instead, we have a situation where Europe is being de-industrialized due to soaring energy prices and Washington’s destruction of the Nord Stream pipelines while the US is potentially confronting economic disaster as the dollar’s relevance to international trade sinks.

The ultimate irony is that Russia, and also the US/Israeli arch enemy Iran, are by comparison doing quite well economically as they sell their oil and gas to anyone in any currency. One has to conclude that when US Treasury Secretary Janet Yellen recently made her secret trip to Kiev to promise the despicable Volodymyr Zelensky billions of taxpayer dollars the United States might just have been better served if she had stayed in Washington and made some minimal effort to address the mounting economic problems confronting us here at home.

“For the day of the Lord is near upon all the nations. As you have done, it shall be done to you; your dealings will return upon your own head” Obadiah 1:15

“Behold, the eyes of the Lord God are upon the sinful kingdom, and I will destroy it from off the face of the earth, except that I will not utterly destroy the house of Jacob,” saith the Lord. Amos 9:8

Zechariah (Ch 3-4)

•April 22, 2023 • Leave a Comment

The vision of Zechariah is in the form of a judicial process: Joshua is the person accused, and is described standing before the Angel of the Lord; and by the filthy garments he had on, which were the ground of the charge against him. The accuser is Satan who stood at his right hand; and his Judge is the Angel of the Lord, before whom he was the Branch.

Also, the hand of Zerubbabel with those seven eyes of the Lord sent forth “to and fro” into all the earth; only a Divine Being could have seven eyes of the Lord “which run to and fro through the whole earth,” thus testifying that Zerubbabel is prophetically the Son of God, the Messiah.

Zechariah 3

1 And he showed me Joshua the high priest standing before the angel of the Lord, and Satan standing at his right hand to resist him. — the high priest Joshua is to be considered typically representing the condition of the priesthood in which office he was;

— and which was very low and mean, under the second Temple; which the high priest, were representatives of; and now, standing before the Angel of the Lord pictured as the Judge in a court of law, and Satan standing at his right hand to accuse him;

— to accuse him: to accuse him because Joshua’s sons were married to heathen women, as it is written in Ezra 10:18, “And it was found of the sons of the priests who had taken foreign wives, of the sons of Joshua the son of Jozadak …”

2 And the Lord said unto Satan, “The Lord rebuke thee, O Satan; even the Lord who hath chosen Jerusalem rebuke thee! Is not this a brand plucked out of the fire?”

— and the Lord, (יְהֹוָה Yehovah), for he is also the Angel of the Lord, the Son, said unto Satan, The Lord (יְהֹוָה) rebuke thee, O Satan, the adversary and accuser being condemned instead of him whom he wanted to condemn,

— even the Lord (יְהֹוָה the Father) that hath chosen Jerusalem, rebuke thee; he has accepted the believers as his people and will not permit Satan with his choice.

— is not this a brand plucked out of the fire? A brand is a burnt, burning, or smoldering piece of wood. His people had been at the very brink of destruction, but the Lord had interfered before it was too late; therefore Joshua also, standing before the Lord as the representative of the sinful people, is shielded from condemnation.

3 Now Joshua was clothed with filthy garments, and stood before the Angel. — was wearing filthy garments: this is also explained according to the Targum: he had sons who had married women who were unfit to marry into the priesthood, and Joshua was accused because he did not interfere with his sons’ marriages.

4 And He answered and spoke unto those who stood before Him, saying, “Take away the filthy garments from him.” And unto him He said, “Behold, I have caused thine iniquity to pass from thee, and I will clothe thee with change of raiment.”

— and he, the presiding Angel of God, the Son answered and spoke unto those that stood before him, some of his ministering angels; or as the Targum paraphrases it, “and he said to them who ministered before him;”

The Targum is another source of the Bible. Started by Ezra for those returning from Babylon and for these returnees they could only understand in Aramaic; hence the Targum is as if Ezra is speaking to us from the verses quoted;

— saying, Take away the filthy garments from him, this signifying the removal of the people’s guilt; and unto him He said, Behold, I have caused thine iniquity to pass from thee, that is, by an act of complete forgiveness, and I will clothe thee with change of raiment, with the festival garments of a perfect righteousness.

5 And I said, “Let them set a clean miter upon his head.” So they set a clean miter upon his head, and clothed him with garments. And the angel of the Lord stood by.

— and Zechariah said, the prophet here suddenly interposing in his eagerness to have, the work of cleansing completed, Let them set a fair miter upon his head, to give him the crowning assurance that the priesthood was restored, that the name of Yehovah was once more borne on the turban of the high priest;

— so they set a fair miter upon his head and clothed Joshua with garments; and the Angel of the Lord stood by, thus Joshua, the representative of the people, particularly of its priestly character, was restored to the full dignity of the olden days, and thereby the people were likewise restored to their position as the Lord’s people.

6 And the angel of the Lord protested unto Joshua, saying,

7 “Thus saith the Lord of hosts: ‘If thou wilt walk in My ways, and if thou wilt keep My ordinance, then thou shalt also judge My house, and shalt also keep My courts, and I will give thee places to walk among these who stand by.

— thus saith the Lord of hosts, If thou wilt walk in my ways, as a true witness of God, and if thou wilt keep my charge, performing every part of the law with due faithfulness,

— then thou shalt also judge my house (the Father’s house), have charge of the Lord’s Temple, and shalt also keep my courts, in observing every provision of all the Law concerning worship, and I will give thee places to walk among these that stand by, that is, he would have open and unhindered access between the holy angels to the very throne of God; so that every believer may draw nigh to the Throne of God without hesitation;

— the Targum very agreeably paraphrases the words thus, “and in the resurrection or quickening of the dead, I will raise or quicken thee; and I will give thee feet walking among these seraphim.”

8 Hear now, O Joshua the high priest, thou and thy fellows who sit before thee; for they are men wondered at. For behold, I will bring forth My Servant the Branch.

— hear now, O Joshua the high priest, thou and thy fellows that sit before thee, his fellow-priests; for they are men wondered at, literally, “men of wonder are they,” that is, men about whom one might marvel;

— for, behold, I the Father, will bring forth my Servant, the branch, the Son, Cf Jeremiah 23:5-6; Isaiah 11:1. This Branch, of whom the priests of the Old Testament were but types, is the Servant of God in a most singular sense, who was to carry out the will of God concerning the redemption of the world. Cf Isaiah 53.

9 For behold the stone that I have laid before Joshua: upon one stone shall be seven eyes. Behold, I will engrave the engraving thereof,’ saith the Lord of hosts, ‘and I will remove the iniquity of that land in one day.

— for behold the stone that the Father have laid before Joshua; upon one stone shall be seven eyes, that is, omnipresent seven eyes, the number of perfection, would be directed upon him, the loving care of Yehovah being indicated, as he observes his people, the believers in him;

— behold, the Father will engrave the graving thereof, with beautiful ornamental sculpture, saith the Lord of hosts, and he will remove the iniquity of that land in one day, both the transgressions and their punishment. This great day is the day of Calvary, for it was then that God, in one day, took away the sins of the whole world; also the Church, now still clothed with a filthy garment;

— the seven eyes parallels the seven Spirits of God and the seven stars of Revelation 5:6 “And I beheld, and lo, in the midst of the throne and the four living beings, and in the midst of the elders, stood a Lamb as it had been slain, having seven horns and seven eyes, which are the seven Spirits of God, sent forth into all the earth.”

10 In that day,’ saith the Lord of hosts, ‘shall ye call every man his neighbor under the vine and under the fig tree.’” — in that day, saith the Lord of hosts, shall ye call every man his neighbor under the vine and under the fig-tree,

— inviting him in Godly fellowship, doing Godly-work in calling others to enjoy the blessings of the kingdom of God. We thus have the entire plan of God in his seven thousand years plan outline in this one vision, a Godly message which might well be heeded by all men in our days.

Zechariah 4

1 And the angel who talked with me came again and waked me, as a man who is wakened out of his sleep, — and the Angel that talked with me (identified earlier as the Son in chapter 1);

— he who intercedes between the Father and man in making known the message concerning the future, came again and waked me, as a man that is wakened out of his sleep, out of his state of exhaustion. The Angel had evidently left the prophet Zechariah for a short while and now returned for the purpose of interceding further visions.

2 and said unto me, “What seest thou?” And I said, “I have looked and behold, a candlestick all of gold with a bowl upon the top of it, and his seven lamps thereon, and seven pipes to the seven lamps which are upon the top thereof;

— and said unto Zechariah, What seest thou? thus calling the prophet’s attention to a new vision, whereas in the other instances Zechariah had asked for information. And Zechariah said, he have looked, he was even then observing very closely;

— and behold a candlestick all of gold, with a bowl upon the top of it, a round vessel, or reservoir, for oil, and his seven lamps thereon and seven pipes to the seven lamps, or seven feed-pipes to each of the seven lamps, to insure a plentiful supply of fuel, which are upon the top thereof, the candlestick in general being formed after that in the Tabernacle, Exodus 25:31-37;

3 and two olive trees by it, one upon the right side of the bowl, and the other upon the left side thereof.” — and two olive-trees by it, one upon the right side of the bowl and the other upon the left side thereof, this being a new feature, indicating the source of the oil for the lamps.

4 So I answered and spoke to the angel who talked with me, saying, “What are these, my lord?” — so Zechariah answered, and spoke to the angel that talked with Zechariah, saying,

— What are these, my lord (‘āḏôn)? He, Zechariah, could not quite grasp the significance of it all, as if he thought as one who has just wakened out of his sleep, not realizing he was speaking to the Son, but just an angel;

— second, a further possibility is that the emphasis of the Son is to be shifted away from that of an interceder to that of Zerubbabel, the governor, the builder and the finisher for the building of the Temple of God; of the physical to that of the spiritual.

5 Then the angel who talked with me answered and said unto me, “Knowest thou not what these be?” And I said, “No, my lord.”

— then the angel that talked with Zechariah answered and said unto him, Knowest thou not what these be? He was surprised that a man of Judah, a Zechariah of priestly descent, should not find some meaning in the vision of such a candlestick. But Zechariah said, No, my lord (‘āḏôn not Yehovah יְהֹוָה so he appeared as an ordinary angel to Zechariah).

6 Then he answered and spoke unto me, saying, “This is the word of the Lord unto Zerubbabel, saying, ‘Not by might nor by power, but by My Spirit,’ saith the Lord of hosts.

— then the angel answered and spake unto Zechariah, saying, This is the word of the Lord (יְהֹוָה) unto Zerubbabel, saying, Not by might, that is, the force of armies, nor by power, namely, that of any earthly agency, but by my Spirit, saith the Lord of hosts;

— the candlestick of the Tabernacle was a type of the congregation of Israel, which was supposed to be a light shining in the darkness of the world. Its oil was a type of the holy spirits, and the high priests of the Covenant received the strength for the performance of the duties of their office from the Spirit symbolized in the light of the great candlestick;

— moreover, Zerubbabel, the governor of the people, was to be informed that the great work which he was to perform could be carried on only through the spirit of the Lord.

The Targum testifies that Zerubbabel is prophetically refering to the Messiah

7 Who art thou, O great mountain? Before Zerubbabel thou shalt become a plain; and he shall bring forth the headstone thereof with shoutings, crying, ‘Grace, grace unto it!’” — this phase “0 great mountain” only used once in the Bible;

— who art thou, 0 great mountain? the building of the Temple being thus represented. Before Zerubbabel thou shalt become a plain, he would easily overcome all the difficulties connected with the completion of this momentous work;

— and the angel shall bring forth the headstone thereof, the uppermost stone of its walls, the headstone in the building up of his church, fulfilled only by Christ;

— with shoutings, crying, Grace, grace unto it! that is, May God grant grace to this stone and to the building which it represents, so that it may stand forever!

The Targum indeed paraphrases the words thus,

“and he shall reveal his Messiah [or Christ], whose name is said from eternity, and he shall rule over all kingdoms;”

— thus the Targum testifies that Zerubbabel is prophetically the Messiah (Ezra, the one who inspires the translationof the Sacred Text into the Targum, also knows about Zerubbabel being the Messiah!).

8 Moreover the word of the Lord came unto me, saying,

9 “The hands of Zerubbabel have laid the foundation of this house; his hands shall also finish it. And thou shalt know that the Lord of hosts hath sent me unto you.

— the hands of Zerubbabel, the Messiah, have laid the foundation of this house, the elect, his hands shall also finish it, and thou shalt know that the Lord of hosts hath sent me unto you, whence it follows that the entire situation has a deeper significance than that of a mere earthly Temple, namely, that the Lord Yehovah, in the Word that was made flesh, was coming to complete the Temple of the kingdom of God;

— the Targum paraphrases them to this sense, “and ye shall know that the Lord of hosts hath sent me to prophesy unto you;” thus the Targum testifies that Zerubbabel is one sent from God, the Father; hence Zerubbabel is the Son of God, the Messiah;

Remember, laying side by side along with the Masoretic Text, the Targum is another source of the Bible. Started by Ezra for those returning from Babylon and Persia, these returnees they could only understand in Aramaic; hence the Targum is as if Ezra is speaking to them in ancient times and to us today from the Hebrew Text quoted.

10 For who hath despised the day of small things? For they shall rejoice and shall see the plummet in the hand of Zerubbabel with those seven. They are the eyes of the Lord, which run to and fro through the whole earth.”

— for who hath despised the day of small things? It seemed indeed that the days in which Judah was then living were days of insignificant things, when the entire nation was living in deepest poverty and contempt; yet these days were the forerunners of the most momentous period in the history of the world;

— for they, the people concerned, shall rejoice and shall see the plummet in the hand of Zerubbabel, as the chief builder of the spiritual Temple, with those seven, they are the eyes of the Lord, which run to and fro through the whole earth, Cf Zechariah 3:9. But if the eyes of God’s majesty rest upon this building with such evident joy and satisfaction, it surely must be a Temple of the greatest importance;

— “the hand of Zerubbabel with those seven” and these seven are “the seven eyes of the Lord” which are also the seven spirits of God, sent forth “to and fro” into all the earth; Revelations 5:6;

— only a Divine Being could have seven eyes or seven spirits of the Lord “which run to and fro through the whole earth,” thus the Targum testifies that Zerubbabel is the Son of God, the Messiah.

11 Then answered I and said unto him, “What are these two olive trees upon the right side of the candlestick and upon the left side thereof?”

— then answered Zechariah and said unto the angel, What are these two olive-trees upon the right side of the candlestick and upon the left side thereof? The candlestick was in the center with its arms extended on either side, and next to these arms stood the two olive-trees which were puzzling the prophet Zechariah.

12 And I answered again and said unto him, “What be these two olive branches, which through the two golden pipes empty the golden oil out of themselves?”

— and Zechariah answered again and said unto the angel, What be these two olive-branches, literally, “ears,” because they were bunched to resemble ears of grain, which through the two golden pipes, special spouts, or funnels, placed under them, empty the golden oil out of themselves? so that the oil was fed directly from the trees into the pipes connecting with the reservoir of the candlestick.

13 And he answered me and said, “Knowest thou not what these be?” And I said, “No, my lord.”

14 Then said he, “These are the two anointed ones, who stand by the Lord of the whole earth.”

— then said the angel, these are the two anointed ones that stand by the Lord of the whole earth as his servants; they are the two witnesses of Revelation 11:

3 And I will give power unto my two witnesses, and they shall prophesy a thousand two hundred and threescore days, clothed in sackcloth.”

4 These are the two olive trees and the two candlesticks, standing before the God of the earth.

— anointed by God for the performance of witnessing to the whole world for the work of perfecting the Kingdom of God;

— the meaning for our day is clear; the saints with the spirits of God are the Lord’s candlesticks, Matthew 5:14, and therefore has a great and important duty to fulfil in this world. This duty may not be performed by the power and might of mere men, but solely through the spirits of the Lord to his two specially anointed.

US Guns Flowing Back into Mexico

•April 21, 2023 • Leave a Comment

France, under Macron, manages to remain free, unlike Britain or even Germany, who have been shouted down by the US to become vassal states.

Now a former Mexican president has been identified in declassified papers to work for the CIA. Had Mexican presidents been shouted down by the US all over the years? Not the current one, I believe. He seems very capably of fighting back!

US guns keep flowing into Mexico and the rest of Latin America

~~~~

In Mexico, Tens Of Thousands Of Guns Come From The US

Mexico Daily Post • April 18, 2023

US guns, many of them exported legally, are flowing into Latin America in an “iron river” ending in the hands of drug cartels and abusive security forces, activists said on Monday, April 17th, calling for greater oversight from US law and federal agencies.

More than half of “crime guns” recovered and traced in Central America are sourced from the United States, according to the US gun control agency ATF. This level nears 70% for Mexico and is around 80% across the Caribbean.

“It’s called the iron river and it’s flooding countries to the South,” Elizabeth Burke of US non-profit Global Action on Gun Violence said at an event organized by the Center for American Progress in Washington.

Burke called for rules preventing manufacturers from selling to dealers with lax distribution practices. Manufacturers should also stop selling armor-piercing weapons and guns that can easily be modified to shoot hundreds of bullets at a time, she said.

John Lindsay-Poland, an activist from Stop US Arms to Mexico, added that lax license rules and enforcement helped facilitate the cross-border flow of arms – including military-grade weapons desired by cartels.

“Why would we be arming the very people that we say we are fighting?” he said, calling for more controls at the start of the supply chains.

Sixteen US states and a handful of Caribbean governments last month expressed support for Mexico’s appeal in a civil lawsuit against US gun manufacturers, which seeks to hold them responsible for facilitating the trafficking of deadly weapons.

US gunmakers have maintained that they sell firearms legally to Americans who pass a background check, and their lawyers have argued that holding them responsible opens the door for other lawsuits, such as the deaths of Russians killed by their weapons in Ukraine.

US stymied as guns flow to Mexican cartels

US government figures show last year that income from legal firearm shipments to Latin America increased by 8%, with most sales going to Brazil, Mexico, Guatemala and Colombia.

The National Rifle Association and the State Department did not immediately respond to a Reuters request for comment.

“We don’t want more tragedies in our families,” said Maria Herrera, who founded a national collective investigating the many forced disappearances in Mexico and where the number of gun homicides is surging.

“It destroys lives, breaks families apart, fills communities with pain and panic,” Herrera said at the event. “We can’t live like this.”

For more about the South, a prophecy of Esau or Edom, see Obadiah

For more on the enemy from the South, see A Sword from the South!

For more into another Captivity: see Ezekiel Timeline – 190/40 Years

Trading with the Enemy • Sy Hersh

•April 21, 2023 • Leave a Comment

China is expected to stop the war in Ukraine, so says the German Foreign Minister, Annalena Baerbock, because in her mind, China is a permanent member of the UN, and thus should be a responsible member working for world peace.

But Baerbock doesn’t notice that the other two permanent members, the UK and the US, have been sabotaging any peace process in Ukraine. And that, she has no complaint!

Weird! How often has Baerbock been shouted down since she was appointed as Foreign Minister of Germany?

Trading with the Enemy. Seymour Hersh; or Dangerous Allies?

~~~~

Global Research by Seymour M. Hersh • April 14, 2023 // Seymour Hersh

The Ukraine government, headed by Volodymyr Zelensky, has been using American taxpayers’ funds to pay dearly for the vitally needed diesel fuel that is keeping the Ukrainian army on the move in its war with Russia.

It is unknown how much the Zelensky government is paying per gallon for the fuel, but the Pentagon was paying as much as $400 per gallon to transport gasoline from a port in Pakistan, via truck or parachute, into Afghanistan during the decades-long American war there.

What also is unknown is that Zelensky has been buying the fuel from Russia, the country with which it, and Washington, are at war, and the Ukrainian president and many in his entourage have been skimming untold millions from the American dollars earmarked for diesel fuel payments.

One estimate by analysts from the Central Intelligence Agency put the embezzled funds at $400 million last year, at least; another expert compared the level of corruption in Kiev as approaching that of the Afghan war, “although there will be no professional audit reports emerging from the Ukraine.”

“Zelensky’s been buying discount diesel from the Russians,” one knowledgeable American intelligence official told me. “And who’s paying for the gas and oil? We are. Putin and his oligarchs are making millions” on it.

Many government ministries in Kiev have been literally “competing,” I was told, to set up front companies for export contracts for weapons and ammunition with private arms dealers around the world, all of which provide kickbacks.

Many of those companies are in Poland and Czechia, but others are thought to exist in the Persian Gulf and Israel. “I wouldn’t be surprised to learn that there are others in places like the Cayman Islands and Panama, and there are lots of Americans involved,” an American expert on international trade told me.

The issue of corruption was directly raised with Zelensky in a meeting last January in Kiev with CIA Director William Burns. His message to the Ukrainian president, I was told by an intelligence official with direct knowledge of the meeting, was out of a 1950s mob movie.

The senior generals and government officials in Kiev were angry at what they saw as Zelensky’s greed, so Burns told the Ukrainian president, because “he was taking a larger share of the skim money than was going to the generals.”

Burns also presented Zelensky with a list of thirty-five generals and senior officials whose corruption was known to the CIA and others in the American government. Zelensky responded to the American pressure ten days later by publicly dismissing ten of the most ostentatious officials on the list and doing little else.

“The ten he got rid of were brazenly bragging about the money they had—driving around Kiev in their new Mercedes,” the intelligence official told me.

“O Ephraim, what shall I do unto thee? O Judah, what shall I do unto thee? For your goodness is as a morning cloud, and as the early dew it goeth away” Hosea 6:4

“I have seen a horrible thing in the house of Israel; there is the whoredom of Ephraim, Israel is defiled” Hosea 6:10

“Shall a trumpet be blown in the city, and the people not be afraid? Shall there be evil in a city, and the LORD hath not done it?” Amos 3:6

Zechariah (Ch 1-2)

•April 20, 2023 • Leave a Comment

Attributed to the prophet Zechariah, the Book of Zechariah is included in the Twelve Minor Prophets in the Hebrew Bible. Zechariah is specific about dating his writing (520–518 BC); after Ezekiel and Jeremiah who wrote before the fall of Jerusalem while continuing to prophesy in the early exile period.

Freedom eventually did come to many Jews when Cyrus the Great conquered the Babylonians in 539 BC; and a year later, the famous Edict of Cyrus was released, and the first return took place under Sheshbazzar. After the death of Cyrus in 530 BC, Darius consolidated power and took office in 522 BC; and Zechariah’s prophetic career began during Darius’ reign where he wrote the book that bears his name.

Zechariah 1

1 In the eighth month in the second year of Darius, came the word of the Lord unto Zechariah the son of Berechiah, the son of Iddo the prophet, saying, — in the eighth month, in the second year of Darius, that is, in the year 520 BC;

— in the second year of Darius I: king of Persia; not Darius, son of Ahasuerus, the Mede, who conquered the Babylonian empire in 539 BC at 62 of age; but this is Darius the son of Hystaspes:

— came the word of the Lord unto Zechariah; that is, “the word of prophecy from before the Lord” as the Targum paraphrases it; which came to him, either in a dream or in a vision;

The Targum is another source of the Bible. Started by Ezra for those returning from Babylon and for these returnees they could only understand in Aramaic; hence the Targum is as if Ezra is speaking to them in ancient times and to us from the verses quoted.

2 “The Lord hath been sorely displeased with your fathers. — displeased with your fathers, who lived before and during the destruction of the city of Jerusalem and which was manifest by their captivity;

— all of which were occasioned by their sins, which they provoked the Lord to anger; and this is mentioned as a caution to their children that they may not follow their example and incur similar wraths and displeasure.

3 Therefore say thou unto them: Thus saith the Lord of hosts: ‘Turn ye unto Me,’ saith the Lord of hosts, ‘and I will turn unto you,’ saith the Lord of hosts. — “saith the Lord of hosts” repeated three times;

— therefore say thou unto them, Thus saith the Lord of hosts, the almighty Sovereign of the universe, Turn ye unto Me, saith the Lord, a most impressive call to the children of the former trespassers to repent. and I will turn unto you.

4 Be ye not as your fathers, unto whom the former prophets have cried, saying: Thus saith the Lord of hosts: ‘Turn ye now from your evil ways and from your evil doings.’ But they did not hear, nor hearken unto Me, saith the Lord.

— be ye not as your fathers, those before the exile, unto whom the former prophets have cried, saying, Thus saith the Lord, Turn ye now from your evil ways and from your evil doings, this being the gist of many admonitions in the earlier prophets, Cf Isaiah 31:6; Jeremiah 3:12; Jeremiah 18:11; Ezekiel 18:30; Hosea 14:1; but they did not hear nor hearken unto Me, saith the Lord. Cf II Kings 17.

5 Your fathers, where are they? And the prophets, do they live for ever? — your fathers and the prophets, where are they? do they live forever? The former members of Israel and Judah had perished, as God had said;

— and if the people should say that the prophets also were dead, the Lord would remind them of the fact that His words, as spoken through these prophets are not dead, but had been abundantly fulfilled.

6 But My words and My statutes, which I commanded My servants the prophets, did they not overtake your fathers? And they returned and said, ‘As the Lord of hosts thought to do unto us, according to our ways and according to our doings, so hath He dealt with us.’”

— but my words and my statutes which I commanded my servants, the prophets, namely, that they should proclaim them, threatening of punishment in case of disobedience, did they not take hold of your fathers?

— the prophesied punishments having overtaken them like swift messengers. And they, the fathers before the exile, returned and said, in acknowledging their afflictions as the result of their wickedness, ‘Like as the Lord of hosts thought to do unto us, according to our ways and according to our doings, just as they had deserved it, so hath he dealt with us.’

7 Upon the four and twentieth day of the eleventh month, which is the month of Shebat, in the second year of Darius, came the word of the Lord unto Zechariah the son of Berechiah, the son of Iddo the prophet, saying:

— upon the twenty-fourth day of the eleventh month, which is the month Sebat, five months after the building of the Temple had been resumed, in the second year of Darius, came the word of the Lord unto Zechariah, the son of Berechiah, the son of Iddo, the prophet, saying,

8 I saw by night, and behold, a man riding upon a red horse, and he stood among the myrtle trees that were in the bottom; and behind him were there red horses, speckled, and white.

— Zechariah saw by night in a night vision, and behold a man riding upon a red horse, the color of war and bloodshed;

— and he stood among the myrtle trees that were in the bottom, most likely by the “myrtle trees” may mean the Israelites; or by a valley in the neighborhood of Jerusalem; and behind him were red horses, speckled, or patches of bay and ohers, the color of fire and flames and burning, and white, in this connection the color of victory;

— after released from captivity, the Jews were now in a very low estate, like a grove of myrtle trees in a bottom, so a man riding upon a red horse is still on top of the Jews; but who is he?

9 Then said I, “O my lord, what are these?” And the angel that talked with me said unto me, “I will show thee what these be.”

— then Zechariah asked, O my lord (H113 ‘āḏôn), what are these? And the angel that talked with him said unto him, ‘I will show thee what these be,’ for the Lord wanted Zechariah to know the meaning of the vision in order that he might reveal it to others;

— my lord (H113 ‘āḏôn); this angel “that talked with me” a messenger for God; could he be revealed as the Son of God if verses 19 and 20 below be linked together? It should be linked together because v19 is a question and v20 is a continuation of the the angel’s answer by showing him four carpenters, who is revealed as the Lord (H3068 יְהוָה)!

10 And the man that stood among the myrtle trees answered and said, “These are they whom the Lord hath sent to walk to and fro throughout the earth.”

— and the man that stood among the myrtle trees, the first angel answered and said, ‘These are they whom the Lord (H3068 יְהוָה) hath sent to walk to and fro through the earth,’ to find out how matters stood everywhere.

11 And they answered the angel of the Lord who stood among the myrtle trees, and said, “We have walked to and fro throughout the earth, and behold, all the earth sitteth still and is at rest.”

— and they, the host of angels answered the angel that stood among the myrtle trees (probably Michael the archangel, since he is the chief of the angels), and said, ‘We have walked to and fro through the earth, and, behold, all the earth sitteth still and is at rest,’

— the great commotion among the nations, of which the prophet Haggai had spoken, 2:7-8, had not yet begun, that is, the time for the Messiah to appear in the flesh had not yet come, a statement which naturally had a most depressing effect upon the Jews. But the Lord has a word of comfort ready for them.

Haggai 2:7-8

7 And I will shake all nations, and the desire of all nations shall come; and I will fill this house with glory,’ saith the Lord of hosts.

8 ‘The silver is Mine, and the gold is Mine,’ saith the Lord of hosts.

12 Then the angel of the Lord answered and said, “O Lord of hosts, how long wilt Thou not have mercy on Jerusalem and on the cities of Judah, against which Thou hast had indignation these threescore and ten years?”

— as the seventy years of the exile seemed extended, as though the affliction of the captivity would never end; then the angel (mal’āḵ; probably Michael) of the Lord asked the second person of the Godhead, the Son, who is One who talked with the prophet Zechariah;

— “O Lord of hosts, how long wilt Thou not have mercy on Jerusalem and on the cities of Judah?” the archangel Michael asked the Son (also call the Lord) who normally intercedes between Jerusalem/Judah and the Father; He, the Son, identified later as the Messiah, was already doing the job of a High Priest, interceding between the Father and man.

13 And the Lord answered the angel who talked with me, with good words and comforting words. — and the Lord the Father answered the Son that talked with Zechariah with good and comfortable words, words of prophecy and foresight, which was to pass immediately on to the congregation of Israel.

14 So the angel who communed with me said unto me, “Cry thou, saying, Thus saith the Lord of hosts: ‘I am jealous for Jerusalem and for Zion with a great jealousy.

— so the Angel (mal’āḵ; probablythe Son) that communed with Zechariah, He who had first been given an understanding of the Father’s intentions as expressed in the vision, said unto Zechariah, “Cry thou, saying, Thus saith the Lord of hosts, ‘I am jealous for Jerusalem and for Zion with a great jealousy.’

15 And I am very sorely displeased with the heathen [nations] who are at ease; for I was but a little displeased, and they helped forward the affliction.’

— and the Lord the Father was very sore displeased with the nations that are at ease, believing that they had been permanently victorious over the Jews; for the Father was but a little displeased, as his punishment went out upon his people for seventy years, and they helped forward the affliction, they rioted in the sufferings of helpless Israel and were anxious to prolong them.

16 Therefore thus saith the Lord: ‘I have returned to Jerusalem with mercies. My house shall be built in it,’ saith the Lord of hosts, ‘and a line shall be stretched forth upon Jerusalem.’

— therefore, thus saith the Father, ‘I am returned to Jerusalem with mercies,’ for he had withheld them from his people for a time in order to punish them, but now he was once more ready to accept his repentant children;

— ‘my house shall be built in it,’ namely, the Temple, the Father’s house as the seat of the Lord’s merciful presence in the midst of his congregation, saith the Lord of hosts, and a line shall be stretched forth upon Jerusalem, in this case the builder’s line signifying the rebuilding of the city.

— throughout the Scriptures the Son has never lay claim that the Temple is his house; it is “My Father’s house” John 2:16.

17 Cry yet, saying, Thus saith the Lord of hosts: ‘My cities through prosperity shall yet be spread abroad; and the Lord shall yet comfort Zion, and shall yet choose Jerusalem.’”

— cry yet, saying, ‘Thus saith the Lord of hosts, my cities through prosperity shall yet be spread abroad, overflowing with abundant growth as a stream overflows its banks; and the Lord shall yet comfort Zion,’ and shall yet choose Jerusalem.

18 Then I lifted up mine eyes and saw, and behold, four horns. — then, after the first vision had fully come to an end, Zechariah lifted his eyes and saw, in a second distinct vision, four horns, the common Scriptural symbol of strength.

19 And I said unto the angel who talked with me, “What are these?” And he answered me, “These are the horns which have scattered Judah, Israel, and Jerusalem.”

— and Zechariah said unto the Son (maybe Michael or one of the lesser angels; but the next verse indentifies him as the Son) that talked with him, What be these? And the Son answered Zechariah, These are the horns which have scattered Judah, Jerusalem and Israel; the four horns are the nations that scattered the twelve tribes!

20 And the Lord (יְהוָה) showed me four carpenters. — and the Lord (H3068 יְהוָה; finally this ‘Angel’ is no ordinary angel but revealed himself as יְהוָה YHVH, the Son (he is the second Yehovah);

— the Son of God also carries the name יְהוָה Yehovah; he showed Zechariah four carpenters, rather, four craftsmen in iron, four smiths; or four craftsmen;

— the Son of God also moves around the heavens carrying messages for God the Father;

Exodus 23:20 “Behold, I (the Father) send an Angel (the Son) before you to keep you in the way and to bring you into the place which I have prepared. 21 Beware of Him (the Son) and obey His voice; do not provoke Him (the Son, Yeshua), for He will not pardon your transgressions; for My name יְהוָה is in Him (hence Yehovah’s name, יְהוָה, is also in the Son;

Peshitta 23:21 “Be on your guard before him and obey his voice; do not be rebellious toward him, for he will not pardon your transgression, since My name is in him). 22 But if you indeed obey His voice and do all that I speak, then I will be an enemy to your enemies and an adversary to your adversaries.

23 For My Angel (the Son) will go before you and bring you in to the Amorites and the Hittites and the Perizzites and the Canaanites and the Hivites and the Jebusites; and I will cut them off. 24 You shall not bow down to their gods, nor serve them, nor do according to their works; but you shall utterly overthrow them and completely break down their sacred pillars. Peshitta 23:21-24

— the Son of God, who later came to earth as Yeshua (or more commonly known as Jesus, is also Yehovah “for My name (that is, יְהוָה), is in Him.”

21 Then said I, “What come these to do?” And he spoke, saying, “These are the horns which have scattered Judah, so that no man lifted up his head; but these [the four craftsmen] have come to frighten them, to cast out the horns of the Gentiles who lifted up their horn over the land of Judah to scatter it.”

— then said Zechariah, ‘What come these to do? What was the object in introducing them into the picture?’ And He (the Son, יְהוָה) spoke, saying, ‘These are the horns which have scattered Judah, so that no man did lift up his head,’ being altogether discouraged; but these are come to fray them, to terrify the great powers of evil;

— the “four horns” = these are, first the Babylonians; second, the Greeks; third, the Romans and the fourth? Perhaps the Turks and Muslims; or perhaps the Russians and Chinese, or even the Latinos? or the number four may just point to Judah’s enemies coming from the four directions of the earth;

— the four craftsmen (perhaps these may be the Russians and Chinese, and the Spanish/Latinos?) to cast out the horns of the nations, which lifted up their horn over the land of Judah and Israel to scatter them. It has always been a nature of the Lord to use one nation; as an instruments, to punish another.

Zechariah 2

1 I lifted up mine eyes again and looked, and behold, a man with a measuring line in his hand. — in a state of vision, Zechariah lifted up his eyes again and behold, a man with a measuring-line in his hand, evidently a messenger or angel sent for a special purpose.

2 Then said I, “Whither goest thou?” And he said unto me, “To measure Jerusalem to see what is the breadth thereof and what is the length thereof.”

— then said Zechariah, addressing the angel, Whither goest thou? And he replied, To measure Jerusalem, the city of God, to see what is the breadth thereof, and what is the length thereof, to get the dimensions of the city even then in existence;

3 And behold, the angel who talked with me went forth; and another angel went out to meet him — and, behold, the angel that talked with Zechariah went forth, he was removed from the scene;

— and another angel went out to meet Zechariah, the second angel in this chapter; thus meeting him who acted as interpreter,

— this Angel that talked with Zechariah was identified in this Study as the Son in the previous chapter, but the question is, is He the same as the man with a measuring line in his hand? (verse 1 above)

4 and said unto him, “Run, speak to this young man, saying, ‘Jerusalem shall be inhabited as towns without walls, because of the multitude of men and cattle therein.

— and said unto him, Run, speak to this young man, namely, Zechariah the prophet, saying, Jerusalem shall be inhabited as towns without walls for the multitude of men and cattle therein. It is clearly not the old city to which the angel refers, but a wonderful revived city with an enlarged dimensions, the new Jerusalem with the Ezekiel’s Temple built within.

5 For I,’ saith the Lord, ‘will be unto her a wall of fire round about, and will be the glory in the midst of her.’”

— thus saith the Lord (יְהוָה), for I will be unto Jerusalem a wall of fire round about, so that the city of God would be secure under the sheltering wings of his power;

— and יְהוָה will be the glory in the midst of Jerusalem, so that his blessings would rest upon the Holy City and his name be praised within her. So much being established, Zechariah the prophet is given a summary of what he should proclaim to his people of the Lord.

6 “Ho! Ho! Come forth, and flee from the land of the north,” saith the Lord; “for I have spread you abroad as the four winds of the heaven,” saith the Lord.

— ho, ho, come forth; the Targum paraphrases it, “proclaim to the dispersed:” so the Lord יְהוָה addresses his people through his servant the prophet Zechariah to flee from the land of the North, out of “Babylon” as typical of all powers of evil banded together against his people Israel;

— for I the Lord; have spread you abroad as the four winds of the heaven, namely, in his people Israel which extends to the most remote ends of the world;

— these are spread by the “four horns” in the previous chapter = first the Babylonians; second the Greeks; third the Romans and the fourth? Perhaps the Turks and Muslims; or perhaps the Russians and Chinese, or even the Latinos?

“For I have spread you abroad as the four winds of the heaven,” saith the Lord: two Parallel passages extracted from Ezekiel 6 and 36 worth a closer examination here:

— “the mountain of Israel” this prophecy is concerning the desolations of the United States, United Kingdom and France;

— “and to the hills, to the rivers and to the valleys” these are the hills: Ireland, Switzerland and the Scandinavian countries: Denmark, Norway, and Sweden, Finland, and Iceland; and the valleys, the low countries: Belgium, the Netherlands, and Luxembourg;

— and to the rivers; where during the nineteenth century, the British Royal Navy were known to “Rule the Waves;” and the United States having been plowing up and down the five oceans with her Seven Fleets since the British left the scene;

— ye shall shoot forth your branches; that is, the trees that grew upon them should; the vines, and the olive trees, planted on hills and mountains; these could be their colonies: Canada, Australia, New Zealand, South Africa; American Samoa, Guam, the Northern Mariana Islands, Puerto Rico, and the Virgin Islands (US); Anguilla, Bermuda, Cayman Islands, Falkland Islands, Gibraltar, Virgin Islands (UK); Guadeloupe, Martinique, French Guiana, Mayotte, Réunion (France).

7 “Deliver thyself, O Zion, ye that dwellest with the daughter of Babylon.”

— deliver thyself, O Zion, that dwellest with the daughter of Babylon, or “Ho, Zion, save thyself!” the separation between the children of God and the children of the world being absolute, even if not local. Cf II Corinthians 6:17.

8 For thus saith the Lord of hosts: “After the glory hath He sent me unto the nations which despoiled you, for he that toucheth you toucheth the apple of His eye. — the “me “could be the Son;

— for thus saith the Lord of hosts, ‘After the glory hath he sent me unto the nations which spoiled you,’ the angel of the Lord (could be the Son in this instant) being sent to the nations to get back the glory which they, by their hostile treatment of his people, had taken from him;

— for he that toucheth me toucheth the apple of his eye, so dear are the believers, the members of his elect, in the eyes of the Lord. Every adversary who dares to touch the kingdom of God and its members thereby becomes guilty of a wicked act, which grieves the Lord most deeply and he will punish them.

9 For behold, I will shake Mine hand upon them, and they shall be a spoil to their servants. And ye shall know that the Lord of hosts hath sent me.

— for thus saith the Lord of hosts: behold, I will shake mine hand upon them, swinging it back and forth over them in order to deliver a heavy blow, and they shall be a spoil to their servants, so that the latter become the lords of their former masters;

— and ye shall know that the Lord of hosts hath sent me, yes the Son again, the Anointed, given great power and authority that through him the great Sovereign of the heavens could be carrying out his punishment upon the enemies of his saints. For this reason the people of the Lord are exhorted to sing praises to the Son; the returning Messiah.

10 “Sing and rejoice, O daughter of Zion; for lo, I come, and I will dwell in the midst of thee,” saith the Lord. — sing and rejoice, O daughter of Zion, or the “congregation of Zion” as the Targum paraphrases it;

— the people of Yehovah; for, lo, I come, the Messiah himself addressing those who were longing for his coming, and I will dwell in the midst of thee, saith the Lord. This was so wonderfully fulfilled when the Word was made flesh and dwelt among us.

11 “And many nations shall be joined to the Lord in that day, and shall be My people; and I will dwell in the midst of thee. And thou shalt know that the Lord of hosts hath sent me unto thee.

— and many nations, representatives of the various races and countries of the world, shall be joined to the Lord in that day, to be added to his elect;

— and shall be my people; and the Messiah will dwell in the midst of thee, in the city of God, and thou shalt know that the Lord of hosts hath sent the Messiah unto thee; the great God of the heavens sending his only-begotten Son for the salvation of his people.

12 And the Lord shall inherit Judah as His portion in the holy land, and shall choose Jerusalem again.” — and the Lord shall inherit Judah his portion in the Holy Land, so that He would possess His people, and shall choose Jerusalem again, as the place of his dwelling and of his blessing.

13 Be silent, O all flesh, before the Lord, for He is raised up out of His holy habitation. — be silent, O all flesh, in a spirit of awe and reverence, before the Lord;

— for he is raised up out of his holy habitation, he is preparing to rise from his throne in heaven to visit the enemies with his righteous punishment and to lead his children to glory.

US making ‘Bioweapons’ in Ukraine

•April 19, 2023 • Leave a Comment

US making ‘bioweapons components’ in Ukraine – Moscow

The evidence are overwhelming, according to the Russian military

RT World News • April 11, 2023 // Irish Sun

The US is using Ukraine to manufacture components for biological weapons, the commander of Russia’s Nuclear, Biological and Chemical Defense Forces told the State Duma on Tuesday. Lieutenant General Igor Kirillov says the Russian military found ample evidence of this in Donetsk, Lugansk and Kherson.

“We have no doubt that the US, under the guise of ensuring global biosecurity, conducted dual-use research, including the creation of biological weapons components, in close proximity to Russian borders,” Kirillov told lawmakers.

He said the military has come to this conclusion after interviewing multiple eyewitnesses and going over some 2,000 pages of documentation found in Kherson Region and the Donetsk and Lugansk People’s Republics. The investigation also involved a parliamentary task force and federal law enforcement.

Moscow raised concerns over a network of secretive US-funded laboratories in Ukraine in the early weeks of the conflict, and has frequently made public evidence about the program ever since. The US government confirmed the existence of the labs last March, but insisted they were neither illegal nor intended for a military purpose, despite the fact that much of their funding went through the Pentagon.

According to Kirillov, the investigation has identified specific individuals involved in the military bio-research in the territory of the US and Ukraine. He also noted that the facts made public by the Russian Defense Ministry have not been disputed.

“No one, including Western countries, has had any doubts about the authenticity of the published documents,” the general said.

Moscow took the biolabs issue to the UN last October, requesting an international probe, but the motion was blocked by the US, UK, and France in the Security Council.

US Cover-Up of Pentagon’s Secretive Bioweapons Labs Poses Global Threat

The program in Ukraine was previously known as ‘Joint biological research’ but has since been rebranded as ‘Biological control research’, according to documents Kirillov presented last week. The US has blamed an alleged “Russian disinformation campaign” for the increased public scrutiny of the biolabs.

“Behold, the eyes of the Lord God are upon the sinful kingdom, and I will destroy it from off the face of the earth, except that I will not utterly destroy the house of Jacob,” saith the Lord. Amos 9:8

“For the day of the Lord is near upon all the nations. As you have done, it shall be done to you; your dealings will return upon your own head” Obadiah 1:15

Leaked: Former Mexican president worked for CIA

•April 19, 2023 • Leave a Comment

France, under Macron, manages to remain free, unlike Britain or even Germany, who have been shouted down by the US to become vassal states. 

Now a former Mexican president has been identified in declassified papers to work for the CIA. Had Mexican presidents been shouted down by the US all over the years? Not the current one, I believe. He seems very capably of fighting back!

RT News • April 17, 2023 // Big News Network

Former Mexican president Jose Lopez Portillo, who led the country from 1976 to 1982, was an asset of the Central Intelligence Agency (CIA), according to a new batch of declassified documents published by the US National Archives.

Among the papers, relating to a CIA probe into the murder of President John F. Kennedy in 1963, was a memo from a meeting of CIA agents on November 29, 1976.

In the discussions, US intelligence official Bill Sturbitts informed his colleagues that “Mexico will soon have a new president, a man who has had control of Liaison for a number of years.”

Lopez Portillo was not mentioned by name in the memo, but the meeting took place just a few days before he officially assumed the presidency.

He had run for office earlier that year as the sole candidate from the Institutional Revolutionary Party, which ruled the country from 1929 to 2000. Lopez Portillo died in 2004 at the age of 83.

‘Mexico is not a US colony!’ Mexico’s President Andrés Manuel López Obrador

The meeting described in the memo was dedicated to the expected release in mid-December 1976 of papers from the CIA’s investigation into Lee Harvey Oswald – the man convicted for JFK’s murder. Oswald had visited Mexico shortly before the fatal shots were fired in Dallas, and US intelligence subsequently carried out a large-scale surveillance and phone-tapping operation in the country.

Authorities concluded that the Marine veteran shot the president from a sixth-floor window in a nearby building as the presidential motorcade was passing by. Oswald denied the accusations, telling the media that he was a “patsy.” He was shot dead two days after JFK’s assassination while in police custody. Oswald’s killer, Jack Ruby, was sentenced to death, but died of lung cancer while in prison.

Sturbitts said during the 1976 meeting that Mexico’s new leader “can be expected not to look favorably upon publicity of that relationship” with the CIA, according to the declassified paper.

Lopez Portillo has become the fourth former Mexican president named as a US intelligence asset. The other three are Luis Echeverria, who was in office between 1970 and 1976, Gustavo Diaz Ordaz (1964-1970) and Adolfo Lopez Mateos (1958-1964).

For more about the South, a prophecy of Esau or Edom, see Obadiah

For more on the enemy from the South, see A Sword from the South!

For more into another Captivity: see Ezekiel Timeline – 190/40 Years

Bolton’s Grand Strategy

•April 18, 2023 • Leave a Comment

Bolton touts ‘grand strategy’ to counter Russia and China, especially China; he would love to take away any social welfare programs and double or even triple the defence budget to finance helping Taiwan to contain Communist China!

RT World News • April 13, 2023 // The Big News network

The notorious ‘hawk’ has floated a plan involving increased arms spending, nuclear tests, and a ‘global NATO’ to defend Taiwan

Former US National Security Advisor John Bolton has urged Washington to implement a new Cold War-style strategy against Russia and China. According to the long-time foreign policy hawk, the West should cut back on social programs to fund military spending, renew testing of nuclear weapons, and provide security guarantees to Taiwan.

Bolton, who served in the administration of President Donald Trump, described his “grand-strategy” approach to geopolitics in a Wall Street Journal column on Wednesday, urging candidates in the 2024 US presidential election to think in the same terms.

The US should have a “contemporary reincarnation” of NSC-68, Bolton argued, referring to the document adopted under President Harry Truman which laid the foundation for militarizing the confrontation with the USSR. He also claimed that in a new Cold War, the US and its allies would be pitted against a Chinese-Russian “axis” and “accompanying rogue-state outriders like Iran and North Korea.”

Bolton named several key points for his proposed strategy, including an immediate increase in military spending to Reagan-era levels, which he claimed should be maintained for the foreseeable future. He also asserted that Western nations should cut back on social spending, because “neither the obese welfare state nor massive income-redistribution schemes protect us from foreign adversaries.”

In addition, Bolton insisted that the US should upgrade its nuclear stockpiles, which would mean “the inevitable need to resume some underground testing.”

“Neither the obese welfare state nor massive income-redistribution schemes protect us from foreign adversaries,” Bolton

Bolton’s plan also advocated the “improvement and expansion” of American military alliances, possibly by making NATO a global organization. This would help “exclude Moscow from regional influence, along with Beijing,” the former official claimed.

The self-governed Chinese island of Taiwan should receive “much more military aid” from Western nations, which should “embed Taipei into collective-defense structures,” Bolton suggested. The recommendation comes despite the Chinese government identifying Taiwanese separatism as a major ‘red line’ which may trigger military action if crossed.

Finally, Bolton urged Washington to prepare for what happens “after Ukraine wins its war with Russia.” He claimed that such an outcome could lead to Russia’s fragmentation, and warned that China would then seize some of its territories, providing it with “direct access to the Arctic, including even the Bering Strait, facing Alaska.”

Moscow has alleged that the conflict in Ukraine is part of a US proxy war against Russia, and that Washington’s goal is to partition the country. The Russian leadership has argued that this threat leaves it with no other option but to succeed in Ukraine.

“Behold, the eyes of the Lord God are upon the sinful kingdom, and I will destroy it from off the face of the earth, except that I will not utterly destroy the house of Jacob,” saith the Lord. Amos 9:8

“For the day of the Lord is near upon all the nations. As you have done, it shall be done to you; your dealings will return upon your own head” Obadiah 1:15

Leaked: China’s new DF-27 missile

•April 18, 2023 • Leave a Comment

France, under Macron, manages to remain free, unlike Britain, who had been shouted down by the US to become a vassal state.

These days, Xi Jinping has followed what Mohammed bin Salman of Saudi Arabia and UAE had done: Don’t pick up the phone!

Now news of another leaked. China ready to unleash terrifying WW3 superweapon invisible to US defences.

“Don’t pick up the phone” might be a hot topic in between meetings during the next Brics+ conference in South Africa comes August, 2023

Express World News • April 14, 2023 // The EurAsian Times

Beijing’s terrifying new arsenal of hypersonic weapons are another bombshell revelation in a series of leaked top secret files.

Leaked documents reportedly show that China has developed a new missile which can evade US defences.

The top secret report by the Joint Chiefs of Staff intelligence directorate, compiled on February 28, shows China’s new DF-27 missile had been the subject of successful testing.

The new device is described as a hypersonic intermediate-range ballistic missile and is part of the Dongfeng series – a group of missiles readymade to deliver nuclear warheads.

According to the leaked report, the weapon “possesses a high probability of penetrating” US ballistic missile defences.

Contents of the February 28 memo was part of an alleged breach by Jack Teixeira, a 21-year-old National Guard member, who was arrested yesterday by the FBI and now faces criminal charges.

Intelligence suggests that the newly crafted missile is capable of flying at more than five times the speed of sound and is described as having a hypersonic glide vehicle.

This means it can shift in flight, making it incredibly difficult to shoot down.

The document noted the DF-27 flew for around 12 minutes, traveling 2,100 kilometers (1,300 miles), The Washington Post reported.

Files claim the “the DF-27 is designed to enhance [China’s] ability to hold targets at risk beyond the Second Island Chain and possesses a high probability of penetrating US” ballistic missile defense.

“I have seen a horrible thing in the house of Israel; there is the whoredom of Ephraim, Israel is defiled” Hosea 6:10

“Shall a trumpet be blown in the city, and the people not be afraid? Shall there be evil in a city, and the LORD hath not done it?” Amos 3:6

ICC: Cash for Justice

•April 17, 2023 • Leave a Comment

Cash for Justice: ICC ‘Flooded’ With Western Government Funds After Issuing Putin Warrant

ICC prosecutor raised millions from NATO states by crafting an arrest warrant for Vladimir Putin while freezing investigations into US and Israeli crimes

Sputnik International ~ April 15, 2023 // The Gray Zone

A new investigation from The Grayzone shows the top ICC prosecutor brought in millions after the legally-questionable court cooked up an arrest warrant for the Russian president, who has been charged with war crimes for having allowed children to be evacuated from a theater of combat.

The International Criminal Court’s prosecutor general, Karim Khan, leveraged the news of his much-publicized ‘arrest warrant’ for Russian President Vladimir Putin to rake in millions of dollars from NATO states, a new report by independent US-based investigative outlet The Grayzone has revealed.

“Through his focus on Ukraine, Khan has presided over a massive surge in Western financial support for his office, with much of the money earmarked for his investigation into Russian officials,” wrote Grayzone editor Max Blumenthal, who pointed out that “the ICC’s issuance of Putin’s arrest warrant happened to coincide with a major donor’s conference for the court in London, England.”

That’s where, with numerous “justice ministers from the UK and UK allies on hand,” $5 million was raised during an event held by the British and Dutch governments in support of “the ICC’s mission to prosecute Russian officials,” the outlet reported.

And it’s not just critical and independent outlets taking notice.

At least one mainstream publication has linked the date with an important ICC fundraiser, implying Khan timed the publication of the warrant to coincide with a donor conference in London for the international court.

But according to the Grayzone, the ICC’s conspicuous fixation with Russia began well before last month’s warrant was issued.

A clear shift in the ICC’s priorities can be traced to the change in leadership that took place in 2021, when Khan replaced then-prosecutor general Fatou Bensouda, who had been slapped with sanctions and had her US visa revoked following her decision to investigate American war crimes in Afghanistan.

How NATO states sponsored ICC prosecutor’s Putin arrest warrant

Following Bensouda’s departure, that investigation was dropped – along with a probe into potential Israeli war crimes committed against Palestinians.

“With its two most contentious investigations out of the way, a clearly pliant figure in the prosecutor’s office, and Russian troops inside Ukraine, the previously battered ICC suddenly experienced a deluge of Western financial support,” the report states.

“Much of the money flowed directly to Khan’s office, with special earmarks for efforts targeting Russian officials,” the outler notes, pointing to comments by a Human Rights Watch official who told a French publication that “in the messaging around the various pledges that were made, states were not always that careful, and they often made the link between their contribution and Ukraine, thus creating this perception of politicization or selectivity in the court’s work.”

Khan has pledged to remain neutral in the ICC investigation, but has made little secret of his sympathies for the Kiev regime, having wrapped up his fourth visit to Ukraine in a single year last month.

While “the Ukrainian military was escalating its attacks on civilian targets throughout the independent Republicans of Donetsk and Lugansk, bombing markets and in one instance, massacring a bus load of commuters with a Tochka-U missile… [and] executing unarmed Russian prisoners of war and shooting them in the knees,” the report notes that Khan “remained studiously disinterested in the documented abuses his official hosts were carrying out right under his nose.”

Instead, “he had his eyes firmly fixed on Putin – and on the generous Western donations that propelled his mission,” the Grayzone report concluded.

“Behold, therefore I will gather all thy lovers with whom thou hast taken pleasure, and all them that thou hast loved, with all them that thou hast hated. I will even gather them round about against thee and will uncover thy nakedness unto them, that they may see all thy nakedness” Ezekiel 16:37

For I will be unto Ephraim as a lion, and as a young lion to the house of Judah; I, even I, will tear and go away; I will take away, and none shall rescue him. Hosea 5:14

Habakkuk (Ch 1-3)

•April 17, 2023 • Leave a Comment

The book of Habakkuk is a dialogue between what the Prophet Habakkuk saw and Questions he had for God and how God responded to him. That is, it is a dialogue between Habakkuk and God about the difficult scene he saw, at a latter day, and why was it the way it was.

The time seems to have been about 610 BC, when the Chaldeans attacked Jerusalem in the ninth month of the fifth year of Jehoiakim, 605 BC. And Habakkuk, a contemporary of the Prophet Jeremiah, spoke of the Chaldeans as about to invade Judah (Habakkuk 1:6), and he seemed to have seen the people’s desperations of their attack that followed; hence he asked many questions. And although the oracle was relevant for his time, it was also prophetic; that is, it is for the endtime.

“For I will work a work in your days” (verse 1:5 below) means that the message of Habakkuk is really for us in the latter days, today. And this is reinforced in Habakkuk 2:3 “For the vision is yet for an appointed time, but at the end it shall speak and not lie. Though it tarry, wait for it, because it will surely come; it will not tarry.”

“The anger of the Lord shall not return, until He has executed and till He has performed the thoughts of His heart; in the latter days ye shall consider it perfectly” Jeremiah 23:20. The crtical statement is “In latter days you will understand it fully,” that is, it means, “you wouldn’t fully understand these prophecies until you are living in the latter days after God had executed his judgement in anger and pertformed the thoughts of his heart!”

Habakkuk 1

Habakkuk made his observations and started them with a series of three Questions:

“The vision is yet for an appointed time.” Habakkuk 2:3 makes clear that this vision was not just for his time, but also for the end-time, and although it had a narrow vision for the house of Judah, its wider implication for the latter days is for the latter days house of Israel; the time shortly before the second coming of the Messiah.

1 The burden which Habakkuk the prophet saw. — the prophet Habakkuk saw, did see, that is, foresee: a burden, the oracle, a grievous calamity or heavy judgment;

— not only in the sense of a message from God, but also in the sense of a heavy weight. It was heavy in its content, because Habakkuk announced the coming judgement on the house of Judah. It was also heavy in its source, because Habakkuk deals with tough questions he brings to God and God’s answer to those questions;

— “for I will work a work in your days” (verse 5 below) means that the message of Habakkuk is meant for us in the latter days, today at the endtime. And this is reinforced in Habakkuk 2:3 “For the vision is yet for an appointed time, but at the end it shall speak and not lie.”

2 O Lord, how long shall I cry, and Thou wilt not hear? Even cry out unto Thee of violence, and Thou wilt not save? — Q (1): O Lord, how long shall I cry, and you will not hear? Q (2): Or cry to you, “Violence!” and you will not come to the rescue?

— Rashi (Rabbi Shlomo Yitzchaki 1040–1105, France): O Lord! How long: Habakkuk foresaw that Nebuchadnezzar was destined to be the ruler of the world and to cause trouble for Israel, as the matter is stated in his prophecy (1:6): “For behold, I raise up the Chaldeans, etc.”

— Habakkuk was asking a series of questions we all have today: when we ask and it seems God is not hearing; and when there is violence, it seems God is not saving! Or cry out to you, “Violence!” and you do not intervene?

3 Why dost Thou show me iniquity, and cause me to behold grievance? For despoiling and violence are before me, and there are those that raise up strife and contention. — Q (3): Why do you make me see wickedness, and cause me to see trouble? Plundering and violence; strife and contention everywhere.

— iniquity, plunder and violence are all before me; you look upon these mischieves, but you do not help; why He seems to see these and leave them unpunished?

4 Therefore the law is slacked, and judgement doth never go forth. For the wicked doth compass about the righteous; therefore wrong judgement proceedeth. —“Judgment” (that is, redress of evils); the law is “slacked” it means the law is powerless; it loses its force and vigour;

— so the first point is that the law is lacking in physical and moral strength! The law is applied weakly to evildoers; those who are guilty are hardly charged for their crimes. Judgement seldom has its enforcement; that there is little justice in the land;

— “the wicked compass about the righteous” means that the wicked surround the righteous, frequently in the form of rioting, to pressure the law-abiding population into accepting their criminal activities. “Therefore wrong judgement proceeds” means that justice is perverted;

— so the Targum says, “the law languishes;” loses its force and vigour.

Remember, the Targum, whose origin was in the Aramaic language, could be traced to Ezra speaking to the returning exiles who couldn’t understand Hebrew, but was expounded to them in a language they could understand.

The Lord’s Answer to Habakkuk’s first series of Questions:

5 “Behold ye among the nations and regard, and wonder marvelously; for I will work a work in your days which ye will not believe, though it be told you. — look among the nations and watch, God said; wonder and be amazed! “For I am doing a work in your days that you would not believe, though it were told you.”

— “ye among the nations” the Jews during Habakkuk’s time were not among the nations (plural); hence this could only referenced the Jews, or the wider Israelites, as being of a different timeframe, they are to be amazed, or terrified, as one being yet-to-be scattered amongst the nations;

— the expression “in your days” tells us that this is a reference to the end-times when they are, again, to be scattered “among the nations” ~ the period preceding the return of the Messiah;

— this Scripture is speaking about very different type of work where people will not accept what is done as being “the work of God” something very extraordinary which the people will not believe, but only “wonder marvelously;”

— a parallel in Isaiah 29:14, “therefore, behold, I will proceed to do a marvelous work among this people, even a marvelous work and a wonder; for the wisdom of their wise men shall perish, and the understanding of their prudent men shall be hidden” which means in the context of those in leadership positions lack wisdom and understanding today; perhaps drunk and incoherent;

— and bear in mind that only then, in the latter days, could we understand fully: “The anger of the Lord shall not return, until He has executed and till He has performed the thoughts of His heart; in the latter days ye shall understand it perfectly” Jeremiah 23:20;

6 For lo, I raise up the Chaldeans, that bitter and hasty nation, which shall march through the breadth of the land to possess the dwelling places that are not theirs. — God is going to send “the Chaldeans” or the Babylonians, that fierce and reckless nation; they will march throughout the earth to take possession of lands that don’t belong to them;

— to possess the dwellingplaces that are not theirs; the cities of Judea, and houses in them, as well as the palaces and dwelling places in Jerusalem, which they had no right unto, but what they got by the sword; or it could be interpreted another way:

— the land that the Jews dwelled in Judea and Jerusalem were actually their given land; already alloted and given during Joshua’s time; but this is talking of “dwelling places that are not theirs;” hence this could only refered to when they are in exile, in captivity.

— Q. Since this is speaking of the endtime, who would these new Chaldeans be?

7 They are terrible and dreadful; their judgement and their dignity shall proceed from themselves. — they “the Chaldeans” will be terrifying and fearsome with they assault, and cruelty with which they use their captives; they will carry out their own kind of justice and honor.

8 Their horses also are swifter than the leopards, and are more fierce than the evening wolves. And their horsemen shall spread themselves, and their horsemen shall come from afar; they shall fly as the vulture that hasten to eat. — they “the Chaldeans” fly like an eagle swooping down to devour;

— their horses will be faster than leopards and quicker than wolves in the evening; or are swifter than the eagles of the heavens. Their riders will gallop along proudly; their riders will come from far away; they will fly like a vulture that swoops down for carcases or its food; or they fly like an eagle swooping down to devour;

— taken historically, these verses can be seen as applying only to the Babylonians who took Judah into captivity; but prophecy are meant to be dual, so when we consider the context that follows, it should be clear that God is using the Babylonian captivity as a type of the yet future great tribulation on all Israel; and particularly on Ephraim, the head of Israel;

— a parallel scene in Ezekiel 20-21 (more details at the end)

9 They shall come all for violence; their faces shall consume as the east wind, and they shall gather the captives as the sand. — they, the “Chaldeans” will all come for violence; every face will be directed forward; they will gather prisoners as innumerable as the sand of the sea; remember, this prophecy is for the latter days;

10 And they shall scoff at the kings, and the princes shall be a scorn unto them. They shall deride every stronghold, for they shall heap up dirt and take it. — the Babylonian soldiers laugh at kings; Jehoiakim as a tributary sovereign; then Zedekiah;

— they make fun of their rulers; they laugh at all their strong walled cities. They build dirt roads up to the top of their walls, then they capture the cities.

11 Then shall his mind change; and he shall pass over, and offend, imputing this his power unto his god.” — imputing this his power; rather, that his might becometh his god; they will move quickly and pass through like the wind. So they will be guilty, because their own strength is their god; made only of stones and wood.

Habakkuk’s Second Series of Questions

Habakkuk wonders why God would use a wicked nation to bring judgement on Judah.

12 Art Thou not from everlasting, O Lord my God, mine Holy One? We shall not die. O Lord, Thou hast ordained them for judgement; and, O mighty God, Thou hast established them for correction. — O Lord God, you’re from eternity, aren’t you?

Q (1) If thou art from everlasting, we are not going to die, are we? O Lord, you have appointed them, a nation more wicked than Judah, for judgement; and you, O Rock, have established them for correction.

— three times Nebuchadnezzar the king of Babylon, described as God’s servant: Jeremiah 25:9, 27:6, 43:10; and thou hast appointed the Chaldeans to execute thy judgments on sinners;

13 Thou art of purer eyes than to behold evil, and canst not look on iniquity. Why lookest Thou upon them that deal treacherously, and holdest Thy tongue when the wicked devoureth the man that is more righteous than he? — the Lord with his eyes of omniscience beholds all things, good and evil, yet your eyes are too pure to look on evil, and you cannot look on wickedness.

Q (2) Why do you look on those who deal treacherously, and hold your tongue when the wicked devours the one who is more righteous than he?

14 And makest men as the fishes of the sea, as the creeping things that have no ruler over them? — you make men like fish of the sea, that is, sufferest them to be used as the fishes of the sea, which are easily taken in the net, like crawling things that have no dignity; to be killed and devoured for food;

15 They take up all of them with the hook; they catch them in their net, and gather them in their drag; therefore they rejoice and are glad. — some they take up as with the angle, one by one; others they catch in shoals, as in their net, and gather them in their drag, their enclosing net;

— the Chaldeans bring all of them up with a hook, they catch them in their net; they gather them in their lootings; therefore they rejoice and are laughing.

16 Therefore they sacrifice unto their net, and burn incense unto their drag, because by them their portion is fat and their meat plenteous. — therefore they sacrifice with their choicest booty and burn incense to their idols which they set in the heart; for by them their portion is extravagant, and their food plentiful;

— there have not indeed been lacking of savage nations, who indeed worshiped their arms; those of old worshiped spears as immortal gods; others designate their bow and arrow as the only beneficent deities whom they worship.

17 Shall they therefore empty their net, and not spare continually to slay the nations? — should these Chaldeans, when they have conquered one nation, and so filled their net with the spoil, carry it to Babylon, and there lay it up, and then proceed to fight against another kingdom and nation and plunder it in like manner?

Q (3) shall they continue to empty their net, and continually kill the nations while not sparing anyone? The Targum asks, “shall he send his armies continually to consume nations, and that without mercy?”

~~~

A Description of the Chaldeans, one from the East an anti-type of one similar coming from the South in the latter days:

“Their horses are swifter than leopards, more fierce than evening wolves. Their horsemen charge on; their horsemen come from afar; they fly like the eagle that hastens to eat,” Habakkuk 1:8

Ezekiel 20:45 Moreover the word of the Lord came unto me, saying,
46 “Son of man, set thy face toward the South, and drop thy word toward the South, and prophesy against the forest of the Southland.
47 And say to the forest of the South: ‘Hear the word of the Lord. Thus saith the Lord God: Behold, I will kindle a fire in thee, and it shall devour every green tree in thee and every dry tree. The flaming flame shall not be quenched, and all faces from the South to the North shall be burned therein.
48 And all flesh shall see that I, the Lord, have kindled it; it shall not be quenched.’”
49 Then said I, “Ah, Lord God! They say of me, ‘Doth he not speak parables?’”
Ezekiel 21:1 And the word of the Lord came unto me, saying,
2 “Son of man, set thy face toward Jerusalem, and drop thy word toward the holy places, and prophesy against the land of Israel;
3 and say to the land of Israel, ‘Thus saith the Lord: Behold, I am against thee, and will draw forth My Sword out of his sheath and will cut off from thee the righteous and the wicked.
4 Seeing then that I will cut off from thee the righteous and the wicked, therefore shall My Sword go forth out of his sheath against all flesh from the South to the North,
5 that all flesh may know that I, the Lord, have drawn forth My Sword out of his sheath. It shall not return any more.’

The Scriptures above are shrouded in cryptic language, and so the Q is: how would such scenarios be played out?

For more about the South, a prophecy of Esau or Edom, see Obadiah

For more on the enemy from the South, see A Sword from the South!

For more into another Captivity: see Ezekiel Timeline – 190/40 Years

Habakkuk 2

1 I will stand upon my watch and set me upon the tower, and will watch to see what He will say unto me, and what I shall answer when I am reproved. — the way Habakkuk says has a sense of arrogance, he was yet to be humbled;

— reproved: that is, how he will respond to my complaint: Habakkuk will stand at his watchtower and station himself; and he will wait and keep watch to see what God will say to him, and what he will answer when he expect himself to be reprimanded.

The Lord’s Answer to Habakkuk’s second series of Questions:

2 And the Lord answered me and said: “Write the vision and make it plain upon tablets, that he may run that readeth it. — here Habakkuk is expecting some message or some instructions from God; and sure enough, God gave him specific instructions, which is: write this message down in big block letters, engraving it, for people to read it;

— it says “that he may run who reads it,” that none would need to make a stop while reading the message, but hold on his course in great haste of fleeing from those terrible times to come who take warning.

3 For the vision is yet for an appointed time, but at the end it shall speak and not lie. Though it tarry, wait for it, because it will surely come; it will not tarry. — for an appointed time; determined and fixed with God, though unknown to men; but where else but the present time;

— a witness for the appointed time, a testimony to the endtime; a prophecy for the latter days at the end; if it seems slow in coming; wait, it’s on its way; it will come right on time. If it delays, wait for it; it will not be delayed;

— a parallel Scripture in Jeremiah:

“The anger of the Lord shall not return, until He has executed and till He has performed the thoughts of His heart; in the latter days ye shall consider it perfectly” Jeremiah 23:20

“In latter days you will understand it fully,” that is, it means as a whole, “you wouldn’t fully understand these prophecies until you’re are living in the latter days after God had executed his judgement in anger and pertformed the thoughts of his heart!”

4 Behold, his soul which is lifted up is not upright in him; but the just shall live by his faith. — look, his soul, the soul of the Chaldæan invader, is lifted up; or be puffed up or arrogant; it is not upright in him; but the just shall live by his faith; yes, not just the NT, but the OT talks of mercy (Ezekiel 39:25) and faith!

5 “Yea also, because he transgresseth by wine, he is a proud man, neither keepeth at home, who enlargeth his desire as hell, and is as death and cannot be satisfied, but gathereth unto him all nations, and heapeth unto him all people. — note well: wine and money deceives; the arrogant rich wouldn’t last;

— God sees the proud man and how the proud man cannot be satisfied; indeed, wine betrays the proud man, who does not stay at home. He enlarges his appetite and like death he is never satisfied;

— they are like cemeteries filled with dead bones; like graveyards filled with corpses. Don’t give people like this a second thought. Woe to the Wicked, soon the whole world will be taunting them.

6 Shall not all these take up a parable against him, and a taunting proverb against him, and say, ‘Woe to him that increaseth that which is not his (how long?) and to him that ladeth himself with thick clay’?

— shall not all these take up a taunt against him, with satire and riddles, and say, “Woe to him who increases what is not his—how long? And to him who loads himself with heavy debts!”

— to him that ladeth himself; woe to him that increaseth that which is not his, substance or goods, not his own, while he burdens himself with amassed treasures gathered by extortion and grievous, unjust gains!

7 Shall they not rise up suddenly that shall bite thee, and awake, that shall vex thee? And shalt thou be for booty unto them? — shall not your debtors rise up suddenly, or shall exact usury from thee? Then you will be their plunder; and those awake shall suddenly oppress you;

— would the Latinos in the United States rise up suddenly and reclaim their land and properties? Wouldn’t the Indians in Britain suddenly rise up and reloot back their lost $45 trillions?

8 Because thou hast despoiled many nations, all the remnant of the people shall despoil thee, because of men’s blood, and for the violence of the land, of the city, and of all that dwell therein. — this threat applies to the Chaldaeans, as well as to Israel; because you Israel have plundered many nations, all the remnant of these nations will plunder you;

— and for the violence of the land, and of the city, and of all that dwell therein: because you did it through warfares, bloodsheds, deceits and violence; of the cities and all of the land where you live in them; it shall return like a boomarang;

— when you visit any museum of the house of modern Israel (London, Paris, New York), you’ll witness lots of plunderings of other nations over the centuries; thus one day “all the remnant of these people will plunder you.”

— and this from the Message Bible: Habakkuk 2:6-8

“‘Who do you think you are—
getting rich by stealing and extortion?
How long do you think
you can get away with this?’
Indeed, how long before your victims wake up,
stand up and make you the victim?
You’ve plundered nation after nation.
Now you’ll get a taste of your own medicine.
All the survivors are out to plunder you,
a payback for all your murders and massacres.

Here is one example of an article by Jason Hickel’s How Britain stole $45 trillion from India (from economist Utsa Patnaik – published by Columbia University Press) and thus funded the industrialisation of Britain. And during the entire 200-year history of British rule, income in India collapsed and millions died needlessly of policy-induced famine. India’s share of world’s GDP went from over 20 percent to less than 2 percent when India won her independence in 1947.

But the plundering of India wasn’t alone; after the British had conquered India, they then went to war with China (the First and Second Opium Wars: 1839–42; 1856–60), “trading opiums” for tea, porcelain and silk, promoting opium smoking as fashionable and resulting a quarter of China’s population hooked on opium. Not satisfied, they, together with the French, went to war again, burnt down Beijing’s Summer Palace after looting its arts and treasures. These plundered treasure are still hidden today by the rich and famous in their lofty homes, a few in their national museums.

Following Christopher Columbus’ voyage in 1492, the Spanish conquistadors arrived in the 15th and 16th century with steel weapons and armor, they plundered the Aztecs and Incas of their gold and silver, as native weapons could not pierce Spanish armor nor could native armor defend against steel swords.

Later they came with rifles, firearms and cannons. In Mexico, conquistadors found great golden treasures, including great discs of gold, masks, jewelry, and even gold dust and bars. In Peru, Spanish conquistador Francisco Pizarro demanded that the Incan Emperor Atahualpa fill up a large room once with gold and twice with silver in exchange for his freedom. The emperor complied, but the Spanish killed him anyway. All in all, Atahualpa’s ransom came to 13,000 pounds of gold and twice that much silver. This did not even count the vast treasures taken later when the Inca capital city of Cuzco was looted.

And following the Mexican-American War that ended in 1848, the United States plundered more than 500,000 square miles (1,300,000 square km) of land from Mexico, expanding US territory by about one-third. Mexico ceded nearly all the territory now included in the US states of New Mexico, Utah, Nevada, Arizona, California, Texas, and western Colorado for $15 million and US assumption of its citizens’ claims against Mexico.

More recently, the Americans “assisted” American museums in acquiring vast quantities of Persian antiquities and archaeological finds; this was the looting of Persia’s mosques and shrines, the transfer of these religious artifacts first, to London, and the subsequent acquisition of some of the objects by such museums as the Metropolitan of New York.

God says He saw all these; and how these Godly Judgements will play out, we’ll have to wait and see; but there is a parallel from the Prophet Ezekiel; and this mystery is an “enemy” coming from the SOUTH:

Ezekiel 20:45 Moreover the word of the Lord came unto me, saying,
46 “Son of man, set thy face toward the South, and drop thy word toward the South, and prophesy against the forest of the Southland.
47 And say to the forest of the South: ‘Hear the word of the Lord. Thus saith the Lord God: Behold, I will kindle a fire in thee, and it shall devour every green tree in thee and every dry tree. The flaming flame shall not be quenched, and all faces from the South to the North shall be burned therein.
48 And all flesh shall see that I, the Lord, have kindled it; it shall not be quenched.’”
49 Then said I, “Ah, Lord God! They say of me, ‘Doth he not speak parables?’”
Ezekiel 21: And the word of the Lord came unto me, saying,
2 “Son of man, set thy face toward Jerusalem, and drop thy word toward the holy places, and prophesy against the land of Israel;
3 and say to the land of Israel, ‘Thus saith the Lord: Behold, I am against thee, and will draw forth My Sword out of his sheath and will cut off from thee the righteous and the wicked.
4 Seeing then that I will cut off from thee the righteous and the wicked, therefore shall My Sword go forth out of his sheath against all flesh from the South to the North,
5 that all flesh may know that I, the Lord, have drawn forth My Sword out of his sheath. It shall not return any more.’

Q: Who is this enemy from the SOUTH, and how would such scenarios be played out? But God says He will kindle a fire and “all the remnant of the people shall despoil thee.”

9 “Woe to him that coveteth an evil covetousness for his house, that he may set his nest on high, that he may be delivered from the power of evil! — woe to him who gets evil gain for his house, that is, greedily seizing enormous wealth, not merely for himself, but for his family, to set his nest on high, an image is from an eagle (Job 39:27); the royal family or dynasty is meant.

10 Thou hast devised shame to thy house by cutting off many people, and hast sinned against thy soul. — instead of bringing honour and glory to their nation, you have given shameful counsel to your house by cutting off many peoples and forfeiting their lives.

11 For the stone shall cry out of the wall, and the beam out of the timber shall answer it. — for the stone will cry out from the wall, from wall of cruelty and oppression, and the beam of the woodwork will answer it.

— from the Message Bible: Habakkuk 2:9-11

“Who do you think you are—
recklessly grabbing and looting,
Living it up, acting like king of the mountain,
acting above it all, above trials and troubles?
You’ve engineered the ruin of your own house.
In ruining others you’ve ruined yourself.
You’ve undermined your foundations,
rotted out your own soul.
The bricks of your house will speak up and accuse you.
The woodwork will step forward with evidence.

12 “Woe to him that buildeth a town with blood, and establisheth a city by iniquity! — “Woe to him who builds a town with blood and sweat of the subjugated nations and establishes a city by cruelty and wickedness!”

13 Behold, is it not of the Lord of hosts that the people shall labor in the very fire, and the people shall weary themselves for very vanity? — is it not the Lord’s will that people labor to fan the flames, and the nations exhaust themselves for vanity?

14 For the earth shall be filled with the knowledge of the glory of the Lord, as the waters cover the sea. — for the earth will be filled with the knowledge of the glory of the Lord, as the waters cover the seas.

15 “Woe unto him that giveth his neighbor drink, that puttest thy bottle to him, and makest him drunken also, that thou mayest look on his nakedness! — “Woe to him who makes his neighbor drink, pouring out your poison until they are drunk, that you may look on their nakedness with the utmost pleasure and delight!”

16 Thou art filled with the shame for glory; drink thou also, and let thy foreskin be uncovered. The cup of the Lord’S right hand shall be turned unto thee, and shameful spewing shall be on thy glory. — you will be filled with shame instead of glory; you yourself—drink and show your own uncircumcision!

— let thy foreskin be uncovered; in retaliation for uncovering the nakedness of others, now let thy own shame of sinning, like king David did with murder of Urioah after adultery with Bathsheba, be laid open before all nations of the world;

— the judgement of the Lord’s right hand will be turned against you; the drunk and those who promote drunkenness loved their own cup full of drink; now a cup of shame after judgement shall be a cup of glory for them;

17 For the violence of Lebanon shall cover thee, and the spoil of beasts which made them afraid, because of men’s blood and for the violence of the land, of the city, and of all that dwell therein.

— since Lebanon was a mountain on the borders of the land of Israel, from whence cedar wood was brought, of which the Temple was built, so the Targum interprets it, “the violence of the house of the sanctuary shall cover thee;”

— the exploitation done to the forest of Lebanon for the house of the sanctuary, this a a type of Christ (and to a certain extent, Israel), will cover you; who because of his blood shed for all men and violence of the land, the desolation of the land of Judea and city of Jerusalem and all who live in them “shall cover thee.”

— and this from the Message Bible: Habakkuk 2:15-17

“Who do you think you are—
inviting your neighbors to your drunken parties,
Giving them too much to drink,
roping them into your sexual orgies?
You thought you were having the time of your life.
Wrong! It’s a time of disgrace.
All the time you were drinking,
you were drinking from the cup of God’s wrath.
You’ll wake up holding your throbbing head, hung over—
hung over from Lebanon violence,
Hung over from animal massacres,
hung over from murder and mayhem,
From multiple violations
of place and people.

18 “What profiteth the graven image that the maker thereof hath graven it, the molten image and a teacher of lies, that the maker of his work trusteth therein to make dumb idols?

— what profit is a carved image when its maker has carved it, their man-make dumb idols, a cast image, and a teacher of lies, that its maker trusts in what he has shaped when he makes graven and molten images?

19 Woe unto him that saith to the wood, ‘Awake!’ To the dumb stone, ‘Arise, it shall teach!’ Behold, it is laid over with gold and silver, and there is no breath at all in the midst of it.

— woe to him who says to the wood, “Awake!” To the silent stone, “Arise!” Can it teach? It is overlaid with gold and silver, but there is no breath at all in any of them;

— and this from the Message Bible: Habakkuk 2:18-19

“What’s the use of a carved god
so skillfully carved by its sculptor?
What good is a fancy cast god
when all it tells is lies?
What sense does it make to be a pious god-maker
who makes gods that can’t even talk?
Who do you think you are—
saying to a stick of wood, ‘Wake up,’
Or to a dumb stone, ‘Get up’?
Can they teach you anything about anything?

20 “But the Lord is in His holy temple; let all the earth keep silence before Him.” — but the Lord is in His holy Temple; He is on His Throne; not in graven and molten images; not in idols of wood and stone, covered with gold and silver;

— or, as the Septuagint renders it, stand in awe, or stand in fear before him; let all the earth keep silence before Him;

— therefore the whole earth, that is, all the population of the earth, of every tribe and tongue, is to be still before Him: to submit silently to Him, and wait for His judgement;

— the point of this verse is that even though terrible times lie around, God is always in full control; the ultimate outcome will be exactly what God predicted; that is, that all question has a full and adequate answer before a God of Omniscience, Omnipresence and Omnipotence.

Habakkuk 3

A prayer of Habakkuk the prophet: The first two chapters of Habakkuk presented the prophet’s question and answer time with God. Now that the Lord had answered Habakkuk, the prophet offered a prayer of praise and thanksgiving to God “in wrath remember mercy” before keeping silence before Him and close the book.

1 A prayer of Habakkuk the prophet upon “Shigionoth.” — this may be interpreted (by Ezra) according to the Targum: a prayer of Habakkuk because of his ignorance; concerning his errors of judgement:

— however, according to the apparent meaning, Habakkuk is begging for mercy for himself because he spoke rebelliously: (1: 4) “Therefore Torah is slackened,” and (verse 14) “You have made man like the fish of the sea.” Habakkuk also criticized the Divine standard of justice.

— Job, too, repented of his sin for questioning God; earlier, Job had stated that he had lived righteously before God and was undeserving of God’s punishment, as if God was unjust in his treatment of him:

“Who is he that hideth counsel without knowledge? therefore have I uttered that I understood not; things too wonderful for me, which I knew not. Hear, I beseech thee, and I will speak: I will demand of thee, and declare thou unto me. I have heard of thee by the hearing of the ear: but now mine eye seeth thee. Wherefore I abhor myself, and repent in dust and ashes.” Job 42:3-6.

2 O Lord, I have heard Thy speech and was afraid; O Lord, revive Thy work in the midst of the years. In the midst of the years make it known; in wrath remember mercy. — O Lord, revive Your work in the midst of the years: Habakkuk simply prayed for revival, knowing how God once worked and how His people once responded, and he wanted to see that again;

— this prayer of Habakkuk shows us that repentence is a work of God, not the achievement of man; there is something man can and must do for repentence; simply crying out to God and pleading for his mercy;

— notice the prayer: “revive thy work” – often, our prayers are really “revive my or our work,” but we must have a heart and mind for God’s work, far bigger than our portion of it;

— in wrath remember mercy: Habakkuk prayed, knowing well that they didn’t deserve revival, so he prayed for mercy. The idea is, “Lord, I know that we deserve your wrath, but in the midst of your wrath remember mercy.”

3 God came from Teman, and the Holy One from Mount Paran [with everlasting might, Chabad Bible]. Selah. His glory covered the heavens, and the earth was full of His praise.

— Teman: Esau; Paran: Ishmael, as Scripture states (Genesis 21:21): “And he (Ishmael) dwelt in the desert of Paran.”

— having rejected Ismael and Esau, he came to the house of Jacob; or God’s might and wrath could possibly come from Teman (Esau) and Mount Paran (Ismael)?

— Selah; “stop and think.” Oh ye house of Jacob; stop and ponder: his glory covered the heavens, and the earth was full of his praise: All creatures bow down to him!

4 And His brightness was as the light; He had horns coming out of His hand, and there was the hiding of His power. — Oh house of Jacob; stop and ponder:

— God appeared in unparalleled splendour which shined from him, was as the light; pure, clear as the sun, but much more dazzling and overcoming.

5 Before Him went the pestilence, and burning coals went forth at His feet. — Covid-19 has been spreading around the globe; first the Delta variant, then the Omicron; and who knows what’s next? Could Covid-19, or another bioweapon, destroys a third of mankind eventually?

— and sparks went out at his feet: fiery angels came with him to witness the affairs of the heavens and earth. Could “burning coals” went forth at his feet be civil wars within nations? Witness the numerous civil strives within many western nations because of the various issues of how to manage Covid.

6 He stood and measured the earth; He beheld and drove asunder the nations; and the everlasting mountains were scattered, the perpetual hills did bow. His ways are everlasting.

— He stood and judged the earth; he looked and shook the nations; as he did at Mount Sinai, now the whole world is experiencing it; the everlasting mountains were scattered: Ephraim and the other twelve, the heavenly princes of the nations; all are either scattered or bow low.

7 I saw the tents of Cushan in affliction; and the curtains of the land of Midian did tremble. — the curtains… quaked: all is to be understood according to the Targum.

8 Was the Lord displeased against the rivers? Was Thine anger against the rivers? Was Thy wrath against the sea, that Thou didst ride upon Thine horses and Thy chariots of salvation? — Habakkuk was asking another series of Questions: asking the question thrice, Was the Lord displeased against the rivers?

— was thy wrath kindled against the rivers? in the Nile, the Red Sea and the Jordan? God meant more by these acts; he showed his supremacy over all creation, and these rivers are no problem in the execution of his great design (Psalm 106:9; Psalm 114:3);

~ a Parallel in Ezekiel 6:3 on mountains, hills and rivers ~

— this message to the “mountains of Israel;” these mountains refer to the United States, UK and France. . . . “and to the hills, to the rivers and to the valleys;” the hills: Ireland, Switzerland and the Scandinavian countries: Denmark, Norway, and Sweden, Finland, and Iceland; and the valleys, the low countries: Belgium, the Netherlands, and Luxembourg;

— and to the rivers; where during the nineteenth century, the British Royal Navy were known to “Rule the Waves;” and the United States having been plowing up and down the five oceans with her Seven Fleets since the British left the scene.

9 Thy bow was made quite naked according to the oaths of the tribes, even Thy word. Selah. Thou didst cleave the earth with rivers. — your bow revealed itself: your might being revealed; thy bow was made quite naked; that is, the sheath of the bow was laid aside to make it ready for use;

— Rashi: You split the earth into rivers: according to the Targum, “for thou didst break strong rocks, rivers came forth overflowing the earth.”

10 The mountains saw Thee and they trembled; the overflowing of the water passed by; the deep uttered his voice and lifted up his hands on high. — the mountains saw thee, and they trembled; literally, were in pain, Septuagint, the words point to the phenomena of an earthquake, as Sinai shook at the presence of the Lord (Exodus 19:18; Psalm 114:6);

— there is a similar scene at the end-time in Isaiah: where, not just the Israelites, every being will have a Mt Sinai experience: the earth shall reel to and fro like a drunkard; the land utterly emptied! “The earth shall reel to and fro like a drunkard, and shall be removed like a cottage; and the transgression thereof shall be heavy upon it; and it shall fall, and not rise again” Isaiah 24:20

11 The sun and moon stood still in their habitation; at the light of thine arrows they went, and at the shining of Thy glittering spear. — as a similar scene in Isaiah 60:19‘: ‘the sun shall be no more for thy light by day, neither for brightness shall the moon give light unto thee, and the Lord shall be to thee an everlasting light.’”

12 Thou didst march through the land in indignation; Thou didst thresh the heathen in anger. — Habakkuk says, in fury you walkest through the earth, in wrath you stampest down the nations, both Israelites and others.

13 Thou wentest forth for the salvation of Thy people, even for salvation with Thine Anointed. Thou wounded the head out of the house of the wicked, by uncovering the foundation unto the neck. Selah. — Habakkuk says you went forth for the salvation of your people, for salvation with your Anointed:

— Selah; “stop and think.” Oh house of Judah; stop and ponder; don’t be stiff-necked: as Habakkuk remembered how God had saved in the past; this made him full of faith for what God could do in the present and in the future.

— He also declared that salvation is brought with your Anointed – and the Lord’s Anointed is none other than the Messiah (Isaiah 52:13 Targum says God’s suffering servant is the Messiah), Jesus Christ; others call him Yeshua (for Christmas is rightly called “the Mother of all paganism”).

Remember, the Targum, whose origin was in the Aramaic language, could be traced to Ezra speaking to the returning exiles who couldn’t understand Hebrew, but was expounded to them in a language they could understand.

14 Thou didst strike through with his staves the head of his villages; they came out as a whirlwind to scatter me; their rejoicing was as to devour the poor secretly. — Thou, O God, didst strike through with his staves;

— others interpret of Pharaoh and his host, who were destroyed by the steps and methods which they themselves took, going into the sea of themselves, and so were struck through with their own staves:

15 Thou didst walk through the sea with Thine horses, through the heap of great waters. — the gists of this interpretation rests upon the fact of the destruction of Pharaoh and his horsemen in the Red Sea.

16 When I heard, my belly trembled; my lips quivered at the voice. Rottenness entered into my bones, and I trembled in myself, that I might rest in the day of trouble. When he cometh up unto the people, he will invade them with his troops.

— when Habakkuk heard God’s voice, his body trembled: he showed the righteous response of man under the sovereign power of God, recognizing his own weakness and low standing before this God of all majesty and power;

— the Babylon king Nebuchadnezzar will invade him with his troops: the prophet Habakkuk remembered that the Babylonians were coming, and that this God of sovereign power and majesty would direct their work against Judah.

17 Although the fig tree shall not blossom, neither shall fruit be in the vines, the labor of the olive shall fail, and the fields shall yield no meat, the flock shall be cut off from the fold, and there shall be no herd in the stalls—

— the prophet Habakkuk depicts the effects of the hostile invasion, which are such as to make the natural heart despair; though the fig tree may not blossom, no fruit on the vines; nor fruit on the vines;

— though the labor of the olive may fail, and the fields yield no food; though the flock may be cut off from the fold and there be no herd in the stalls; yet Habakkuk will still rejoice in the Lord, whom he knows, has full control from His throne;

18 yet I will rejoice in the Lord, I will be joyful in the God of my salvation. — Habakkuk will rejoice in the God of his salvation: in a vision, he saw the Judean countryside desolate, perhaps from the invading Babylonian army or perhaps from natural calamity;

— sometimes when we see a day of trouble approach, we think, “If God is so great and powerful, how come we’re going through a hard time?” Habakkuk knew this was the wrong question and the wrong attitude; instead, he said: “I know you are strong and mighty, and if we are in desolate circumstances it is because we deserve it. I will praise You still, and even rejoice in You.”

— but in the midst of this almost complete loss, the cities and countryside desolate, Habakkuk could still rejoice in the Lord.

19 The Lord God is my strength; and He will make my feet like hinds’ feet, and He will make me to walk upon mine high places. To the chief singer on my stringed instruments.

— the Lord God is my strength: Habakkuk could only properly declare this after he prayed the prayer of faith in the previous verses. He rightly declared that his strength was not in fig trees or vines or fields or flocks, but only in the Lord God;

— Habakkuk’s prayer could also be adapted as a song of prayer and/or a prayer of reflection. Selah!

In summary, the theme of Habakkuk is “For the vision is yet for an appointed time, but at the end it shall speak and not lie. Though it tarry, wait for it, because it will surely come; it will not tarry,” Habakkuk 2:3.; and we wouldn’t fully understand until the anger and God’s judgement had passed in the latter day; then and only then will we be able to understand fully:

“The anger of the Lord shall not return, until He has executed and till He has performed the thoughts of His heart; in the latter days ye shall consider it perfectly” Jeremiah 23:20; “In latter days you will understand it fully,” that is, it means as a whole: “we wouldn’t fully understand these prophecies until we are living in the latter days after God had executed his judgement in anger and pertformed the thoughts of his heart!” Selah!

For more about the South, a prophecy of Esau or Edom, see Obadiah

For more on the enemy from the South, see A Sword from the South!

For more into another Captivity: see Ezekiel Timeline – 190/40 Years

Rand: How to Destroy Russia!

•April 16, 2023 • 1 Comment

France, under Macron, manages to remain free, unlike Britain, who had been shouted down by the US, has became a vassal state, now lack of dignity or respect for itself. For further study, see

More on (1) Ephraim / The United States; (2) Ephraim and Manasseh

For more on the Ox without the Unicorn

How to Destroy Russia. 2019 Rand Corporation Report: “Overextending and Unbalancing Russia”


Global Research by Manlio Dinucci ~ March 26, 2023 // Rand Corporation

Today’s Russia suffers from many vulnerabilities—oil and gas prices well below peak that have caused a drop in living standards, economic sanctions that have furthered that decline, an aging and soon-to-be-declining population, and increasing authoritarianism under Vladimir Putin’s now-continued rule.

According to their analysts, Russia remains a powerful adversary for the United States in certain fundamental sectors. To handle this opposition, the US and their allies will have to pursue a joint long-term strategy which exploits Russia’s vulnerabilities. So Rand analyses the various means with which to unbalance Russia, indicating for each the probabilities of success, the benefits, the cost, and the risks for the US.

Rand analysts estimate that Russia’s greatest vulnerability is that of its economy, due to its heavy dependency on oil and gas exports. The income from these exports can be reduced by strengthening sanctions and increasing the energy exports of the United States. The goal is to oblige Europe to diminish its importation of Russian natural gas, and replace it by liquefied natural gas transported by sea from other countries.

Another way of destabilising the Russian economy in the long run is to encourage the emigration of qualified personnel, particularly young Russians with a high level of education.

In the ideological and information sectors, it would be necessary to encourage internal contestation and at the same time, to undermine Russia’s image on the exterior, by excluding it from international forums and boycotting the international sporting events that it organises.

In the geopolitical sector, arming Ukraine would enable the US to exploit the central point of Russia’s exterior vulnerability, but this would have to be carefully calculated in order to hold Russia under pressure without slipping into a major conflict, which it would win.

In the military sector, the US could enjoy high benefits, with low costs and risks, by increasing the number of land-based troops from the NATO countries working in an anti-Russian function.

The US can enjoy high probabilities of success and high benefits, with moderate risks, especially by investing mainly in strategic bombers and long-range attack missiles directed against Russia.

Leaving the INF Treaty and deploying in Europe new intermediate-range nuclear missiles pointed at Russia would lead to high probabilities of success, but would also present high risks.

By calibrating each option to gain the desired effect – conclude the Rand analysts – Russia would end up by paying the hardest price in a confrontation, but the US would also have to invest huge resources, which would therefore no longer be available for other objectives. This is also prior warning of a coming major increase in US/NATO military spending, to the disadvantage of social budgets.

This is the future that is planned out for us by the Rand Corporation, the most influential think tank of the Deep State – in other words the underground centre of real power gripped by the economic, financial, and military oligarchies – which determines the strategic choices not only of the US, but all of the Western world.

The “options” set out by the plan are in reality no more than variants of the same war strategy, of which the price in sacrifices and risks is paid by us all.

“For the day of the Lord is near upon all the nations. As thou hast done, it shall be done unto thee: thy reward shall return upon thine own head” Obadiah 1:15

“The crown of pride, the drunkards of Ephraim, shall be trodden under feet” Isaiah 28:3

Chinese ‘carrier killer’ missile worries US

•April 16, 2023 • Leave a Comment

Chinese ‘carrier killer’ missile (DF-17) worries US – Washington Post

Chinese ‘carrier killer’ missile, DF-17, worries US

RT News ~ April 13, 2023 // Washington Post

The Pentagon leaks have revealed Washington’s concerns over a hypersonic-capable weapon

A new Chinese missile may be able to reach the Pacific island of Guam, making it more difficult for US forces based there to intervene on behalf of Taiwan, a Washington Post columnist claimed on Thursday. The article cited an “overlooked” revelation in one of the classified documents leaked from the Pentagon.

“China is quickly improving its capacity to strike thousands of miles from its shores and prevent the United States from intervening,” wrote Josh Rogin, citing the conclusions of US intelligence agencies.

The document Rogin is referring to is a report by the Joint Chiefs of Staff intelligence directorate, marked top secret and dated February 28. It briefs the generals on the February 25 test of the new “hypersonic intermediate-range ballistic missile,” dubbed DF-17 (Dongfeng, ‘East Wind’).

The briefing says that DF-17 has a “high probability of penetrating” US missile defenses and is designed to reach targets beyond the Second Island Chain, a Pentagon term for a line in the Pacific stretching from Japan to New Guinea.

The test involved the missile traveling a distance of 2,100 kilometers (1,305 miles) over 12 minutes, but a 2021 Pentagon assessment believes DF-17 may have a range of up to 8,000 kilometers (4,970 miles). The new missile also has “hypersonic glide” capability, making it a better “carrier killer” than its predecessors, Rogin noted.

“If American ships can be held at bay and US forces in Asia can be targeted at will, any allied intervention in Taiwan’s defense would be more difficult and costly,” Rogin wrote.

The self-described “neoliberal” columnist and CNN political analyst argued that “peace in Asia depends on maintaining the credibility of the United States-led deterrent.” The US and its allies, Rogin wrote, need to “shift resources to nullify the new threat and shore up their ability to protect their assets.” How exactly that might be achieved, however, he did not say.

The US government has not officially confirmed the authenticity of the leaked documents, and has launched a manhunt for their source. Most of the initially released files dealt with the Ukraine conflict, while subsequent revelations expanded their scope. Israeli and South Korean officials have already denounced some of the claims in the documents as false.

“Behold, the eyes of the Lord God are upon the sinful kingdom, and I will destroy it from off the face of the earth, except that I will not utterly destroy the house of Jacob,” saith the Lord. Amos 9:8

“For the day of the Lord is near upon all the nations. As you have done, it shall be done to you; your dealings will return upon your own head” Obadiah 1:15

A Difference of 243 Years!

•April 15, 2023 • Leave a Comment

There is a Difference of 243 Years between the Secular Calendar and the Jewish Calendar! This year is 2023 AD but in the Jewish Calendar is 5783.

By using the year 6000 as the point of reference since creation, we are already off by 26 (23 plus 3) years, whereas Jewish Calendar are 217 years behind, making a total of 243 years difference. So where could we reconcile the discrenpancies?

This presentation from Archbishop Ussher viewpoint is an attempt to reconcile the difference; but is this correct?

Did the Jewish sages falsify the record for the Persian reign of 207 years to a mere 52/53 years (a difference of 165 years)?

“Annals Of The World by James Ussher – Part #2”

Appendix G: “The Seder Olam Rabbah” (Why Jewish Dating Is Different) or the “Book of the Order of The World,” was compiled by Rabbi Yose ben Halafta (who died 160 AD), and is to this day the traditional Jewish chronology.

From this ancient work, the Jewish people reckon the current year [2023 AD as 5783] and understand it to be the number of the years since the creation. [compare to James Ussher’s work published in 1658, a time gap difference of 1,500 years]

At the time the Seder Olam was compiled, the Jews generally dated their years from 312 BC – the beginning of the Seleucid era. For the next few centuries, the Seder Olam was of interest exclusively to only students of the Talmud.

When the center of Jewish life moved from Babylonia to Europe during the 8th and 9th centuries AD, calculations from the Seleucid era became meaningless. Over those centuries, it was replaced by that of the anno mundi era (AM = “from the creation of the world”) of the Seder Olam. From the 11th century, anno mundi dating became dominant throughout most of the world’s Jewish communities.

As Old Testament Scripture is the basis for Seder Olam dating, we would suppose the Jewish chronology to be similar to that of Ussher’s and thus expect them to place the creation date around 6,000 years ago. Yet rather than 4004 BC, the Seder Olam places creation at 3761. The question thus becomes: On what basis do the Jews number their years such that a 243 year shortfall occurs?

The Missing Years:

1. From the creation to the birth of Abraham: Ussher has – 2008 years from, 4004-1996 BC;  Seder Olam has – 1948 years from, 3761-1811 BC (exclusive reckoning) a shortfall of 60 years. – Terah was 130 years old rather than 70 when Abraham was born. (Gen. 11:26 says, “Terah lived 70 years and begot Abram,” it doesn’t say he was 70 when he was born. Gen. 11:32 and 12:4 say, “Terah was 205 when he died in Haran and Abram was 75 when he departed from Haran with Lot.” So, 205 minus 75 equals 130. Thus the first deficit is about 60 years.

2. From the birth of Abraham to the Exodus from Egypt: Ussher has – 505 years from, 1996 – 1491 BC;  Seder Olam has – 500 years from, 1811 – 1311 BC, a shortfall of 5 years. – Abraham was 75 years old when the covenant was made in Gen. 12:4, the Exodus was 430 years later, Gal. 3:17, “The covenant that was confirmed before by God in Christ, the law, which was 430 years after cannot annul that it should make the promise of no effect.” Exodus 12:40-41 says, “Now the sojourning of the children of Israel, who dwelt in Egypt [and Canaan] was four hundred and thirty years. And it came to pass at the end of four hundred and thirty years, even the very same day it came to pass, that all the hosts of the LORD went out from the land of Egypt.” Without New Testament revelation for clarification, the Seder Olam reckons five fewer years. The shortfall now totals 65 years.

3. From the Exodus to the laying of the Temple foundation, I Kings 6:1, “And it came to pass in the four hundred and eightieth year after the children of Israel were come out of the land of Egypt, in the fourth year of Solomon’s reign over Israel, in the month of Ziv, which is the second month, that he began to build the house of the LORD.” Ussher has – 480 years from, 1491 – 1012 BC (inclusive reckoning);  Seder Olam has 480 years from, 1311 – 831 BC, a shortfall of 0 years. As there is no difference the total shortfall remains at 65 years.

4. From the foundation of the first Temple to the consecration of the second Temple: Ussher has – 497 years from, 1012 – 515 BC;  Seder Olam has 480 years from, 831 – 351 BC, a shortfall of 17 years. – Differing decisions in placing the dates of the kings of Israel with respect to the kings of Judah during the period of the divided monarchy account for these 17 years.  Thus far, the Seder Olam reckons 82 (65+17) fewer years difference over a 3,489 year span (4004-515) from creation to the consecration of the second Temple of which the major part concerns the age of Terah at Abraham’s birth.

5. From the consecration of the second Temple to its destruction by Titus of Rome: Ussher has – 584 years from, 515 BC – 70 AD;  Seder Olam has 420 years from, 351 BC – 70 AD, a shortfall of 164 years. – Here we see the main source of the discrepancy found in the Seder Olam’s shorter chronology. Its 420 years are divided into spans of 34, 180, 103, and 103 years of successive foreign rule over Israel. As shown in that which follows, it is remarkable that the 164 year span disparity is almost entirely from within the first or Persian period, which follow. The remaining three periods closely approximate that of the standard chronology.

a) 34 years (351-317 BC) for the remainder of the Persian rule over Israel: from the dedication of the second temple to Ptolemy I Soter’s invasion of Jerusalem (Ptolemy I was one of Alexander the Great’s favorite generals; also called Soter or Saviour, 367?-283 BC. After Alexander’s death in 323, he seized Egypt as his share of the divided Greek empire and assumed the title, “King of Egypt”).

b) 180 years (317-137 BC) for the Grecian rule: from Ptolemy’s invasion to the times when Simon the Maccabean became ruler in Israel and Rome recognized the independence of the Jewish state.

c) 103 years (137-34 BC) for the rule of the Hasmonean (Maccabean) family in Israel: from Simon to the beginning of the reign of Herod the Great.

d) 103 years (34 BC-70 AD) for the Herodian rule until the destruction of the temple.

There is some discrepancy with the standard dates in the later three periods  (b, c & d). The standard date for Alexander’s defeat of Darius is 331 BC rather than the Seder Olam’s 321. It gives Simon’s rule as beginning in 142 BC (not 137) and Herod’s in 37 BC (not 34).

But what are we to understand from (a) where the Seder Olam only allows 34 years for the remainder of the Persian period? Indeed, by Seder Olam reckoning there are only 30 years from the dedication of the second temple to Darius’ defeat at the hands of Alexander in 321 BC and merely four years after that unto Jerusalem’s capture by Ptolemy following Alexander’s death.

Moreover, here the two systems exhibit a striking contrast. The Ptolemaic chronology lists eight Persian kings from Darius I Hystaspes to Darius III Codomannus, the king whom Alexander overcame. However, the Seder Olam identifies the Darius who was reigning during the dedication of the second temple as the same Darius that Alexander defeated.

Recording only five Persian monarchs, Seder Olam gives the following chronology for its 52/53 year depiction of Persian history:

1. Darius the Mede reigns 1 year – 3389 – 3390 AM (374 – 373 BC) Babylon is conquered and Daniel is in the lion’s den.

2. Cyrus reigns 3 years – 3390 – 3392 AM (373 – 371 BC, inclusive) The Jews return and the second temple construction begins.

3. Artaxerxes (Cambyses) reigns one-half of a year – 3393 AM (370 BC) Temple construction halted.

4. Ahasuerus reigns 14 years – 3393 – 3407 AM (370 – 356 BC) Esther is chosen queen and Esther bears Darius the Persian.

5. Darius the Persian reigns 35 years – 3407 – 3442 AM (356 – 321 BC) Temple construction resumes, 3408 AM (355 BC); Second Temple dedicated 3412 AM (355 BC); Ezra comes to Jerusalem 3413 AM (350 BC); Nehemiah comes to Jerusalem 3426 AM (337 BC); Darius defeated by Alexander 3442 AM (321 BC).

Thus the Seder Olam depicts the Kingdom of Persia as lasting a mere 53 years from 374 to 321 BC, rather than about 207 years from 538 to 331 BC. [Wikipedia: from 559 to 330, a reign of 229 years]

Indeed, it is manifestly apparent that the real reasons for the deliberate altering of their own national chronology in the Seder Olam were: (1) To conceal the fact that the Daniel 9:25 prophecy clearly pointed to Jesus of Nazareth as its fulfillment and therefore the long awaited Messiah; and (2) To make that seventy week of years prophecy point to Simon bar Kokhba!

The Rabbis in the century immediately following Christ Jesus had a tremendous problem with so direct a prophecy as Daniel 9:24-27. This chapter speaks of Messiah’s appearing 69 “weeks” (i.e. 69 sevens) or 483 years after the going forth of a commandment to restore and to rebuild Jerusalem and its walls.

By removing the 164/165 years from the duration of the Persian Empire, Rabbi Halafta was able to make the 483 year Daniel 9:24-27 prophecy fall reasonably close to the years prior to the 132 AD revolt during which Bar Kokhba rose to prominence as Israel’s military and economic leader.

Then with Akiva proclaiming, “This is the King Messiah” followed by “all the contemporary sages regarding him as the king Messiah, ” the Jewish populace united behind their messianic hope.

Rabbi Halafta and his fellow compilers of the Seder Olam sought to terminate the 69 “weeks of years” as close to the 132 AD revolt as possible, but they were limited as to where they could make “the cuts.” Since the Daniel 9:24-27 prophecy dealt with a decree that was biblically and historically issued by a Persian monarch, this left only the Persian period of history for them to exploit.

The Persians had been so hated by the Greeks and later by the Moslems that these two conquerors destroyed nearly all the Persian records. This has created great difficulty in recovering their sequence of kings, the length of their reigns, and thereby their chronology. Thus, the Persian period was readily vulnerable to manipulation.

This article is an extract mostly copied from Archbishop James Ussher’s book, “The Annals of the World,” Appendix G: the Seder Olam Rabbah – Why Jewish dating Is Different.”

“The Annals of The World” by ‘Archbishop James Ussher’  10/29/12 Part #1

Some observations with this paper:

(1) The Jewish Calendar might not be perfect, perhaps there could be errors; but our Secular Calendar is already 27 years off the cliff; this paper is not a comprehensive attempt to rectify al possible errors; but to highlight various points;

(2) The compression of the Persian Empire as a deliberate altering of their chronology to a mere 52/53 years seems legitimate; as most empires reign around two to three hundred years;

(3) Another difficulty with this paper is that the Bar Kokhba revolt ended in failure in 136 AD while Rabbi Yose ben Halafta work on the Jewish Calendar was around 150 to 160 AD, some 20 years later, hence he would have amble time to reflect that Bar Kokhba wasn’t fulfilling the Messianic prophecy of Daniel 9:25-27. So why would he falsify the record as alleged?

(4) Daniel 9:24-27 tells us that Israel’s Messiah had to come before the destruction of their Temple and that happened in 70 AD, so if it wasn’t Jesus of Nazareth who began his preaching in 27 AD then who was it?

Failing with Bar Kokhba for an explanation, modern Rabbinic Jews and Rabbi Tovia Singer identify this “annointed” as Cyrus, Isaiah 45:1. Cyrus maybe God’s annointed but certainly he just couldn’t be the “Most Holy” Daniel 9:24.

To honour Cyrus as the “Most Holy” would be blemphemous. Further, Daniel 9 is a prophecy for a future “in the last days” which Daniel couldn’t figure out as he was dazzed and puzzled!

Egypt To Send 40,000 Rockets To Russia

•April 14, 2023 • Leave a Comment

Egypt Secretly Planned To Send 40,000 Rockets To Russia: Leaked Doc

ZeroHedge by Tyler Durden ~ April 12, 2023

Egypt is typically closely behind Israel in terms of countries receiving the highest amount of US foreign aid each year. For example a State Department fact sheet has reviewed that “Since 1978, the United States has provided Egypt with over $50 billion in military and $30 billion in economic assistance.”

This is why the US administration was likely livid when it learned that Washington’s ally, President Abdel Fattah El-Sisi, was moving to ship tens of thousands of rockets to Russia as the Kremlin executes its war in Ukraine.

The revelation came via the trove of classified Pentagon files leaked online, and which is now subject of widespread reporting. The Washington Post, which has seen the leaked slide, said that Sisi recently ordered production of up to 40,000 rockets to be covertly shipped to Russia.

The top secret document is dated to Feb. 17 of this year, and purports to summarize conversations between the Egyptian president and his senior military officials. Artillery rounds and gunpowder are also mentioned. 

“In the document, Sisi instructs the officials to keep the production and shipment of the rockets secret ‘to avoid problems with the West,'” the Washington Post writes.

Indeed, countries like Egypt caught shipping weapons into Russia would not only prove highly embarrassing, but could possibly trigger US sanctions on Cairo, or at least the freezing of defense aid to the country.

Per the report, “The Washington Post obtained the document from a trove of images of classified files posted in February and March on Discord, a chat app popular with gamers. The document has not been previously reported.”

Egypt’s Foreign Ministry has predictably denied and downplayed the document, with FM spokesman, Ambassador Ahmed Abu Zeid, saying “Egypt’s position from the beginning is based on noninvolvement in this crisis and committing to maintain equal distance with both sides, while affirming Egypt’s support to the U.N. charter and international law in the U.N. General Assembly resolutions.”

Some pundits have pointed out that Russia is running up against its own military supply shortages, or at least expects to run low, after a year of waging war in Ukraine…

“Behold, therefore I will gather all thy lovers with whom thou hast taken pleasure, and all them that thou hast loved, with all them that thou hast hated. I will even gather them round about against thee and will uncover thy nakedness unto them, that they may see all thy nakedness” Ezekiel 16:37

For I will be unto Ephraim as a lion, and as a young lion to the house of Judah; I, even I, will tear and go away; I will take away, and none shall rescue him. Hosea 5:14

PISA 2018: the Top Rates Countries

•April 14, 2023 • Leave a Comment

China has a “stunning lead” over the US. “China rocks in my opinion” Elon Musk

“China is a sleeping giant. Let her sleep because when she wakes up, it will shake the world” Napoleon.

TECHSPOT: In a nutshell: The Biden administration might be limiting China’s ability to manufacture advanced chips, but according to an independent think tank, the Asian nation is still ahead of the US when it comes to research in 37 out of 44 crucial and emerging technologies, including AI, defense, and key quantum tech areas.

Insider reports that the Canberra-based Australian Strategic Policy Institute (ASPI) believes China has a “stunning lead” over the US when it comes to high-impact research across the majority of critical and emerging technology domains.

ASPI lists some of the areas where China leads the US as defense, space, robotics, energy, the environment, biotechnology, artificial intelligence, advanced materials, and key quantum technology areas.

China has a “stunning lead” over the US

The think tank notes that for some of these technologies, the ten leading research institutions are based in China and are collectively generating nine times more high-impact research papers than the second-ranked country, which is usually the US. What could be especially worrying for America is that two areas where China really excels are Defense and space-related technologies. ASPI writes that China’s advancements in nuclear-capable hypersonic missiles took the US by surprise in 2021.

How is China so far ahead? Some of it is down to imported talent. The report notes that one-fifth of its high-impact papers are being authored by researchers with postgraduate training in a Five-Eyes country (Australia, Canada, New Zealand, the United Kingdom, and the United States). However, most of China’s progress comes from deliberate design and long-term policy planning by President Xi Jinping and his predecessors.

~~~~

Concept art of a futuristic Chinese nuclear-powered aircraft carrier ~ AsiaTimes

As of 2022, the PLA-N was the world’s largest navy with 340 ships; the US Navy, in comparison, has only 280 ships. China also has 13 naval shipyards, with each facility having more capacity than all seven US naval shipyards combined.

A Study Index of Daniel

•April 14, 2023 • Leave a Comment

A Study Index of Daniel

Although Jewish authorities acknowledge this book of Daniel is a Sacred Text, they regarded it only among the Writings but not among the Prophets. They just dislike what Daniel had written, throwing out their contempt by kicking his writing and its prophecy downstair.

The greatest of the Prophets, Daniel’s writing is a prophecy of the coming Messiah, yet Jews pray everyday at the Wailing Wall for the coming of the Messiah. “Oh blind Guides!” Would God have any obligation to hear such prayers? Or, would he prefer to kindle a fire in the midst of them?

Chapter 1

— Daniel among children of Israel in captives
— the king’s seed and of the princes
— youths: no blemish, favored, skillful in wisdom
— cunning in knowledge, understanding science
— Daniel, Hananiah, Mishael and Azariah
— Belteshazzar; Shadrach, Meshach, Abednego

~ Chapter 2

— Nebuchadnezzar dreamed; his spirit troubled
— magicians, astrologers, sorcerers summoned
— a great image, a statute in human form
— this image’s head was of fine gold
— his breast and his arms of silver
— his belly and his thighs of brass
— his legs of iron, feet part iron and part clay
— image broken, became a great mountain

A Study of Chapters 1 and 2 HERE ~ —— ~

Chapter 3

— Nebuchadnezzar made an huge golden image
— upon the sound of music
— ye fall down and worship the golden image
— but there are certain Jews who bow not
— Shadrach, Meshach and Abednego
— bound into the midst of a burning fiery furnace
— in their midst, a fourth, like the Son of God

~ Chapter 4

— Nebuchadnezzar giving his testimonies
— a dream which made him afraid and troubled
— a tree in the midst of the earth
— and the height thereof was great
— “Hew down the tree and cut off its branches
— Let his heart be changed from man’s to beast’s
— and let seven times pass over him”

A Study of Chapters 3 and 4 HERE ~ —— ~

Chapter 5

— Belshazzar made a great feast before thousands
— gold and silver vessels that were from the temple
— the same hour came forth fingers of a man’s hand
— and wrote on the wall of the king’s palace
— that was written: Mene, Mene, Tekel, Upharsin
— Mene: God hath numbered thy kingdom and finished it
— Tekel: thou art weighed in and art found wanting
— Peres: thy kingdom is given to the Medes and Persians

~ Chapter 6

— Daniel was preferred above the other princes
— then governors, princes and counselors
— conspired against Daniel
— and they brought and cast him into the den of lions
— “my God sent His angel and shut the lions’ mouths”
— so Daniel prospered in the reign of Darius

A Study of Chapters 5 and 6 HERE ~ —— ~

Chapter 7

— Daniel had dream and visions in his head
— four great beasts came up from the sea
— the first like a lion and had eagle’s wings
— a second beast, like unto a bear
— a third, a leopard, four wings and heads
— a fourth beast, dreadful and terrible
— up came among them a little horn
— out of the fourth beast, ten horns

~ Chapter 8

— vision of a ram with two horns
— but one was higher than the other
— behold, a hegoat came from the west
— the ram was the Medo-Persian Empire
— horn on goat’s head – Alexander the Great
— “little horn” will persecute the holy people
— daily sacrifice transgressed and cast down
— for two thousand and three hundred days

A Study of Chapters 7 and 8 HERE ~ —— ~

Chapter 9

— seventy years destined for desolations of Judah
— “we have sinned and have committed iniquity
— Yea, all Israel have transgressed Thy law”
— Gabriel “O Daniel, for thou art greatly loved”
— “seventy weeks concerning thy people
— after sixty-two weeks shall Messiah be cut off”

~ Chapter 10

— Daniel mourning for three full weeks
— was left alone and remained no strength
— “O Daniel, a man greatly loved
— I have come to make thee understand
— what shall befall thy people in the latter days
— for yet the vision is for many days”

A Study of Chapters 9 and 10 HERE ~ —— ~

Chapter 11

— Gabriel stood to strengthen Daniel
— wars Syria and Egypt: Seleucids vs Ptolemies
— the era of Antiochus (III) the Great
— of Antiochus Epiphanes: a type of anti-Christ
— king of the North vs king of the South
— prophecy of Rome and the Papacy
— of Islam — the Turks, Arabs and Muslims

~ Chapter 12

— at that time shall Michael stand up
— there shall be a time of trouble
— “a time of Jacob’s trouble” Jeremiah 30:7
— “O Lord, what shall be the end of these things?”
— these words are sealed till the time of the end
— from the time the daily sacrifice taken away
— there shall be a prophecy of 1290/1335 days

A Study of Chapters 11 and 12 HERE ~ —— ~

Bomb Mexico to stop Fentanyl

•April 13, 2023 • Leave a Comment

France, under Macron, manages to remain free, unlike Britain, who had been shouted down by the US and becomes a vassal state. For further study, see

More on (1) Ephraim / The United States; (2) Ephraim and Manasseh

For more on the Ox without the Unicorn

Now, the GOP is embraceing a new foreign policy: Bomb Mexico to stop fentanyl

Mexico’s President condemned “hypocritical” Republicans who want the US military to invade Mexico: “an independent and free country, not a US colony!

POLITICO by Meridith McGraw and Natalie Allison ~ April 10, 2023 // RT International ~ April 12, 2023

A growing number of prominent Republicans are rallying around the idea that to solve the fentanyl crisis, America must bomb it away.

In recent weeks, Donald Trump has discussed sending “special forces” and using “cyber warfare” to target cartel leaders if he’s reelected president and, per Rolling Stone, asked for “battle plans” to strike Mexico. Reps. Dan Crenshaw (R-Texas) and Mike Waltz (R-Fla.) introduced a bill seeking authorization for the use of military force to “put us at war with the cartels.”

Sen. Tom Cotton (R-Ark.) said he is open to sending US troops into Mexico to target drug lords even without that nation’s permission. And lawmakers in both chambers have filed legislation to label some cartels as foreign terrorist organizations, a move supported by GOP presidential aspirants.

“We need to start thinking about these groups more like ISIS than we do the mafia,” Waltz, a former Green Beret, said in a short interview.

Not all Republican leaders are behind this approach. John Bolton, Trump’s third national security adviser who’s weighing his own presidential run, said unilateral military operations “are not going to solve the problem.”

And House Foreign Affairs Committee Chair Mike McCaul (R-Texas), for example, is “still evaluating” the AUMF proposal “but has concerns about the immigration implications and the bilateral relationship with Mexico,” per a Republican staff member on the panel.

But the eagerness of some Republicans to openly legislate or embrace the use of the military in Mexico suggests that the idea is taking firmer root inside the party. And it illustrates the ways in which frustration with immigration, drug overdose deaths and antipathy towards China are defining the GOP’s larger foreign policy.

Nearly 71,000 Americans died in 2021 from synthetic-opioid overdoses — namely fentanyl — far higher than the 58,220 US military personnel killed during the Vietnam War. And the Drug Enforcement Agency assessed in December that “most” of the fentanyl distributed by two cartels “is being mass-produced at secret factories in Mexico with chemicals sourced largely from China.” [China denied the charge]

Democrats, meanwhile, are allergic to the Republican proposals. President Joe Biden doesn’t want to launch an invasion and has rejected the terrorist label for cartels. His team argues that two issued executive orders already expanded law-enforcement authorities to target transnational organizations.

The bill would “put us at war with the cartels,” Crenshaw boasted in a press release, “we must start treating them like ISIS – because that is who they are.”

“The administration is not considering military action in Mexico,” National Security Council spokesperson Adrienne Watson said. “Designating these cartels as foreign terrorist organizations would not grant us any additional authorities that we don’t already have.”

Instead, Watson said the administration hopes to work with Congress on modernizing the Customs and Border Protection’s technologies and making fentanyl a Schedule I drug, which would impose the strictest regulations on its production and distribution.

Gen. Mark Milley, the Joint Chiefs chair, told Defense One in an interview last month that invading Mexico was a bad idea. “I wouldn’t recommend anything be done without Mexico’s support,” he said, insisting that tackling the cartel-fueled drug trade is a law enforcement issue.

But should a Republican defeat Biden in 2024, those ideas could become policy, especially if Trump — the GOP frontrunner — reclaims the Oval Office.

As president, Trump considered placing cartels on the State Department’s terrorist blacklist. He also asked about using missiles to take out drug labs and cartels in Mexico, according to former Secretary of Defense Mark Esper, who wrote in his memoir that he rejected the idea at the time.

But Trump backed away from the move because of the legal complications and fears that bombing Mexico could lead to increased asylum claims at the southern border.

Now a candidate, Trump is reviving his hawkish instincts toward the drug lords. He has already vowed to deploy US special forces to take on drug cartels, “just as we took down ISIS and the ISIS caliphate.”

In one policy video released by his campaign, Trump said that if reelected, he would “order the Department of Defense to make appropriate use of special forces, cyber warfare, and other overt and covert actions to inflict maximum damage on cartel leadership, infrastructure and operations.”

And during a recent presidential rally speech in Waco, Texas, Trump compared the number of deaths from fentanyl overdoses to a kind of military attack.

“People talk about the people that are pouring in,” Trump said. “But the drugs that are pouring into our country, killing everybody, killing so many people — there’s no army that could ever do damage to us like that still.”

Other 2024 candidates side with Trump. Using military force on cartels without Mexico’s permission “would not be the preferred option, but we would absolutely be willing to do it,” entrepreneur and conservative activist Vivek Ramaswamy said in an interview. What the cartels are doing “is a form of attack” on the United States, he added.

Ramaswamy also said he backs an authorization for the use of military force for “specific” groups: “If those cartels meet the test for qualifying as a domestic terrorist organization for the purpose of freezing their assets, I think that qualifies them for the US president to view them as an eligible target for the use of authorized military force.”

Asa Hutchinson, the former Arkansas governor and among the more moderate foreign policy voices in his party, openly supports the foreign terrorist organization label for the cartels. “They meet the definition,” he said weeks before announcing his entrance into the 2024 field this month.

Mexican President Andrés Manuel López Obrador is openly against any US military involvement in his country to take on the cartels. “In addition to being irresponsible, it is an offense to the people of Mexico,” he said in March.

But Waltz, who serves on the House Armed Services Committee, noted that Colombia’s government was initially resistant to the idea of US military support, too, until both the Clinton and Bush administrations said they were going to send help anyway. “It was only once we delivered some tough messages that they started to shift,” he said, noting attitudes in Bogotá changed as the situation worsened in the country.

Furthermore, Waltz contends that US law enforcement is “overwhelmed by the magnitude of the problem by the capability of the cartels.” America should use military cyber weapons to disrupt cartel communications and money flow, he suggested, adding: “If we need some drone support along the border, that’s not something that a law enforcement agency can do, that’s something the military needs to help with.”

But current and former US foreign policy and military officials, including Republicans, say there are glaring problems with the military proposals. “If you thought Iraq was a bad situation, wait until you invade a country on our border,” a House Republican congressional aide said. “Our grandchildren will be dealing with this.”

They cite two main concerns.

The first is that US Northern Command assesses that 30 to 35 percent of Mexican territory is ungoverned, giving space for the drug cartels to roam free. Should the US launch military operations in Mexico, a crush of people would find their way to US ports of entry seeking asylum and their claims would be stronger by fleeing an active war zone involving US-labeled terrorists.

“You’ve just legitimately made it harder to send thousands of people back,” the House GOP staffer said.

The second issue is that while using force against drug cartels might impact the supply side of the fentanyl crisis, it doesn’t address demand. And past examples of the US military working with a nation to combat drug groups, like in Colombia, were successful, in part, because the host country was committed to the fight and conducted the operations.

There are other complications, such as what the terrorist label would mean for people selling drugs online or shipping them — would a FedEx delivery person be jailed? — and how to stop the sheer volume of imports to Mexico. The Mexican Navy can’t intercept it all, and US forces asked to assist may only catch a small fraction more of what comes into the country.

Still, Republicans see military options as a last-ditch effort to address the crisis roiling Mexico and the United States, and they will continue offering suggestions until a president agrees with them.

“The worst thing we can do is continue to do nothing,” Waltz said.

For more about the South, a prophecy of Esau or Edom, see Obadiah

For more on the enemy from the South, see A Sword from the South!

For more into another Captivity: see Ezekiel Timeline – 190/40 Years

I AM That I AM

•April 13, 2023 • Leave a Comment

According to Scriptures, names do matter, and they have great significance, since they stand for something or reveal something about a person’s character.

There are even several instances when God changed the names of His people, effectively giving them new capacities. For instance, Abram’s name was changed to Abraham, Sarai’s was changed to Sarah, and Jacob’s was changed to Israel.

The names of God, as He has unveiled them in Scripture, should be particularly noteworthy to us because they reveal who He is, as well as aspects of His character, promises, authority, and power.

The Bible also tells us that in these last days, those who call upon God’s name will be saved:

“The sun will be turned to darkness and the moon to blood before the coming of the great and dreadful day of the Lord. And everyone who calls on the name of the Lord will be saved” (Joel 2:31-32)

So what is God’s name? When Moses stood before God at the Burning Bush inquiring about His name, God understood how important it was that Moses was able to reveal to the Israelites this important piece of information.

In response, God told Moses, Ehye Asher Ehye (אֶהְיֶה אֲשֶׁר אֶהְיֶה) or simply Ehye (אֶהְיֶה).

In most English Bibles this name is translated as I Am Who I Am or simply I Am. (Exodus 3:14); “God said to Moses, I AM WHO I AM. This is what you are to say to the Israelites: ‘I AM has sent me to you.'” Or ‘I Will Be Who I Will Be.’

The meaning God was intending to say is, “I am the One who was, who am and who will be.” Meaning that this Being has always lived, and He will always live. Besides, He is omnipotent, omnipresent and omniscient; and will be whoever He chooses to be in any circumstance: saviour, healer, deliverer, provider, protector; He will be that for you.

Immediately after telling Moses to say to the Israelites that “I AM has sent me to you,” God also tells him, “Say to the Israelites, ‘The LORD [YHVH]… has sent me to you.’”  

To most preachers today, the expression I AM has been used to prove that Christ of the New Testament is the same as the Being of the Old Testament.

When Jesus was confronted by the Pharisees and the elders, he said in John 8:56 Your father Abraham rejoiced to see my day: and he saw it, and was glad.
57 Then said the Jews unto him, Thou art not yet fifty years old, and hast thou seen Abraham?

John 8:58 Jesus said unto them, Verily, verily, I say unto you, Before Abraham was, I AM.

Thus the espression I AM has been used to prove that the Personage of the Old Testament is the same as Christ of the New Testament. Typical is a justification in today’s Churches that read like this: [LCG, CBCG, UCG]

Jesus asserts that Abraham rejoiced to see His day. “Your father Abraham rejoiced to see My day, and he saw it and was glad.” The Jews are infuriated by such claim and rebuked Him, “You are not yet fifty years old, and have You seen Abraham?”

Then Jesus drops the bomb, “Most assuredly, I say to you, before Abraham was, I AM.” The Jews knew exactly what He was saying: Jesus was blaspheming by proclaiming that He is the God speaking to Moses at Mount Sinai!

Therefore, the I AM of the Old Testament has to be exactly the I AM that the New Testament says it is, and He is the One Who became Jesus Christ. And thus the Father was not the God of the Old Testament speaking to Moses!

This is why the Jews took up stones to kill Jesus. In their twisted minds He was guilty not only lying but of the utmost blasphemy.

Is this correct? These Jews were blinded to the fact that the Being who had become Jesus was, in fact, the God of Abraham, Isaac, and Israel. They were standing right there talking to the One who was their God—and they did not know it.

Or are these false preachers who are themselves blind shepherd trying to deceive their sheep? It was prophecised in Scriptures that God’s people will know His name: “My people will know My name; therefore in that day they will know that it is I who foretold it” (Isaiah 52:6)

First, it’s confusing to prove anything by mixing Greek with Hebrew. Christ was merely stating that He was present during Abraham’s time rather that His name is “I am.”

The phrase “I am” in Greek is “ego eimi.” In fact, when Yeshua spoke to the Jews, he used the phrase “ego eimi” at least twenty times and yet, in only one instance did the Jews seek to stone him (John 8:58).

Jesus (or Yeshua) said, “I am the bread of life” to a large crowd in John 6:35,48, yet no one opposed him. In verse 41, the Jews murmured because he said, “I am (ego eimi) the bread which came down from heaven.”

But in verse 42, the Jews questioned only the phrase, “I came down from heaven” and ignored “ego eimi.” The same is true of verses 51 and 52. Their complaints being that He claims He came down from heaven, not because of the “I am.” Yet they didn’t attempt to stone him.

In John 8:12,18,24, and 28, Yeshua used “ego eimi” with the Pharisees present (v13) and yet, no attempt at stoning. He again used it four times in John 10:7,9,11 and 14 with no stoning.

Yeshua said to his disciples, “…that…ye may believe that I am (ego eimi)” in John 13:19 without them batting an eye.

In fact, several other individuals beside Yeshua used “ego eimi” as well. In Luke 1:19, the angel Gabriel said, “Ego eimi Gabriel.” In John 9:9, the blind man whose sight was restored by Yeshua said, “Ego eimi.”

In Acts 10:21, Peter said, “Behold, ego eimi (I am) he whom ye seek.” Obviously, the mere use of “ego eimi” does not equate one to the “I Am” of Exodus 3:14.

A sleight of hand! A pigeon!

Only the claim of being present before Abraham caused the Jews to stone Him.

Later in the Garden of Gethsemane Yeshua was answering the question “Whom seek ye?” They answered Him, “Jesus of Nazareth.” Jesus said unto them, “I am He,” John 18:4-5.

Jesus didn’t intend to mean he was the God of the Old Testament, the God who said he was the Ehyeh that appeared to Moses before the burning bush (Exodus 3:14).

Other translations have caught it true intended meaning, as follows:

WE (Worldwide English) translation of John 8:58: Jesus answered, `I tell you the truth. I already was before Abraham was born.’

TLB Jesus: “The absolute truth is that I was in existence before Abraham was ever born!” Same with Luke 22:70 where “I am” is just an affirmation of what His accusers were charging Him of in the WE version.

MAGIC!

A touch of Simon Magus from all the false prophets and false shepherd we have today!

US Is Spying On Zelensky

•April 12, 2023 • Leave a Comment

The Leaked Intelligence Files are revealing the precarious state of the situation in Ukraine, yet the media and White House officaials are painting a rosy picture of the war there, even the possibility of retaking Crimea back from the Russians!

For example, one chart puts the Ukrainian death toll at around 71,000, a figure that is considered plausible. However, the chart also lists the Russian fatalities at 16,000 to 17,500. Fatalities include wounded, but the Ukrainian death toll is at 71,000.

The death rate has a ratio of seven to one in Russia’s favor, according to Judge Napolitano with Larry Johnson.

Could WH officials continue to lie about winning the Ukraine war with figures like these?

The breach could also prove embarrassing for Russia as it deals with the claims that US intelligence has penetrated deeply into the Russian Defense Ministry!

ZeroHedge by Tyler Durden ~ April 11, 2023

The highly classified Pentagon documents which were leaked online in recent weeks, but which began being confirmed and reported as authentic by The New York Times and others only in the past few days, contain some embarrassing revelations. This has sent DOJ and US intelligence officials scrambling to discover the source of the leaks.

CNN is confirming Monday based on one of the documents which appeared online that the US has been spying on Ukrainian President Vladimir Zelensky – a disclosure which has caused officials in Kiev to be “deeply frustrated.”

“One document reveals that the US has been spying on Zelensky,” CNN reports. “That is unsurprising, said the source close to Zelensky, but Ukrainian officials are deeply frustrated about the leak.”

The US intelligence document suggests that American officials have been worried about possible Zelensky decision-making to strike deep into Russian territory, which would escalate the war and potentially bring Russian and NATO into direct clashes:

The US intelligence report, which is sourced to signals intelligence, says that Zelensky in late February “suggested striking Russian deployment locations in Russia’s Rostov Oblast” using unmanned aerial vehicles, since Ukraine does not have long-range weapons capable of reaching that far.

An additional possibility is that the US intelligence community might be monitoring the Ukrainian presidency’s office as part of efforts to oversee and account for how the tens of billions in aid sent to Kiev is being utilized. 

The Washington Post details that “many of the documents seem to have been prepared over the winter for Gen Mark A Milley, chairman of the Joint Chiefs of Staff, and other senior military officials, but they were available to other US personnel and contract employees with the requisite security clearances.”

Here are 14 more major revelations contained within the leaked intel document trove based on various media sources

  • Locations of CIA recruitment efforts focused on human agents which have access to closed-door conversations of world leaders
  • Russia’s Wagner Group tried to obtain weapons from a NATO member: Turkey. Also, some of the internal future plans of Wagner are apparently known to US intelligence
  • Details of sensitive satellite technology used to track Russian forces, namely the “LAPIS time-series video” – described as an advanced satellite system, which up until now has been a closely guarded secret
  • Ukraine battlefield assessments prepared by the Pentagon
  • The Guardian:”One slide suggested that a small contingent of less than a hundred special operations personnel from NATO members France, America, Britain, and Latvia were already active in Ukraine.”
  • Descriptions of intelligence collection activities by the CIA, NSA, the Defense Intelligence Agency, law enforcement agencies and the National Reconnaissance Office (NRO)
  • One Feb. 23 review of the battlefield situation in Ukraine’s Donbas forecasts a “grinding campaign of attrition” by Russia that “is likely heading toward a stalemate, thwarting Moscow’s goal to capture the entire region in 2023.”
  • WaPo: “The US intelligence community has penetrated the Russian military and its commanders so deeply that it can warn Ukraine in advance of attacks and reliably assess the strengths and weaknesses of Russian forces.”
  • WaPo: “A single page in the leaked trove reveals that the US intelligence community knew the Russian Ministry of Defense had transmitted plans to strike Ukrainian troop positions in two locations on a certain date in February and that Russian military planners were preparing strikes on a dozen energy facilities and an equal number of bridges in Ukraine.”
  • WaPo: A summary of analysis from the CIA’s World Intelligence Review, a daily publication for senior policymakers, says that Beijing is likely to view attacks by Ukraine deep inside Russian territory as “an opportunity to cast NATO as the aggressor,” and that China could increase its support to Russia if it felt the attacks were “significant.”
  • Ukraine’s robust Soviet-era air defenses — which have thus far minimized the participation of Russian aircraft – could run out of ammunition in next several weeks.  
  • A purported CIA intelligence update — claims Israel’s Mossad supported protests against Prime Minister Netanyahu’s Supreme Court reform scheme. 
  • One report says internal discussions show that South Korean officials are wary of requests to hand over artillery shells to the United States to replenish American stockpiles, out of concern they’d end up in Ukraine.
  • Another report says that Ukrainian Air Defense is in peril if it’s not reinforced by Western allies.

Meanwhile, the expanding breadth of subject matter has many suggesting a US source is responsible. It’s being called “a nightmare for the Five Eyes” – and could damage intelligence-sharing relationships between the US and its partner countries.

The breach could also prove embarrassing for Russia as it deals with the claims that US intelligence has deeply penetrated some key areas of government, such as the Defense Ministry.

“The focus now is on this being a US leak, as many of the documents were only in US hands,” former Pentagon official Michael Mulroy told Reuters. As opposed to electronic downloads, it appears most or all of these leaks are in the form of photographs of paper documents. 

“Behold, the eyes of the Lord God are upon the sinful kingdom, and I will destroy it from off the face of the earth, except that I will not utterly destroy the house of Jacob,” saith the Lord. Amos 9:8

“For the day of the Lord is near upon all the nations. As you have done, it shall be done to you; your dealings will return upon your own head” Obadiah 1:15

Daniel (Ch 11-12)

•April 12, 2023 • Leave a Comment

Although Jewish authorities acknowledge that this book of Daniel is a Sacred Text, they regarded it only as Writings but not among the Prophets. Some went even further by claiming that Daniel is a historical fiction. They just have a distaste for what Daniel had written, one who have fasted for them and whom Gabriel regarded as “greatly loved.”

Yet the Jewish authorities just throw out their contempt by kicking Daniel’s prophecy downstair. The greatest of the Prophets, Daniel’s writing is a prophecy of the coming Messiah, yet the Jews pray everyday at the Wailing Wall around the Temple Mount for the coming of the Messiah. “Oh blind Guides!” Would God have any obligation to hear such prayers? Or, would he prefer to kindle a fire in the midst of them?

Daniel 11

Chapter 11 is one of the most amazing prophecies in the Bible. It is most specific, with great details describing historical events up to the present in more features than any other prophecy; in fact, it is the longest prophecy in the Bible. It describes numerous wars in the past and an impending one in the future!

The chapter opens with an angelic being speaking to Daniel, foretelling what is to come in the days ahead. This angel could be Gabriel or one other than him, but without further evidence to the contrary, this work will dubbed him Gabriel, especially in Daniel 9:21-22 where he identified himself and said:

“O Daniel, I have now come forth to give thee wisdom and understanding,” that is, to understand what shall befall God’s people in the latter days, (Daniel 10:14); “in the latter days” is the key phase; which is the endtime, our time.

Much of the historical details used below for the fulfilment of this Chapter have been drawn from “A Manual of Ancient History” (1871) by George Rawlinson.

And lastly, Chapters 11 could be broken into six sections as follows:

(1) verses 1-5: events in Ancient Persia and Greece;
(2) verses 6-9: wars between Syria and Egypt (Seleucids vs Ptolemies);
(3) verses 10-20: the era of emperor Antiochus (III) the Great;
(4) verses 21-29: of Antiochus Epiphanes (a type of anti-Christ);
(5) verses 30-39: prophecy of Rome and the Papacy;
(6) verses 40-45: of Islam — the Turks, Arabs and Muslims.

1 “Also I, in the first year of Darius the Mede, even I, stood to confirm and to strengthen him.

— also I, in the first year of Darius the Mede; these words are more properly belong to the preceding chapter; and the “eleventh” chapter should have begun in the next verse; and this verse are not the words of Daniel, but Gabriel’s;

— thus: in the first year of Darius, Gabriel stood to confirm and to strengthen Daniel, the inference being that the various angelic spirits come to the support of one another when special efforts in behalf of the people or nations in their care are required.

2 “And now will I show thee the truth: Behold, there shall stand up yet three kings in Persia, and the fourth shall be far richer than them all; and by his strength through his riches he shall stir up all against the realm of Greece.

— and now Gabriel will show Daniel the truth. Behold, there shall stand up yet, namely, after Cyrus, who was then king, three kings in Persia, whose names are commonly given as Cambyses, Pseudo-Smerdis and Darius Hystaspes;

— and the fourth king was Xerxes, who exceeded his predecessors in wealth and riches; literally, “shall acquire far greater riches than they all” and by his strength through his riches as he applied his immense wealth in order to fit out a mighty army, he shall stir up all against the realm of Greece, Xerxes staking his all on the invasion of the rival kingdom beyond the Dardanelies;

— but in the west, the King Philip of Macedonia planned a great war to conquer the Persian Empire, with an army made up mostly of Grecians. He died before the plans were completed; but his son, Alexander the Great, took over his plans and invaded Persia. He met the Persian army at the Battle of Issus, 333 BC (Daniel 8:2, 5-6).

— Then he swept down into Egypt, and then to a final crushing defeat of the Persian Empire at the Battle of Arbella, 331 BC, after which Alexander marched on a conquest clear to India, sweeping all before him.

3 And a mighty king shall stand up, who shall rule with great dominion and do according to his will. — and a mighty king shall stand up, a heroic warlike king, namely, Alexander the Great of Macedonia and Greece,

— who rose up a hundred years after the expedition of Xerxes, shall rule with great dominion and do according to his will, not only in Greece but in the whole known world with tyrannical authority.

4 And when he shall stand up, his kingdom shall be broken and shall be divided toward the four winds of heaven, and not to his posterity nor according to his dominion which he ruled; for his kingdom shall be plucked up, even for others besides those.

— and when Alexander was risen up to his highest pitch of grandeur, was sole monarch of the world, in the prime of his days, he was cut off by death; he left no inheritor, either of his power or of his projects; his kingdom was broken, no more united but seized by different generals,

— just as soon as his power is fairly established, the brief duration of Alexander’s rule shall be divided toward the four winds of heaven, in a fourfold division of his kingdom after the battle of Ipsus, 301 BC;

— and not to his posterity, nor according to his dominion which he ruled; for his kingdom shall be plucked up; both of Alexander’s sons were put to death, so that the natural heirs and rightful successors of Alexander were eliminated; and after Alexander’s generals had broken up his empire into small divisions, out of this emerged four monarchs, but still Greek in character:

They were:

(1) Cassander, ruling Greece and Macedonia
(2) Lysimachus, ruling Asia Minor
(3) Seleucus (Nicator); Syria, Babylonia and east to India —”king of the North”
(4) Ptolemy (Soter); Egypt, part of Syria and Judea — “king of the South”

5 “And the king of the South shall be strong, and one of his princes; and he shall be strong above him and have dominion. His dominion shall be a great dominion.

— and the king of the South, Egypt (Ptolemy I, called Soter), shall be strong, and one of his princes, Seleucus Nicator; and he shall be strong above him; in 312 BC, taking advantage of Ptolemy’s being tied up in a war, Nicator established himself in Syria, and assumed the diadem as king. and have a great dominion, which, as a matter of fact extended from Phrygia on the west to the Indus on the east.

6 And in the end of years they shall join themselves together, for the king’s daughter of the South shall come to the king of the North to make an agreement. But she shall not retain the power of the arm; neither shall he stand, nor his arm; but she shall be given up with they that brought her, and him that begot her, and him that strengthened her in these times.

— and after several years have elapsed, they shall join themselves together, or “marriage union” the king of the South and the king of the North forming a confederacy, when Antiochus II Theos, the second successor of Seleucus Nicator, married Berenice, the daughter of Ptolemeus Philadelphus;

— at the end of 50 years, the Syria’s ruler, the king of the North, at this time was Antiochus II, called Theos. His wife was named Laodice. And, says Rawlinson’s Ancient History, page 251, “Her influence … engaged him in a war with Ptolemy Philadelphus [king of the South], BC 260, which is terminated, BC 252, by a marriage between Antiochus and Bernice, Ptolemy’s daughter.”

— for the king’s daughter of the South shall come to the king of the North to make an agreement, to establish just and peaceful relations by virtue of this marriage; but she will not retain the power of her position, nor will he retain his power; that is, neither of them retaining the power acquired through their marriage and the joining of their forces;

— but she shall be given up, and they that brought her, and he that begat her, and he that strengthened her in these times, when the critical position in which he found himself suggested the marriage to him. As soon as Ptolemy Philadelphus died in BC 247, Antiochus Theos expelled Berenice and recalled the formerly rejected Laodice.

— The latter, however, aimed for revenge and to achieve it, poisoned the king, and had her son by him, Seleucus II Callinicus, declared as his successor and sent assassins against Berenice who fled to the sanctuary of Daphne. The latter queen was slain, together with her little son, and the hope of the Ptolemies to behold one of their lineage on the throne of the Seleucidae was thus destroyed.

7 “But out of a branch of her roots shall one stand up in his place, who shall come with an army and shall enter into the fortress of the king of the north, and shall deal against them and shall prevail.

— her root would be her parent and so out of her roots would be someone from her parents; that is, a sibling; and history showed that her place in this controversy was her own brother, Ptolemy III Euergetes;

— who shall come with an army and shall enter into the fortress of the king of the North, against all the strongholds of the Northern power, and shall deal against them and shall prevail, this being done to the extent that the entire Syrian country from Cilicia to beyond the Tigris was conquered, numerous fortresses taken;

— then Ptolemy III carried back to Egypt immense booty and 2,500 molten images and idolatrous vessels which in 526 BC Cambyses had carried away from Egypt; and Laodice, the rival and murderess of Berenice, slain; he continued to rule until 222 BC while the king of the North, Seleucus II died in 226 BC.

8 And he shall also carry captive into Egypt their gods, with their princes and with their precious vessels of silver and of gold; and he shall continue more years than the king of the North.

— and Ptolemy III shall also carry captives into Egypt their gods with their princes, their molten or cast images and with their precious vessels of silver and of gold, all this being welcome booty;

— and he shall continue more years than the king of the North, holding out against him with his superior strength.

9 So the king of the South shall come into his kingdom, and shall return into his own land. — so Ptolemy III, the king of the South, shall come into his kingdom, rather, “and he” the last-named king of the North,

— “shall come into the kingdom of the king of the South,” and shall return into his own land to Syria. This was fulfilled in the expedition of Seleucus Callinicus in which he sent a fleet against Egypt which, however, was destroyed in a storm while his army was defeated and overthrown.

10 “But his sons shall be stirred up, and shall assemble a multitude of great forces; and one shall certainly come, and overflow, and pass through. Then shall he return and be stirred up, even to his fortress.

— but when Seleucus II died, his two sons took over the kingdom of the North; first Seleucus III, 226-223 BC, who ruled only three years, and then his brother Antiochus III, who became “the Great,” 223-187 BC. Both of these two sons of Seleucus II assembled immense forces to war against Egypt, avenge their father, and recover their port and fortress, Seleucia;

— and one shall certainly come and overflow and pass through; the activities of Antiochus the Great in his victorious advance upon Egypt; then shall he return and be stirred up, renewing his campaign against the Egyptians in the following spring, even to his fortress, very likely the fortified city of Gaza.

11 And the king of the South shall be moved with anger, and shall come forth and fight with him, even with the king of the North; and he shall set forth a great multitude, but the multitude shall be given into his hand.

— and the king of the South, Ptolemy Philopator, shall be moved with a fierce and sudden anger, and shall come forth and fight with the king of the North, Antiochus the Great, and he shall set forth a great multitude; but the multitude shall be given into the hand of Ptolemy by which he broke the power of Antiochus.

12 And when he hath taken away the multitude, his heart shall be lifted up; and he shall cast down many ten thousands, but he shall not be strengthened by it.

— the young Egyptian king, now Ptolemy IV (Philopater), was roused, and with an army of 20,000 inflicted severe defeat on Antiochus the Great, the king of the North; and Ptolemy IV shall cast down ten thousands, killing myriads in the battle of Raphia, near Gaza;

— but he shall not be strengthened by it; he killed tens of thousands and again annexed Judea to Egypt; but he was not strengthened, for he made a rash and speedy peace with Antiochus, and returned to dissipation, throwing away the fruits of victory because he did not follow up his victory with any degree of urgency.

13 For the king of the North shall return, and shall set forth a multitude greater than the former, and shall certainly come after certain years with a great army and with much riches.

— for the king of the North shall return and set forth a greater multitude with a great army; thus 12 years later, in 205 BC, Ptolemy IV Philopator, king of the South, died, leaving his throne to an infant son, Ptolemy Epiphanes (or Ptolemy V). Then the king of the North, Antiochus III the Great, assembled a greater army, and won great victories,

— this was approximately thirteen years later when Antiochus III had strengthened himself by (1) successful campaigns against the kingdoms toward the east so that his army was composed of veterans and his equipment were of the very best; and he had (2) made a treaty allying Philip of Macedonia with him,

— and others, against Egypt, and they wrested Phoenicia and southern Syria from the king of the South; and also (3) they were assisted by some of the Jews. Josephus’ Jewish history says many Jews entered into a league with Antiochus the Great against Egypt.

14 “And in those times shall many stand up against the king of the South; also the robbers of thy people shall exalt themselves to establish the vision, but they shall fall.

— and in those times many shall stand up against Egypt, particularly in insurrections and rebellions; also the robbers of thy people shall exalt themselves to establish the vision, literally, “violent persons of thy [Daniel’s] people will revolt against him,”

— namely, when a number of Jews entered into a alliance with Antiochus against Egypt; but they shall fall, the Lord sending tribulations and afflictions upon them for their rebellion against the government, the reference probably being to the oppression of Antiochus the Great.

15 So the king of the North shall come and cast up a mound, and take the most fortified cities; and the armies of the South shall not withstand, neither his chosen people, neither shall there be any strength to withstand.

— so Antiochus the Great shall come, advancing to the attack once more, and cast a mount and take the most fenced cities, literally, “city of fortifications,” a term used of the fortresses of the South in general; Antiochus also besieged and took Sidon from Egypt;

16 But he that cometh against him shall do according to his own will, and none shall stand before him; and he shall stand in the glorious land, which by his hand shall be consumed.

— but Antiochus the Great, the victor of Paneas, he shall do according to his own will, and none shall stand before him; and he shall stand in the glorious land, that is, the Holy Land, and then Antiochus ruined the interests of Egypt in Judea at the Battle of Mount Panium, 198 BC, took possession of Judea and his chosen people; which by his hand shall be consumed, literally “and annihilation is in his hand.”

17 He shall also set his face to enter with the strength of his whole kingdom, and upright ones with him; thus shall he do. And he shall give him the daughter of women, corrupting her; but she shall not stand on his side, neither be for him.

— “upright ones” in Hebrew means “equal conditions, or marriage,” but the one he marries will not stand on his side. In 198 BC, Antiochus the Great arranged a marriage between his daughter, Cleopatra (not the Cleopatra of 31 BC in Egypt) and young Ptolemy Epiphanes, king of the South, by which he hoped subtly to gain complete possession of Egypt;

— thus shall he do, and he shall give him the daughter of women, namely, Cleopatra, who was then but a girl and in the care of her mother and others, who educated her, corrupting her, rather, “bringing destruction upon her” for the marriage, which took place five years later, resulted in the ruin of the land which she represented; but she shall not stand on his side, neither be for him, that is, she was unable to carry out the plans of her father.

18 After this shall he turn his face unto the isles, and shall take many. But a prince for his own behalf shall cause the reproach offered by him to cease; without his own reproach, he shall cause it to turn upon him.

— after this shall Antiochus the Great, the king of the North, turn his face unto the isles to conquer, 197 to 196 BC, the islands and coasts of Asia Minor; but the Roman general, Lucius Cornelius Scipio Asiaticus, utterly defeated him at the Battle of Magnesia, 190 BC; that is, the men in command of the islands and coastlands promptly repulsed his attacks.

19 Then he shall turn his face toward the fortress of his own land; but he shall stumble and fall, and not be found.

— as Antiochus the Great turned toward his own land, he was obliged to retire in peace to a fortress of his own land but he stumbled, for history records that he was slain in 187 BC in an insurrection of the inhabitants of Elymais.

20 “Then shall stand up in his place a raiser of taxes in the glory of the kingdom; but within few days he shall be destroyed, neither in anger nor in battle.

— but his heir, Philopator (187-176), second son of Antiochus the Great, in an effort to raise money, sent a tax collector, Heliodorus, through Judea. But Philopator reigned only 11 years, when Heliodorus, his former favorite, who sought the crown for himself, poisoned him: “destroyed neither in anger nor in battle.”

21 And in his place shall stand up a vile person to whom they shall not give the honor of the kingdom; but he shall come in peaceably, and obtain the kingdom by flatteries.

— Philopator left no heir, and Seleucus IV his brother-in-law, who succeeded him, also left no heir. Then Philopator’s brother, a younger son of Antiochus the Great, named Epiphanes (Antiochus IV), a vile, despicable and contemptible reprobate, came by surprise and through flattery (or through trickery as some versions say) seized the royal power and authority against the will of the nation and before the people really realized it. To his aid came his assistant, Eumenes;

— Antiochus IV borrowed the surname Epiphanes from Ptolemy V of Egypt, king of the South; the surname Epiphanes means “manifest” to indicate that he was a manifestation of a deity. Reinforcing a strong tradition of the Seleucids, Antiochus required his subjects to worship him as the Olympian god, Zeus (II Macc 6:2, also the temple on Mount Gerizim was to be officially named Temple of Zeus).

22 And with the arms of a flood shall they be overflown from before him and shall be broken, yea, also the prince of the covenant. — here “the prince of the covenant” does not refer to Christ, but was an attempt of Antiochus Epiphanes to replace Onias from the high-priesthood, and preferred an usurper, Jason, Onias’s brother, to that dignity,

— not for any crime committed against him by the former, but for great sums of money which were offered to him by the latter and that the Jewish high priest would be subservient to him; as a matter of fact he began a process where the king (years later, Herod the Great appointed Simon Boethus from Alexandria as high priest, hence starting the Boethusians sect in the Sanctuary in Jerusalem) could made one high priest after another according to his whim;

— further, in his enthusiasm for Hellenism and in his efforts to unify his empire, Antiochus made use of cultural and religious coercion such as had long ago been employed by the Babylonians and Assyrians (I Macc 1:41).

23 And after the league is made with him he shall work deceitfully, for he shall come up and shall become strong with a small people.

— and from the time that an alliance is made with him, Antiochus IV or Epiphanes, in this expedition down against the South, he shall work deceitfully, and he shall turned up unexpectedly; for Antiochus shall come up and shall become strong, this smaller force being sufficient for his purposes, because he used it so cleverly.

24 He shall enter peaceably even upon the fattest places of the province; and he shall do that which his fathers have not done, nor his fathers’ fathers: he shall scatter among them the plunder and spoil and riches; yea, and he shall plot his devices against the strongholds, even for a time.

— without warning and stealthily Antiochus Epiphanes shall come into the most productive places of a province or among the richest men of a province [of Egypt], and he shall do that which his fathers have not done nor his fathers’ fathers; he shall squander and distribute the plunder and spoil among themselves; causing the provinces to become impoverished—but only for a time [the period decreed by God].

25 And he shall stir up his power and his courage against the king of the South with a great army; and the king of the South shall be stirred up to battle with a very great and mighty army, but he shall not stand, for they shall plot devices against him.

— threatened with war by the ministers of Ptolemy Philometor [now king of the South], who claim Coele-Syria and Palestine as the dowry of Cleopatra, the late queen-mother, Antiochus Epiphanes marches against Egypt in BC 171. But he was met by his nephew, Ptolemy Philometor, king of the South, with another immense army. But the Egyptian king was defeated through the treachery of his own officers and was outwitted by Antiochus.

26 Yea, those who feed from the portion of his meat shall destroy him, and his army shall overflow; and many shall fall down slain.

27 And both these kings’ hearts shall be to do mischief, and they shall speak lies at one table; but it shall not prosper, for yet the end shall be at the time appointed.

— after Antiochus Epiphanes victory at Pelusium, he advanced to Memphis, plundered its wealth, and having obtained possession of the young king, Ptolemy Philometor, king of the South, endeavored to use him as a tool for “effecting the entire reduction of the country.”

— In 174 BC, the uncle of the king of the South sat at a banquet. Antiochus pretended to ally himself with the young Ptolemy, against his brother, Euergetes II, but each was trying to deceive the other;

— both these kings’ hearts shall be to do mischief, in feigning friendship and thus trying to harm one another, and they shall speak lies at one table, all their protestations of high regard to each other being invented for the sake of playing politics;

— but it shall not prosper, neither one succeeding in carrying out the particular designs which he had in mind at this meeting, of which no accounts are found in secular history; for yet the end shall be at the time appointed.

28 Then shall he return into his land with great riches; and his heart shall be against the holy covenant; and he shall do exploits, and return to his own land. — then shall Antiochus Epiphanes return into his land with great riches, in 168 BC,

— with much booty, firstly, those secured in Egypt; also, returning from Egypt with great plunder, Antiochus set himself against the Jews, massacred many, and then returned to Antioch with golden vessels from the Temple at Jerusalem.

29 “At the time appointed he shall return and come toward the South, but it shall not be as the former or as the latter; — at the time appointed Antiochus returned and came toward the South,

— in another campaign against Egypt and the countries tributary to it; but with none of his former success, that is, the triumphs of the other expeditions were not repeated; because Philometor, king of the South, got help from Rome;

30 for the ships of Chittim shall come against him. Therefore he shall be grieved and return, and have indignation against the holy covenant. So shall he do; he shall even return, and have accord with those who forsake the holy covenant.

— for then the Roman fleet of Chittim had came against Antiochus Epiphanes, a fleet from Cyprus, that is, in this case a Roman embassy with a number of ships, the Roman emissaries landing in Alexandria in order to prevent the Syrian king from conquering Egypt; therefore Antiochus shall grieve and return, retracing his steps in discouragement and anger on account of being foiled in his design;

— and have indignation against the holy covenant. So shall Antiochus do, returning through Judea, smarting under the defeat, he vented his exasperation against the Jews in Jerusalem; he returned after having intelligence of them that they had forsaken the holy covenant, that is, he noted that the Temple was deserted and whole service omitted; the city was largely forsaken by its natives.

31 And armies shall stand on his part, and they shall pollute the sanctuary of strength, and shall take away the daily sacrifice, and they shall place there the abomination that maketh desolate.

— Antiochus sent his “detestable ringleader” Apollonius with 20,000 men to destroy Jerusalem, two years after its capture by himself. Apollonius slew multitudes, dismantled and pillaged the city. The soldiers then, from a fortress which they built commanding the Temple, slayed “all those that were in their best age, and to sell the women and the younger sort;”

— and arms shall stand on his part, armed forces sent by him, and they shall pollute the Sanctuary of strength, the image of Jupiter Olympius, was placed upon the altar in the Temple of God by Antiochus; and the Temple itself was ordered to be called the Temple of Jupiter Olympius;

— and shall take away the daily sacrifice, and they shall place the abomination that maketh desolate; abolished the daily sacrifice (see also Daniel 8:11, 24) and their daily prayers be removed (one account says on the 15th of Kislev, Hebrew calendar); and the “abomination” set up is their idolatrous worship on the altar, for they sacrificed swine upon them;

— also, Antiochus Epiphanes decreed that all persons, upon pain of death, to conform to the religion of the Greeks; and so the Jewish law was abrogated and the Temple was consecrated to Jupiter Olympus.

32 And such as do wickedly against the covenant shall he corrupt by flatteries; but the people who do know their God shall be strong, and do exploits.

— Antiochus perverted the Jews by flatteries, those who were willing to forsake their religion and such as do wickedly against the covenant, that is, by allowing themselves to be yielded to the tyrant’s demands, inducing them to return to apostasy by flattering promises of earthly gain, of worldly advantages;

— but the people that do know their God, that is, not surrendering their consciences to Antiochus’ impositions, who would bravely keep their ground at the time of awakening, beginning in 166 BC, when an old scribe Eleazar and the mother and her seven sons, known as the Maccabees brothers became strong and would resist all his blandishments and adhere to the covenant.

33 And those who understand among the people shall instruct many; yet they shall fall by the sword and by flame, by captivity, and by spoil many days.

— and they that understand among the people, faithful Jews did understand. But most of the Maccabees brothers were put to death, and later, history indicates that later, Jesus or Yeshua and all the early apostles were martyred, except John; they all know the Lord and walk in His fear, and they dispersed and instruct many, making every effort to keep others in the right path;

— “many days” and martyrdom continued for many days or years; decades, even into the Middle Ages, when millions more were martyred for their faith.

34 Now when they shall fall, they shall be helped with a little help; but many shall cleave to them with flatteries.

— now, when they shall fall, in sacrificing themselves for the sake of their religious principles, they shall be helped with a little help, for the theocratic kingdom was retained as a result of their efforts;

— but many shall cleave to them with flatteries, hypocritically casting their lot with the victorious party of the Jews in order to save themselves.

35 And some of those of understanding shall fall, to try them, and to purge, and to make them white, even to the time of the end, because it is yet for a time appointed.

— and some of them of understanding shall fall, to try them, and to purge, and to make them white, EVEN TO THE TIME OF THE END: because it is yet for a time appointed, for all these afflictions would serve as trials in separating the dress or cosmetics from the genuine and pure.

— More about the purification process as we learn from the “wave sheaf” offering —

The “wave sheaf” as firstfruits, must be reaped on the morrow after the Sabbath by three persons, each with his own sickle and basket, until each had his basket full.

They then brought them to the courtyard of the Temple to be thrashed and parched and then to go through ALL of the thirteen sieves until it became very clean, and only one tenth the measure of the ‘omer’ were selected.

The resultant flour were then sieved through thirteenth sieves until it was pure and of very fine texture. Only ten percent of an ephah were chosen while the other ninety percent were rejected.

From this, now known as the omer, oil and frankincense were added, which is a weight of about 1.6 kg (the same weight the children of Israel were allowed to collect for their morning manna Exodus 16:16), was taken and then offered the next morning at about 9 AM, the time of the morning sacrifice in the Temple as a special annual offering waved before God.

The “wave sheaf” as firstfruits, represent humans having to go through purification through trials and often even martyrdom to be made pure and white to be regarded as Saints, ready and qualified to rule with the Messiah in the Millennium.

36 “And the king shall do according to his will; and he shall exalt himself and magnify himself above every god, and shall speak marvelous things against the God of gods, and shall prosper till the indignation be accomplished; for that which is determined shall be done.

— in 65 BC, Syria was swallowed up by the Roman Empire, and became a Roman province; now the king of the North; the Roman emperor now controlled Judea, and therefore the king of the North, who will do according to his will, and he did,

— and he shall exalt himself, in the pride of his heart, exalting himself, and magnify himself above every god, and he did; for the Roman emperors required all to worship them and sacrifice to them, as a god. He was as a god. He was to speak arrogantly and blasphemously against the true God, and he did and persecuted true Christians;

— and shall prosper till the indignation be accomplished, until the wrath of God upon His people would be fully carried out, until His punishment would accomplish its purpose; for that which is determined shall be done, it cannot be recalled, it must be executed.

37 Neither shall he regard the God of his fathers, nor the desire of women, nor regard any god; for he shall magnify himself above all.

— neither shall he regard the God of his fathers, thereby breaking with the true worship of his nation, the proper service of God as it had existed since Abraham and even back to Adam, nor the laws promulgated by Moses and Ezra; nor the desire of women, that is, forbidding their priests, call Fathers, to marry were denying and rejecting the natural inclination of man toward woman, as implanted in the sexes by the Creator,

— nor regard any god, it being characteristic of him that he will set aside all reverence and all natural feeling, including that of the natural knowledge of God; for he shall magnify himself above all, both divine and human, in a challenging supercilious arrogance.

38 But in his place shall he honor the god of forces; and a god whom his fathers knew not shall he honor with gold and silver, and with precious stones and pleasant things.

— the Roman emperors honored the god of forces, or munitions and developed the greatest war-making power the world have ever known but in his estate shall he honor the god of forces, literally, “and the god of fortresses in his place shall he honor,” that is, he would make wars, the application of force, his god, would extend his power by means of arms and munitions, spreading his power to all nations;

— and a god whom his fathers knew not shall he honor with gold, and silver, and with precious stones, and pleasant things, these are the gods that their fathers, Adam to Abraham, knew not:

(a) Ishta and Easters, a celebration of the Queen of heaven: Ishtar, the Assyrian and Babylonian goddess of fertility and sex. Her symbols (like the egg and bunny) were and still are fertility and sex symbols; and to those who actually think eggs and bunnies have something to do with the resurrection; Jeremiah 7:18 the women knead their dough to make cakes to the Queen of heaven; in Egypt, Jeremiah 44:17-19, 25, this is Ishtar: pronounced ‘Easter.’

(b) Mithra and Christmas; Ezekiel 8:16 five and twenty men with their backs toward the temple; their faces toward the east; and they worshiped the sun toward the east; Christmas, which honor the Mithraism, birthday on December 25th – a form of nature worship based on the Sun-Goddess Mithra who on the darkest night of the year (December 20/21), gives birth to “Light” causing each day thereafter to grow longer until the Summer solstice.

— neither Moses nor Ezra would have taught them these strange practices.

39 Thus shall he do in the greatest strongholds with a strange god, whom he shall acknowledge and increase with glory. And he shall cause them to rule over many, and shall divide the land for a price.

— thus shall the papacy in Rome do in the most strongholds with strange gods, that is, strange gods in their temples, churches and chapels, dedicated to angels and departed saints; deck and adorn their images with gold, silver, precious stones and with desirable things; as well as commit the grossest idolatries with this strange breaden gods; which they hold up in such places, cringe and bow to, and pay all religious worship and adoration to them:

— and he shall cause them to rule over many and shall divide the land for gain; such as the new discovered land in the Americas, most were under the Romish jurisdiction, all their newly formed countries and states, which are divided among those tutelar saints; each of them have their proper country assigned them they are to defend; but this is not done without gain arising to the pope of Rome from those countries as a reward to those who accept his claims.

And now we come to our very twenty-first century; and thus a bit speculative, because we couldn’t be definitely sure how things are going to be played out:

40 “And at the time of the end shall the king of the South push at him. And the king of the North shall come against him like a whirlwind, with chariots and with horsemen and with many ships; and he shall enter into the countries, and shall overflow and pass over.

— and at the time of the end, namely, that of the present age of the world, during our very twenty-first century era, the king of the South, who would now be the Muslims countries, for Egypt was swallowed by the Mohammedians during the tenth century; who in turn, were conquered by the Ottoman Turks, who were also Muslims;

— shall push at the North, and the king of the North shall come against him like a whirlwind with chariots and with horsemen and with many ships, with the aid of powerful forces;

— now Recep Tayyip Erdoğan, the current President of Turkey, seems to be actively re-exerting himself in nearby countries; another country is Iran, who also has high ambition and having proxies all around the Middle-East; we’ll have to wait and see;

— and whoever he is, he shall enter into the countries, the king of the South carrying forward his campaign with all energy, and shall overflow and pass over, disturbing the peace of the king of the North. who would then rush Southward.

41 He shall enter also into the glorious land, and many countries shall be overthrown; but these shall escape out of his hand: even Edom, and Moab, and the chief of the children of Ammon.

— he, namely, the king of the North, together with the papacy, shall enter also into the glorious land, the land of Palestine, and many countries shall be overthrown; but these shall escape out of his hand, even Edom and Moab and the chief of the children of Ammon, these ancient enemies of the people of God being representative of all the forces opposing the Lord, and therefore, from the beginning, allies of the king of the North, whom he would not need to overthrow.

42 He shall stretch forth his hand also upon the countries, and the land of Egypt shall not escape. — the king of the North shall stretch forth his hand also upon the countries, namely, in order to take possession of them; and the land of Egypt shall not escape.

43 But he shall have power over the treasures of gold and of silver, and over all the precious things of Egypt; and the Libyans and the Ethiopians shall be at his steps.

— but the king of the North shall have power over the treasures of gold and of silver, the possession of which was ever one of the chief objects of it Roman pope, and over all the precious things of Egypt; and the Libyans and the Ethiopians, representative of the southernmost people of the world, shall be at his steps;

— we have here, in a few bold strokes, and in terms taken from the campaigns of the forces of the king of the North since the third and second centuries. Although the Roman papacy suffered temporary reverses on account of the secession of the Greek and Russian Orthodox Church and the rise of Mohammedanism, he still managed to subjugate one country after the other, so that his strongholds were found throughout the world.

44 But tidings out of the east and out of the north shall trouble him. Therefore he shall go forth with great fury to destroy and utterly to sweep away many. — but tidings out of the East and out of the North; perhaps the Orient and Russia shall trouble the revived Roman Empire;

— therefore the king of the North shall go forth with great fury to destroy and utterly to make away many when he heard of Gog and Magog coming like a storm, with the utmost rage and fury, and like a cloud for number, and threaten utter ruin and destruction to the nation of Israel in their homeland; this will be his end in view in coming out, but he will not be able to accomplish it; of all which see Ezekiel 38:2;

— another possibility of the army from the East and the North could also be an Islamic Army of 200 million of Revelation 9:16-18.

45 And he shall plant the tabernacles of his palace between the seas in the glorious holy mountain. Yet he shall come to his end, and none shall help him.

— and the king of the North and the papacy shall plant the tabernacle of his palace between the seas, in the glorious holy mountain; some say the coming Roman Empire shall establish its palace as capital of the revived Roman Empire, and eventually its religious headquarters in Jerusalem! over against the mountain of the glory [or ornament] of holiness,” so that his palace was intended to be a rival of the ancient seat of God’s power in the midst of His holy people;

— yet the king of the North and the papacy shall come to their end (no more Easters, no more Christmas), their true nature being exposed and realized by at least some of those who could read the signs of the times, and none shall help them; although they will continue their campaign of deceit until the end of time.

Daniel 12

1 “And at that time shall Michael stand up, the great prince who standeth for the children of thy people; and there shall be a time of trouble, such as never was since there was a nation, even to that same time. And at that time thy people shall be delivered, every one who shall be found written in the book.

— and at that time the Archangel Michael shall stand up, who has all the angels of heaven under him, and he shall “stand up” in the latter day and Michael, standing and on guard;

— stand for the children of thy people, as the protector of Israel, Daniel 10:13-21; and there shall be a time regarded as “a time of Jacob’s trouble” (Jeremiah 30:7); a time of tribulation and affliction for the house of Jacob, such as never was since there was a nation, even to that same time, the climax of the oppression brought upon the house of Israel by all opponent forces;

— a parallel scenario is available from Prophet Ezekiel

Ezekiel 20:45 Moreover the word of the Lord came unto me, saying,
46 “Son of man, set thy face toward the South, and drop thy word toward the South, and prophesy against the forest of the Southland.
47 And say to the forest of the South: ‘Hear the word of the Lord. Thus saith the Lord God: Behold, I will kindle a fire in thee, and it shall devour every green tree in thee and every dry tree. The flaming flame shall not be quenched, and all faces from the South to the North shall be burned therein.
48 And all flesh shall see that I, the Lord, have kindled it; it shall not be quenched.’”
49 Then said I, “Ah, Lord God! They say of me, ‘Doth he not speak parables?’”
Ezekiel 21:1 And the word of the Lord came unto me, saying,
2 “Son of man, set thy face toward Jerusalem, and drop thy word toward the holy places, and prophesy against the land of Israel;
3 and say to the land of Israel, ‘Thus saith the Lord: Behold, I am against thee, and will draw forth My Sword out of his sheath and will cut off from thee the righteous and the wicked.
4 Seeing then that I will cut off from thee the righteous and the wicked, therefore shall My Sword go forth out of his sheath against all flesh from the South to the North,
5 that all flesh may know that I, the Lord, have drawn forth My Sword out of his sheath. It shall not return any more.’

Q: how would such scenarios be played out?

— and at that time thy people, the true believers, shall be delivered, everyone that shall be found written in the book, whose name had been entered in the book of life; this prophecy begins with the kingdoms of Syria and Egypt, soon after the death of Alexander the Great — 2300 years ago.

— But it ends at the time of the resurrection and the Second Coming of the Messiah to bring peace to the region — and to the entire world! This prophecy is so long, but plain and this “2300 days” or years could also mean the period where his Saints are cleansed, made white and purified!

2 And many of those who sleep in the dust of the earth shall awake, some to everlasting life, and some to shame and everlasting contempt. — and many of them that sleep in the dust of the earth shall awake,

— literally, “many, a great multitude of those who sleep in the dust-land, shall awake,” shall return to life in the resurrection, some to everlasting life and some to shame and everlasting contempt, this being the division at the day of Judgement: believers destined for eternal glory, the wicked with their gnashing of teeth and torments.

3 And they that are wise shall shine as the brightness of the firmament, and they that turn many to righteousness as the stars for ever and ever.

— and they that are wise, the true and righteous shall shine as the brightness of the firmament, in a wonderful glorification and they that turn many to righteousness, by instructing them in loyalty and faithfulness in the midst of the tribulations in the latter days and shine as the stars forever and ever;

4 But thou, O Daniel, shut up the words and seal the book, even to the time of the end. Many shall run to and fro, and knowledge shall be increased.”

— but thou, O Daniel, the greatest among the Prophets, shut up the words and seal the book, so that its contents during his time, would not be revealed to men, even perhaps to the time of the end, before the Millenium or the Messianic era; many shall run to and fro, and knowledge shall be increased,

— literally, “many shall search it through, and thus understanding will become great.” It is true in general that the knowledge and interpretation of the prophecies of old comes to those who search the Scriptures most carefully, diligently comparing prophecy and fulfillment as indicated in the directions of the Lord.

5 Then I, Daniel, looked; and behold, there stood two others, the one on this side of the bank of the river and the other on that side of the bank of the river.

— then Daniel looked after the angel had finished his message, and behold, there stood two more angels besides the one who had spoken to him, on either side of the River Tigris.

6 And one said to the man clothed in linen, who was upon the waters of the river, “How long shall it be to the end of these wonders?”

— and one, only one of these angels being introduced as speaking, said to the man clothed in linen (who could most probably be the Son of God, who later came and served humanity as the son of man, hence “a man clothed in linen” otherwise why the distinction?),

— which was upon the waters of the river, occupying a position above the water, How long shall it be to the end of these wonders? literally, “Till when the end of these marvelous things?” the end being the period or era of the Messiah with all that happened in it.

7 And I heard the man clothed in linen, who was upon the waters of the river, when he held up his right hand and his left hand unto heaven, and swore by Him that liveth for ever that it shall be for a time, times, and a half; and when he shall have accomplished scattering the power of the holy people, all these things shall be finished.

— and I heard the man clothed in linen (who could be the Son of God), which was upon the waters of the river, as though enthroned there or floating on the waters, when he held up his right hand and his left hand unto heaven, in the gesture of a most solemn oath;

— and swore by him that liveth forever, by the one everlasting true God, that it, the period of these wonderful things, shall be for a time, times, and a half, the duration of the period being the same as that of Antichrist’s reign, a type of Antiochus Epiphanes; Cf. Daniel 7:25;

— and when he shall have accomplished to scatter the power of the holy people, when the Church would have reached a point apparently near annihilation on account of the oppression of Antichrist, all these things shall be finished, including also the deliverance of the people of the Lord by the archangel Michael and everything else that had been included in the great prophecy of the angel.

8 And I heard, but I understood not. Then said I, “O my lord, what shall be the end of these things?”

— and Daniel heard, but he understood not; he did not grasp the meaning of the angel’s announcement; then said Daniel, O my Lord, what shall be the end of these things? He wanted a more exact explanation and interpretation of the period to which reference was made and to the sequence of events in that era, for Daniel was still in the dark concerning them.

9 And he said, “Go thy way, Daniel, for the words are closed up and sealed till the time of the end.

— and be content with what has been made known to thee, Daniel, although the words bare encouraging they are closed up, all sealed till the time of the end, so that it would not be lost or mutilated throughout the times then coming and until the latter days.

10 Many shall be purified and made white and tried, but the wicked shall do wickedly; and none of the wicked shall understand, but the wise shall understand.

— many shall be purified, tried and made pure and white, the time of tribulation bringing out and testing their faithfulness to their Lord, for they would read and interpret the signs of the times aright; but the wicked shall do wickedly, deliberately closing their eyes and minds to the lessons intended for them, and none of the wicked shall understand.

11 And from the time that the daily sacrifice shall be taken away and the abomination that maketh desolate set up, there shall be a thousand two hundred and ninety days.

— and from the time that the daily sacrifice shall be taken away, Cf. Daniel 11:31, and the abomination that maketh desolate set up, in the idolatry introduced by Antiochus Epiphanes, the antitype of Antichrist, there shall be a thousand two hundred and ninety days (yā·mîm, not “bō·qer e·reḇ” as in Daniel 8:14) a period of time whose duration in days are determined exactly, but when it would start or how it would end would require some speculations.

12 Blessed is he that waiteth, and cometh to the thousand three hundred and five and thirty days.

— blessed is he that waiteth and cometh to the thousand three hundred and five and thirty days (yā·mîm), evidently the end of the great trial intended to test the loyalty of the Lord’s children by a tyrant, a type of Antiochus Epiphanes we have seen in the last chapter.

13 But go thou thy way till the end be; for thou shalt rest, and stand in thy lot at the end of the days.” — but go your way, Daniel (now ninety years of age at least) till the end comes;

— for thou shalt rest in the peace of the grave, and stand in thy lot at the end of days (yā·mîm), calmly awaiting in death for deliverance. Blessed are all who await their death in this spirit of calm hopefulness and certain trust in the promise of God!

~~~

— More on an endtime fulfillment to a character similar to Antiochus Epiphanes —

In Daniel 11:21, referring in original, typical fulfillment to Antiochus Epiphanes, there ‘shall stand up a vile person…’ that was in 168 BC. Now, notice verse 31 — still speaking of Antiochus Epiphanes, ‘And arms shall stand on his part, and they shall pollute the sanctuary of strength’ — speaking of the Temple at Jerusalem, ‘… and shall take away the daily sacrifice, and they shall place the abomination that maketh desolate.’

What Antiochus placed there to defile the ‘Holy of Holies’ in God’s Temple, was the statue of Jupiter Olympus. The Mercy Seat of the Holy of Holies was the earthly representation of the very Throne of GOD in heaven. There will be another man similar to Antiochus Epiphanes, who will be a supreme religious leader, called ‘the False Prophet,’ [Revelation 16:13; 19:20; 20:10] and the ‘man of sin,’ who will make this final fulfillment.

So once again before the second coming of Jesus (a Greek name which is Iesus which means ‘son of Zeus’, others say it is short for ‘Hail Zeus’ – there were no letter J until very recently, about 400 years ago only) or better in Hebrew, Jesus or Yeshua (which means ‘he will save’), or the Messiah, one theory is that another vile leader will stop the daily sacrifices being offered in the Temple (yet to be built) in Jerusalem, and will profane the Holy Place with an idol. But that is not all.

This same prophecy spoken by Yeshua is also reported by Luke in his Gospel. Notice Luke 21:20-24: ‘And when ye shall see Jerusalem compassed with armies, then know that the desolation thereof is nigh. Then let them which are in Judea flee to the mountains…’

The typical fulfillment of this occurred in 66-70 AD. The Roman army under General Cestius was marching, late October, 66 AD, toward Jerusalem. They became established in sight of the gates of the city. But for some reason unknown Cestius’ army was pulled back.

The Nazarenes who heeded a divine warning fled to the hills of Judea and then northward east of the Jordan, a place call Pella — almost a century of 19-year time cycles ago. It was the Roman army under Titus, in 70 AD, which actually invaded and destroyed Jerusalem.

Another group, the Hillel branch of Pharisees also took warning, and fled west of Jerusalem to Yavne near the Mediterranean Sea and later to Tiberias where they flourished as Rabbinic Judaism.

The Sadducees, the Boethusians (who were closely allied to the Herodians), the Zealots and the Shammai branch of Pharisees, all deemed as tares, all perished in the AD 70 inferno; a magnificent manifestation of God’s judgement on man whose cause is still unknown to man.

So now, putting the two accounts of Yeshua’s Olivet prophecy together, Matthew 24 and Luke 21, two Events are to occur, just before the Great Tribulation. 1) There will very soon be a Temple in Jerusalem, with daily sacrifices once again being offered.

But the ruler of the soon-coming resurrected ‘Holy Roman Empire,’ a political-military union of ten European nations, will stop the daily sacrifices and profane the Holy Place in the Temple; and 2) Jerusalem will be surrounded and captured (Zechariah 14:1-2) by the Fascist-Nazi army of the European Empire, already starting to rise now out of the European Union. They will invade Jerusalem, and take charge of the Temple.

For the moment this is the only viable possibility being offered. Prophecies are fluid, especially those pertaining to the future which are always subjected to human bias, errors or perhaps unknowingly leaving out some relevant factors that should be incorporated in our analysis.

So, if readers have sported any discrepancies or leftouts, please feel free to share with us; thanks. As events unfold our visions would be clearer and we may see further possibilities. We’ll have to wait and see.

Mexican Cartels designated as Terrorists

•April 11, 2023 • Leave a Comment

The US has a list of nine Mexican cartels to be designated as Foreign Terrorist Organizations

Sen. Lindsey Graham, joined by Sen. John Kennedy, tells reporters he wants to introduce legislation to combat Mexican cartels

Mexico Daily Post ~ April 7, 2023

Skyrocketing fentanyl overdoses in the US and the latest high-impact attacks against Americans on Mexican soil have again led to demands that the US designate drug cartels as terrorist organizations.

Several congressional Republicans are behind the push.

They say designating Mexican cartels as terrorist organizations would give US authorities the tools they need to take them down.

It may seem to be a simple designation. But it is anything but that.

Here’s what representatives from each side, and the experts who study the issue, are saying:

‘Cartels in our crosshairs’

These are the nine Mexican cartels that could be designated as Foreign Terrorist Organizations:

  1. Sinaloa Cartel
  2. Jalisco New Generation Cartel
  3. Gulf Cartel
  4. Los Zetas
  5. Northeast Cartel
  6. Juarez Cartel
  7. Tijuana Cartel
  8. Beltran Leyva Cartel
  9. La Familia Michoacana


Six Republican US senators introduced a bill on March 29 called the NARCOS Act. It would add the “foreign terrorist organization” label to nine notorious Mexican cartels, including the powerhouse Sinaloa and Jalisco New Generation cartels. A similar bill was also introduced in the House of Representatives.

“Despite what the president of Mexico says, drug cartels are in control of large parts of Mexico,” Sen. Lindsey Graham said in a prepared statement.

“They are making billions of dollars sending fentanyl and illicit drugs into the United States, where it is killing our citizens by the thousands. Designating these cartels as Foreign Terrorist Organizations will be a game-changer.

“We will put the cartels in our crosshairs and go after those who provide material support to them, including the Chinese entities who send them chemicals to produce these poisons.”

China [who denied the charge] and more recently, India, are sources of “precursor” chemicals used by drug cartels to produce fentanyl and methamphetamine for shipment north of the border.

The terrorist designation would give law enforcement and prosecutors more power to freeze cartel assets and deny their members entry to the US, Graham’s office reported. It would also open the door to charging those who support a terrorist organization.

Mexican leaders have said it would violate Mexico’s sovereignty and lead to a breakdown in diplomatic relations between the nations.

What would happen if the Mexican cartels are designated as a Foreign Terrorist Organizations by the US? See If Mexican Cartels are designated as FTO?

For more about the South, a prophecy of Esau or Edom, see Obadiah

For more on the enemy from the South, see A Sword from the South!

For more into another Captivity: see Ezekiel Timeline – 190/40 Years

More Classified Docs Appear Online

•April 10, 2023 • Leave a Comment

The Leaked Intelligence Files are revealing the precarious state of the situation in Ukraine, yet the media and White House officaials are painting a rosy picture of the war there, even the possibility of retaking Crimea back from the Russians!

For example, one chart puts the Ukrainian death toll at around 71,000, a figure that is considered plausible. However, the chart also lists the Russian fatalities at 16,000 to 17,500. Fatalities include wounded, but the Ukrainian death toll is at 71,000.

The death rate has a ratio of seven to one in Russia’s favor, according to Judge Napolitano with Larry Johnson.

Could WH officials continue to lie about winning the Ukraine war with figures like these?

“The scale of the leak — “a nightmare for the Five Eyes” — more than 100 documents may have been obtained, along with the sensitivity of the documents themselves, could be hugely damaging.”

ZeroHedge by Tyler Durden ~ April 8, 2023 // Sputnik International // Japan Times

A more expanded document dump and leak of highly classified materials is being reported in the wake of the initial disclosure that memos related to US strategy in the Ukraine war appeared online, including material marked “Top Secret.” 

This time the leak appears more expansive: “A new batch of classified documents that appear to detail American national security secrets from Ukraine to the Middle East to China surfaced on social media sites on Friday, alarming the Pentagon and adding turmoil to a situation that seemed to have caught the Biden administration off guard,” The New York Times reported Friday evening.

“The scale of the leak — analysts say more than 100 documents may have been obtained — along with the sensitivity of the documents themselves, could be hugely damaging, US officials said,” the report continues.

One senior intelligence official was quoted in the report as saying the leak is “a nightmare for the Five Eyes” – in reference to the intelligence-sharing nations of the US, UK, Canada, Australia and New Zealand.

Like the Ukraine war plans earlier reported on by the Times, some of these latest documents appeared on Twitter and other social media platforms, and they include reports labeled with one of the highest classification ratings of “Secret/NoForn” – which means they are sensitive enough to not be shared with even foreign allies. 

Interestingly, the NY Times notes that one intelligence slide which is circulating features “an alarming assessment of Ukraine’s faltering air defense capabilities.” But these leaks, some of which actually appeared on a Discord server devoted to discussing Minecraft and other unusual places, include more than the initial content on Ukraine war planning

But the leaked documents appear to go well beyond highly classified material on Ukraine war plans. Security analysts who have reviewed the documents tumbling onto social media sites say the increasing trove also includes sensitive briefing slides on China, the Indo-Pacific military theater, the Middle East and terrorism.

The report quotes one analyst who warns this is likely “the tip of the iceberg” and that more major leaks are coming, or possibly have already happened, in something which could begin to rival the ‘Pentagon Papers’ of the Vietnam war era.

A former senior Pentagon official, Mick Mulroy, was also quoted as saying this could possibly hinder Ukrainian military planning given that “many of these were pictures of documents” and thus “it appears that it was a deliberate leak done by someone that wished to damage the Ukraine, US and NATO efforts.”

This assessment suggests a leak from inside allied forces, and not from a foreign adversary, even though US officials are accusing Russian-linked entities online of being the chief spreaders of the leaked documents. 

US officials are also warning that some of the documents may have been digitally altered to fit a more pro-Kremlin narrative, as we detailed earlier. Twitter has acknowledged that US officials are requesting that it act to scrub classified materials from the platform.

Pentagon and US intelligence officials are also scrambling to discover the source of the leak in an ongoing investigation. Likely this is to result in greater scrutiny on Kiev and how its chain-of-command handles sensitive data shared from the Pentagon.

“I have seen a horrible thing in the house of Israel; there is the whoredom of Ephraim, Israel is defiled” Hosea 6:10

“Shall a trumpet be blown in the city, and the people not be afraid? Shall there be evil in a city, and the LORD hath not done it?” Amos 3:6

Daniel (Ch 9-10)

•April 10, 2023 • Leave a Comment

Although Jewish authorities acknowledge that this book of Daniel is a Sacred Text, they don’t regarded it a prophecy; that this book is only among the Writings but not among the Prophets. They just dislike the writings of Daniel, one who prayed with sackcloth and ashes, and had fasted for his countrymen and whose prayers were answered, for Gabriel said to Daniel, “thou art greatly beloved.”

Yet the Jewish authorities just show their disdain for what Daniel had written, throwing out their contempt by kicking his writing and its prophecy downstair. Daniel’s writing is a prophecy of the coming Messiah, yet the Jews pray everyday at the Wailing Wall around the Temple Mount for the coming of the Messiah. “Oh blind Guides!” Would God have any obligation to hear their prayers?

Daniel 9

In Daniel 12:4 “but thou, O Daniel, shut up the words, and seal the book that I may tell you that which shall befall you in the last days,” and so we are trying to understand this prophecy “in the last days.”

9: Interpretation of Jeremiah’s prophecy of the seventy weeks (9:1–27 – Median era; Hebrew)

1 In the first year of Darius the son of Ahasuerus, of the seed of the Medes, who was made king over the realm of the Chaldeans”

— in the first year of Darius, the son of Ahasuerus, known in secular histor of the empire after the fall of Babylon, of the seed of the Medes, who were with the Persians in the conquest of Babylon, who was made king over the realm of the Chaldeans, not by accession, but through the agency of the victorious army and by the hand of Cyrus,

— there were three Darius in biblical times and the most sensible one while Daniel was still alive must be Darius I, whose reign was from 522 to 486 BC; whereas Cyrus “the Great” reign was from 550 to 529 BC; hence the Rabbinic deflection that Gabriel’s prophecy was “to anoint the Most Holy” applies to King Cyrus just doesn’t make sense:

— because: (1) Cyrus had already came and gone, dead; and (2) Cyrus maybe “his annointed” prophecised in Isaiah 45:1, but he certainly just couldn’t be qualified to be considered “the Most Holy” Daniel 9:24. By denying the Real Annointed as the Most Holy that would be close to blasphemy!

2 in the first year of his reign I, Daniel, came to understand by books the number of the years, according to the word of the Lord as it came to Jeremiah the prophet, that He would spend seventy years in the desolations of Jerusalem.

— in the first year of his reign, Daniel understood by books, he observed and understand his information and then drew his conclusions, the number of the years whereof the word of the Lord came to Jeremiah, the prophet, Cf Jeremiah 25:11;

— that he would accomplish seventy years in the desolations of Jerusalem, or “that seventy years would be completed by the desolate condition of Jerusalem.” Note that Daniel was in possession of a book of Jeremiah’s prophecies, that he considered the words of this book as the words of the Most High.

3 And I set my face unto the Lord God, seeking by prayer and supplications, with fasting, and sackcloth, and ashes. — and Daniel set his face unto the Lord God, the one sovereign God of the universe to seek by prayer and supplications;

— to plead for the restoration of the city of his fathers, with fasting and sackcloth and ashes. It was thus an importunate, moving prayer which Daniel sought by the operation of the holy spirit, by which he made known his requests before God.

4 And I prayed unto the Lord my God, and made my confession and said, “O Lord, the great and fearsome God, keeping the covenant and mercy to them that love Him and to them that keep His commandments,

— and Daniel prayed unto the Lord and made confession, a frank acknowledgment of one’s sinfulness preparing the way for the proper worship of the Lord and said, O Lord, the great and dreadful God, he whose fear and terror is upon all those who wouldn’t fear him, keeping the covenant and mercy to them that love him and to them that keep his commandments, Cf Deuteronomy 7:9:

5 we have sinned and have committed iniquity, and have done wickedly and have rebelled, even by departing from Thy precepts and from Thy judgements.

— we have sinned and have committed iniquity by leaving the path of God’s commandments and have done wickedly and have rebelled even by departing from thy precepts and from thy judgements, the introduction of the confession being modeled after the words of Solomon’s prayer, 1 Kings 8:47;

6 Neither have we hearkened unto Thy servants the prophets, who spoke in Thy name to our kings, our princes, and our fathers, and to all the people of the land.

— neither have we hearkened unto thy servants, the prophets, a confession now being made in the name of his entire people with their open disregard of the admonition of the prophets, which spoke in Thy name to our kings, our princes, and our fathers, and to all the people of the land;

— prophets are liked Isaiah, Jeremiah, Ezekiel, Micah, Hosea and others: such a prayer today should rededicated the book of Daniel prime among into the Prophets and study its content seriously.

7 O Lord, righteousness belongeth unto Thee, but unto us confusion of faces, as at this day: to the men of Judah and to the inhabitants of Jerusalem, and unto all Israel who are near and who are far off, through all the countries whither Thou hast driven them, because of their trespass that they have trespassed against Thee.

— O Lord, all righteousness belong to thee, you are the possessor of absolute righteousness, who alone can dispense righteousness, but unto us confusion reign, namely, the confusion which shows ourselves in the guilty blush on account of the wrong choices we made and the consequent judgement and tribulation;

— as at this day, to the men of Judah and to the inhabitants of Jerusalem, these being concerned first of all, as the leaders of the Lord’s people; and unto all Israel “who are far off” that is, over the seas and oceans among the nations afar off, and all those who professed their belief in the true God thus casting their lot together;

— that are near and that are far off, through all the countries whither thou hast driven us, that is, all humanity since Noah and the towel of Babel, as all were deported into shameful exile, because of all the trespasses that all have trespassed against thee, the guilt of the people thus being brought out time and again.

8 O Lord, to us belongeth confusion of face, to our kings, to our princes, and to our fathers, because we have sinned against Thee. — O Lord, to us belongeth confusion of all faces: to our kings, to our princes, and to our fathers;

— because we have sinned against thee, this statement being repeated for the sake of emphasis, just as the synonymous expressions were heaped at the beginning of Daniel’s confession in order that the full scope of the people’s guilt might be brought out.

9 To the Lord our God belong mercies and forgivenesses, though we have rebelled against Him; — to the Lord, our God, belong mercies and forgivenesses,

— of which all repentant sinners feel the great need, though we have rebelled against Him; or “for we have rebelled” and the need for his forgiveness as our one hope has become apparent;

10 neither have we obeyed the voice of the Lord our God to walk in His laws, which He set before us by His servants the prophets.

— neither have we obeyed the voice of the Lord, our God, to walk in his laws, following them exactly which he set before us by his servants, the prophets and his administrators in making known his will, spoken and unspoken, to men.

11 “Yea, all Israel have transgressed Thy law, even by departing, that they might not obey Thy voice; therefore the curse is poured upon us, and the oath that is written in the Law of Moses the servant of God, because we have sinned against Him.

— yea, all Israel have transgressed thy Law, even by departing, that they might not obey thy voice, their turning away from him being done with deliberate purpose; therefore the curse is poured upon us, like a rainstorm with hail and the oath that is written in the Law of Moses, the servant of God, Cf Leviticus 26; Deuteronomy 28, because we all have sinned against him.

12 And He hath confirmed His words which He spoke against us and against our judges who judged us, by bringing upon us a great evil; for under the whole heaven hath not been done as hath been done upon Jerusalem.

— and he hath confirmed his words which he spoke against us, confirming them in words and deed as they now had the proof before them and against our judges that judged us, by bringing upon us a great evil; for under the whole heaven hath not been done as hath been done upon Jerusalem, as the fall of Jerusalem and the Temple in 586 BC (Jewish authority 423 BCE) and in 70 AD.

13 “As it is written in the Law of Moses, all this evil is come upon us. Yet made we not our prayer before the Lord our God, that we might turn from our iniquities and understand Thy truth.

— as written in two chapters in the Law of Moses (Leviticus 26; Deuteronomy 28) which contain the dreadful judgement of the Lord concerning his punishment upon the transgressors of his Law, all this evil to come upon Israel;

— yet we made no prayer before the Lord, our God, by entreating or conciliating his face, by attempting to propitiate his anger, as suggested in King Solomon’s great prayer, that we might turn from our iniquities and understand his truth; the truth of God is his plan of salvation, according to which he wants the sinner to turn from his evil ways.

14 Therefore hath the Lord watched upon the evil, and brought it upon us; for the Lord our God is righteous in all His works which He doeth, for we obeyed not His voice.

— therefore hath the Lord watched upon the evil; he is concerned about its coming upon the transgressors and brought it upon us; for the Lord our God is righteous in all; his works which he doeth, all his actions being essentially just; for we obeyed not his voice.

15 “And now, O Lord our God, who hast brought Thy people forth out of the land of Egypt with a mighty hand, and hast made Thee a name, as at this day — we have sinned, we have done wickedly.

— and now, O Lord, our God, that hast brought thy people forth out of the land of Egypt with a mighty hand, Exodus 32:11, and hast gotten thee renown as at this day, his acts of mercy being acknowledged wherever they became known among the nations: we have sinned, we have done wickedly, this confession now also introducing the final petition of Daniel’s prayer.

16 O Lord, according to all Thy righteousness, I beseech Thee, let Thine anger and Thy fury be turned away from Thy city Jerusalem, Thy holy mountain; because for our sins and for the iniquities of our fathers, Jerusalem and Thy people have become a reproach to all who are about us.

— O Lord, according to all thy righteousness, Daniel beseech him in accordance with the righteousness which demanded the fulfillment of his promises, let thine anger and thy fury be turned away from Jerusalem, designated thus because his Sanctuary had been situated there for many centuries;

— because for our sins and for the iniquities of our fathers Jerusalem and its people are become a reproach to all that are about us, so that the heathen looked upon us with scorn and mockery.

17 “Now therefore, O our God, hear the prayer of Thy servant and his supplications, and cause Thy face to shine upon Thy sanctuary that is desolate, for the Lord’s sake.

— now, therefore, O our God, hear the prayer of thy servant and his supplications and cause thy face to shine in merciful love upon thy Sanctuary that is desolate, for the fact that the Temple was lying in ruins was the chief ground for Daniel’s prayer, for the Lord’s sake, for the glory of the restoration would then be the Lord’s.

18 O my God, incline Thine ear and hear. Open Thine eyes and behold our desolations and the city which is called by Thy name; for we do not present our supplications before Thee because of our righteousnesses, but because of Thy great mercies.

— O God, incline thine ear and listen; open thine eyes and behold our desolations, both the cities and their ruins being included, and the city which is called by thy name, literally, “upon which Thy name is called” where God had so gloriously revealed himself which he had by choosing it for his Sanctuary, elevated so highly among the cities of the world;

19 O Lord, hear! O Lord, forgive! O Lord, hearken and do! Defer not, for Thine own sake, O my God; for Thy city and Thy people are called by Thy name.”

— O Lord, hear; O Lord, forgive and hearken! Daniel here is rising to the very climax of an importunate and fervent prayer. Defer not for thine own sake, O God; for thy city and thy people are called by thy name and therefore his zeal for his own glory should be the motive urging him to heed Daniel’s prayer.

20 And while I was speaking and praying, and confessing my sin and the sin of my people Israel, and presenting my supplication before the Lord my God for the holy mountain of my God—

— and while Daniel was praying and confessing his sin and the sin of his people Israel and presenting his supplication before the Lord, piling up petitions in seeking the mercy of God in the interest of the Lord’s Sanctuary and true worship;

21 yea, while I was speaking in prayer, even the man Gabriel, whom I had seen in the vision at the beginning, being caused to fly swiftly, touched me about the time of the evening oblation.

— while Daniel was praying, making the concluding remarks, even Gabriel, one of the chief angel-princes, whom Daniel had seen earlier in the vision at the beginning (Daniel 8:15-16), being caused to fly swiftly, touched him about the time of the evening sacrifice, about three o’clock in the afternoon.

22 And he informed me, and talked with me and said, “O Daniel, I have now come forth to give thee skill and understanding.

— and he informed Daniel and talked with him and said, O Daniel, I am now come to give thee skill and understanding, a correct insight into the problem perplexing him and an assurance for the future.

23 At the beginning of thy supplications the commandment came forth; and I have come to show thee, for thou art greatly beloved. Therefore understand the matter, and heed the vision:

— at the beginning of Daniel’s supplications the commandment came forth, namely, the decree or oracle, which is presently stated, and Gabriel was to show him to make it known;

— for thou art greatly loved, this being the reason why the Lord was so ready to make known to Daniel the solution of the problem of the seventy weeks; therefore understand the matter and consider the vision, observing the oracle as to be set forth and explained.

24 “Seventy weeks are determined concerning thy people and concerning thy holy city to finish the transgression and to make an end of sins, and to make reconciliation for iniquity, and to bring in everlasting righteousness, and to seal up the vision and prophecy, and to anoint the Most Holy.

— seventy weeks are determined upon thy people and upon thy Holy City, the capital which was so dear to the heart of God, the determination of the time being purposely indefinite, to finish the transgression and to make an end of sins, to restrain the rebellion and to seal up the sins so that they would no longer find expression;

— and to make reconciliation for iniquity, to effect an expiation for guilt and to bring in everlasting righteousness, the result of the expiation of sin and to seal up the vision and prophecy, rather “and the prophet,” for these would be the chief and greatest prophecies ever written and be fulfilled;

— and to anoint the Most Holy: if this is meant the Holy of Holies in the Temple, as Jewish authority and a few others believe, then what is this anointing for? What’s the big deal; what is its significance? No explanations were ever given. It only has meaning if it is something special: to anoint the Special One; to anoint the Messiah; this has far more merit than for any other purpose;

— using the day-for-a-year principle of Bible prophecy is understood in Numbers 14:34 and Ezekiel 4:3-6, the seventy weeks in Daniel 9 represent 70 times 7 or 490 days — that is, since days stand for prophetic years, this comes to a total of 490 years. What was to happen at the end of these years?

25 Know therefore and understand that from the going forth of the commandment to restore and to build Jerusalem until the Messiah the Prince, shall be seven weeks and threescore and two weeks; the street shall be built again, and the wall, even in troublesome times.

— know therefore and understand that from the going forth of the commandment to restore and to build Jerusalem, from the time that the decree of Cyrus concerning the rebuilding of Jerusalem went forth, Ezra 1:1; Isaiah 44:28, unto the Messiah, the Anointed One, the Prince;

— shall be seven weeks, that is, until the coming of the Messiah, the Savior, and threescore and two weeks, during which the great spiritual Temple of the Lord would be constructed; the street shall be built again and the wall, even in troublous times; young and adolescents, the spiritual Church established, under the turbulent Roman rule, would be like kids playing in the streets of Jerusalem in troublous times;

— this means the Messiah would appear after “seven weeks, and threescore and two weeks” or 69 weeks, after the decree was given; it is known that the seventh year of Artaxerxes when he issued the decree was from September 458 to September 457 BC (Jewish reckoning fall to fall; Artaxerxes came to the throne in December 465 BC and reigned until 424 BC; Wikipedia);

— it took seven prophetic weeks, or 49 years (a year for a day) to complete this rebuilding of the Temple. The troublous times are described in Nehemiah 4. This carries us from 457 to 408 BC;

— after 62 more weeks, or 434 years (from 408 BC), the Messiah would be on the scene (verse 26).

— in other words, from 457 BC in the fall, till Christ appeared on the scene, there would be sixty-nine weeks (7 + 62) — a total of 69 times 7 or 483 years! Just 483 years after 457 BC brings us to exactly AD 27!

483 years were to pass, beginning from
457 BC when the decree went forth, bringing us to
26 AD — however, one year must be added
1 in crossing from BC to AD, bringing us to
27 AD — since there is no year zero

(or the calculation from BC to AD is: -457 + 1 + 483 = 27 AD)

— the Messiah would appear on the scene in 27 AD!

26 And after threescore and two weeks shall Messiah be cut off, but not for Himself; and the people of the prince who shall come shall destroy the city and the sanctuary. And the end thereof shall be with a flood, and until the end of the war desolations are determined.

— and after threescore and two weeks (62 weeks) shall Messiah be cut off, namely, at the time of Christ’s death, a death not for Himself, but for the whole humanity;

— and the people of the prince that shall come, a mighty opponent, an anti-Messianic movement, Rome, shall destroy the city Jerusalem and the Temple, so that everything, apparently, would be lost after the attack;

— and the end thereof shall be with a flood, so that the attacking prince himself would perish in the end, by a divine judgement, and unto the end of the war desolations are determined, or “until the end there will be warfare,” until the end of this world; these sound like a preamble, introduction or summary to the book of Revelation.

27 And he shall confirm the covenant with many for one week; and (better with “but” in some translations: AMP, CSB, LSB, LEB, NJKV, etc) in the midst of the week he shall cause the sacrifice and the oblation to cease. And for the overspreading of abominations he shall make it desolate, even until the consummation, and that determined shall be poured upon the desolate.”

— and he, the prince, the Messiah, shall confirm the covenant with many for one week; and but in the midst of the week he, a different ‘he’ (the one in verse 26 “the prince who shall come shall destroy the city and the sanctuary”) shall cause the sacrifice and oblation to cease, so that there would be a break of the worship of God in the Temple, because the Temple would be destroyed,

— and for the over-spreading of abominations this different ‘he’ shall make it desolate; the daily sacrifice of the Temple and all their other sacrifices; when the city of Jerusalem, being besieged by Titus, and their fall in AD 70; the daily sacrifice ceased to the great grief of the people;

When? When did the Messiah accomplish this? “In the MIDST of the week!” That is dual — 1) after fulfilling one half of the seventieth week — after preaching the Kingdom of God for three and a half year, Christ died for the sins of the world, after doing the Work of God for three and a half years, from autumn 27 AD until spring 31 AD.

And 2) it also indicates that Christ died for our sins in the middle of a literal week — on a Wednesday! And He was resurrected three days and three nights later (Matthew 12:40) — near sunset on the weekly Sabbath so that He had risen already by sunrise Sunday morning (Matthew 28:6Mark 16:6Luke 24:6).

Since Christ died for the sins of man kind in the midst of the week, the prophecy, “And he shall confirm the covenant with many for one week,” has not yet been been completely fulfilled.

For three and a half years, during his ministry, he confirmed the covenant with his disciples. By his death, he put the final stamp on the covenant; through him all people can now enter into the covenant which God made with Abraham (Galations 3:29), and become heirs “according to the promise.”

— but as Daniel 9:26-27 reveals, there remains yet three and a half years of Christ’s ministry to be fulfilled! When will Christ fulfill it? Perhaps the last three and a half years could be a time of final training before the return of Christ Second Coming? Otherwise, when will he once again confirm the covenant?

Daniel 10

10: The angel’s revelation: kings of the north and south (10:1–12:13 – Persian era, mention of Greek era; Hebrew)

1 In the third year of Cyrus king of Persia a thing was revealed unto Daniel, whose name was called Belteshazzar. And the thing was true, but the time appointed was long; and he understood the thing, and had understanding of the vision.

— Cyrus, king of Persia, two years after his decree for the restoration of Jerusalem and the Temple had gone forth, a thing was revealed unto Daniel, whose name was Belteshazzar;

— both names being given here, one as a member of the people of God, the other as an official of the Persian court, who could render his nation a better service by remaining at court than by joining them in the restoration of Jerusalem, especially he was now of advanced age;

— and the thing, the word of God revealed to Daniel but the time appointed would be long into the future, of a time regarded as “the great tribulation” that is, the revelation concerned was God’s judgement with misery, wretchedness and troubles, a time called Jacob’s trouble.

2 In those days I, Daniel, was mourning three full weeks. — Daniel was mourning, either on account of what had been revealed to him in the last vision or prophecy of the seventy weeks; by which it appeared the Jews would be guilty of in cutting off the Messiah;

— or what desolations would come upon their land, city and Temple, as also because of the present case of his people; many of them continuing in the country of Babylon when they had liberty to return to their land:

— or because of the hinderance the Jews met with in rebuilding Jerusalem and the Temple who had returned; of which Daniel had an account of the Samaritans infiltrating the returning exiles, disrupting them and which caused him to mourn secretly.

3 I ate no pleasant bread, neither came flesh nor wine in my mouth, neither did I anoint myself at all, till three whole weeks were fulfilled.

— Daniel fasted, ate neither flesh nor wine thus discarding all food, neither did he anoint himself at all, he abstained from all expressions of joy and happiness till three whole weeks were fulfilled; an expressions of sorrow and mourning at such a time.

4 And in the four and twentieth day of the first month, as I was by the side of the great river, which is Hiddekel,

— Daniel abstained food and wine even through a Passover festival season, for the Passover festival was on the first month, Nisan, thus the seriousness of his quest.

5 then I lifted up mine eyes and looked, and behold, a certain man clothed in linen, whose loins were girded with fine gold of Uphaz.

6 His body also was like beryl, and his face as the appearance of lightning, and his eyes as lamps of fire, and his arms and his feet like the color of polished brass, and the voice of his words like the voice of a multitude.

—a man clothed in linen, his body also was like the beryl; that is, that part which was not covered with the linen garment and was seen, was like such a precious stone, said to be of an azure and sky colour, signifying he was the Lord from heaven; though, according to its name, it should be of a sea colour, greenish;

— and his face the appearance of lightning; exceeding bright, very dazzling to the eye, and striking terror to the mind; expressive of something very awful and majestic; and could be the Son of God whose face or countenance at his transfiguration on the mount, and when John saw him in a visionary way, was as the sun shineth in his strength;

— and the eyes of the Son of God as lamps of fire; and how piercing and penetrating his eyes are into the affairs of men and states, by whom they are clearly seen and to whom they are exactly known; and how fierce and terrible his wrath is towards his enemies, and whose looks must inject dread and terror into them; see Revelation 19:12;

— and his arms and feet like in colour to polished brass; denoting great strength for action, the stability, firmness and the glory of the Son of God; his power, in trampling upon his enemies and subduing them;

— and the voice of the Son of God; his words like the voice of a multitude, the voice of roaring like that of the ocean or of many waters; see Revelation 1:15 and may intend the power and efficacy of his words whether in proclamation or in judgements in a way of comfort or of wrath and vengeance.

7 And I, Daniel, alone saw the vision, for the men who were with me saw not the vision; but a great quaking fell upon them, so that they fled to hide themselves.

— and Daniel alone saw the vision so that all its details were clear to him; for the men that were with him saw not the vision as was the case also with the companions of Saul on the way to Damascus, Acts 9:7; Acts 22:11;

— but a great quaking fell upon them so that they fled to hide themselves, literally, “they fled by hiding themselves” an expression showing the greatness of their fear.

8 Therefore I was left alone and saw this great vision, and there remained no strength in me; for my comeliness was turned in me into corruption, and I retained no strength.

— therefore Daniel was left alone and saw this great vision and there remained no strength in him on account of the overwhelming terror of the vision;

— for his comeliness was turned in him into corruption, for his countenance grew deathly pale and Daniel retained no strength; it is evident from the entire description that Daniel had a vision and countenance of the Messiah, as He revealed Himself to Prophets of the Old Testament. Cf Revelation 1:13-15.

9 Yet heard I the voice of his words; and when I heard the voice of his words, then was I in a deep sleep on my face, and my face was toward the ground.

— and when Daniel heard the voice of his words, he fell facedown on the ground either in a way of worship and adoration, in prayer and supplication, or because of awe and reverence of the speaker.

10 And behold, a hand touched me, which set me upon my knees and upon the palms of my hands. — and an hand touched Daniel, the stunned prophet not being able to say whose hand it was,

— but could be another being; the text indicates that it could be the previous angel in white, Gabriel perhaps, which set him upon his knees and upon the palms of his hands, gently shaking him into a waking state, so that he assumed at least a crouching position, although his stupor was not yet entirely gone;

— this angel could be Gabriel or one other than him, but without further evidence to the contrary, I’ll identify him as Gabriel, especially in Daniel 9:21-22 where he identified himself and said: “O Daniel, I have now come forth to give thee wisdom and understanding.”

11 And he said unto me, “O Daniel, a man greatly beloved, understand the words that I speak unto thee, and stand upright; for unto thee am I now sent.” And when he had spoken this word unto me, I stood trembling.

— and he said unto him, O Daniel, a man greatly beloved, Cf. Daniel 9:23, understand the words that I speak unto thee, marking them very closely, and stand upright, shaking off the last effects of the numbness besetting him;

— for unto thee Gabriel now sent, as the bearer of a message of comfort and blessing. And when Gabriel had spoken this word unto him, Daniel stood trembling, still in fearful expectation of the matters which would be revealed to him.

12 Then said he unto me, “Fear not, Daniel, for from the first day that thou didst set thine heart to understand and to chasten thyself before thy God, thy words were heard; and I have come for thy words.

— then said Gabriel unto him, Fear not, Daniel; for from the first day that thou didst set thine heart to understand, applying himself most earnestly to the solution of the problems, and to chasten himself before God, in the proper humiliation of mind;

— thy words had come to the attention of God and his prayers heard and Gabriel come but he was delayed.

13 But the prince of the kingdom of Persia withstood me one and twenty days; but lo, Michael, one of the chief princes, came to help me, and I remained there with the kings of Persia.

— because the prince of the kingdom of Persia, the angel of darkness overseeing the Persian world power and therefore identical with some evil spirits, withstood Gabriel twenty one days; this being couldn’t be the Son of God for no other being could withstood the Second in Command, the Son, not even the devil identified by the Romans as Lucifer;

— but, Michael, the first of the angelic beings, known also as the Archangel, came to help him; and he remained there with the kings of Persia, using his influence in the interest of the Lord’s people. There is a world of angels and spirit beings and these spirits often have a very decided influence upon the happenings of our world history.

14 Now I have come to make thee understand what shall befall thy people in the latter days, for yet the vision is for many days.” — now Gabriel come to make Daniel understand what shall befall his people in the latter days,

— during our era and even during the Messianic era; for yet the vision is for many days, it extends far into the future, our future.

15 And when he had spoken such words unto me, I set my face toward the ground, and I became dumb.

— and when Gabriel had spoken such words unto Daniel, he set his face toward the ground, in awe and consternation over the revelations to be expected, and he became dumb, remaining speechless for the time being.

16 And behold, one with the similitude of the sons of men touched my lips. Then I opened my mouth and spoke, and said unto him that stood before me, “O my lord, by the vision my sorrows are turned upon me, and I have retained no strength.

— and, behold, one of the likeness of the sons of men, Gabriel, or perhaps another administrating angel having the appearance of a human being, touched his lips, to heal his dumbness;

— then Daniel opened his mouth and said unto him, O my Lord, by the vision, as a result of his seeing the vision, his sorrows have returned unto him with acute and overwhelming power, and Daniel lost his strength.

17 For how can this servant of my Lord talk with thee, my lord? For as for me, straightway there remained no strength in me, neither is there breath left in me.”

— how can the servant of this my Lord talk with this, my Lord? whose majesty was of a nature to terrify a poor sinful mortal; as for Daniel, straightway there remained no strength in him who grew pale neither is there breath left in him; he could neither stand nor breathe properly for agitation and consternation.

18 Then there came again and touched me one with the appearance of a man; and he strengthened me

— then there came again one like the appearance of a man and touched Daniel; or one like a man again touched him; the same that touched him before, Daniel 10:16, perhaps Gabriel or another administrating angel, using the same language in the following verse as he does Daniel 10:11;

19 and said, “O man greatly beloved, fear not. Peace be unto thee; be strong, yea, be strong.” And when he had spoken unto me, I was strengthened and said, “Let my lord speak, for thou hast strengthened me.”

— and said, O man greatly loved, fear not, for his terror was the real cause of his weakness. Peace be unto thee; be strong, yea, be strong! the repetition of the comforting words serving to give emphasis to them;

— and when he had spoken unto Daniel, he was strengthened and said, ‘my lord speak,’ he now felt able to hear and receive the message; ‘for thou hast strengthened me.’

20 Then said he, “Knowest thou why I come unto thee? And now will I return to fight with the prince of Persia; and when I have gone forth, lo, the prince of Greece shall come.

— then said he, Knowest thou wherefore I come unto thee? The serious and highly important character of the message must be borne in mind by the prophet. And now will he return to fight with the prince of Persia, in order to hinder him from performing his evil designs against the children of Israel;

— and when I am gone forth to prepare to wage war, lo, the prince of Grecia shall come, another hostile spirit, representing Greece, destined to be the next world-power.

21 But I will show thee that which is noted in the Scripture of truth; and there is none that holdeth with me in these things, but Michael your prince.

— but I will show thee that which is noted in the Scripture, in the sacred document of God’s divine decrees; yet there is no one who could stand firmly with Gabriel (perhaps) against these forces, except Michael, the prince and Archangel.

Black Hawk crashed near Taiwan

•April 9, 2023 • Leave a Comment

Could the Black Hawk had been brought down by some unknown forces? And why were neither one of the two pilots not given a fraction of a second to send a SOS message before going down?

Now Japan is searching for 10 people aboard crashed military helicopter off Miyakojimar.

Could the Black Hawk had been brought down by some unknown forces?

Reuters by Tim Kelly, ~ April 6, 2023 // BBC

TOKYO, April 6 (Reuters) – Japan on Thursday said rescue efforts were under way to locate any survivors after one of its military helicopters carrying 10 people crashed in the sea near Miyakojima, part of the country’s southwest Okinawa island chain.

General Yasunori Morishita, chief of staff of Japan’s Ground Self-Defense Force (GSDF), said two pilots, two mechanics, and six passengers are among the missing personnel, including Lt. Gen. Yuichi Sakamoto, a top GSDF commander.

This crash comes just days after nine US soldiers were killed in a mid-air collision involving two Black Hawk helicopters near Fort Campbell, Kentucky.

The UH60 troop transport, commonly known as the Black Hawk, disappeared from radar tracking after leaving a Ground Self Defense Force base on Miyakojima, General Yasunori Morishita said at a press briefing.

The aircraft’s last known position was 18 km northwest of Miyako Airport

The aircraft was patrolling the waters around Miyakojima during an aerial reconnaissance mission, Morishita said. The helicopter was stationed at a key regional army base in Kumamoto prefecture on the southern main island of Kyushu; and one of its 10 crew members is the division commander, Yuichi Sakamoto.

NHK public television earlier said the helicopter disappeared from radar about an hour after it departed from Miyako island and about half an hour before its scheduled return.

The average cruising speed of a Black Hawk is around 174 mph with a deployment range of 1,200 nautical miles. The aircraft’s last known position was 18 km northwest of Miyako Airport. Japan Coast Guard and naval vessels were deployed to search the area.

Chinese navy vessels traveling to the Pacific Ocean from the East China Sea often pass close to Miyakojima, which has hosted GSDF mobile anti-ship missile launchers since 2019.

In the past four days, amid growing tension over a meeting between Taiwanese President Tsai Ing-wen and US House Speaker Kevin McCarthy, at least three Chinese warships have sailed past the island.

Japan searching for 10 people aboard a crashed Black Hawk helicopter

Morishita did not say whether the helicopter was involved in tracking any Chinese military activity.

The government’s priority now is to rescue those who were on board, Japan Prime Minister Fumio Kishida said in comments aired by public broadcaster NHK.

Japanese Coast Guard and military ships and aircraft that located aircraft wreckage in the water were searching for the missing four helicopter crew members and six passengers. Yuichi Sakamoto, a senior GSDF commander, is among the missing.

Daniel (Ch 7-8)

•April 8, 2023 • Leave a Comment

In Daniel 12:4 “but thou, O Daniel, shut up the words, and seal the book that I may tell you that which shall befall you in the last days,” and so we are trying to understand this prophecy in the last days.

In Jewish reckoning it must be noted that this book is among the Writings but not among the Prophets. The foundation for their reasoning is based on sands; what seems to have induced them to downgrade Daniel is the manifest prophecy of the time of the coming of the Messiah whom they couldn’t reconcile with, hence they dropped this prophetic book from Prophets to Writings.

Daniel 7

7: The beasts from the sea (7:1–28 – Babylonian era: Aramaic)

1 In the first year of Belshazzar king of Babylon, Daniel had a dream and visions in his head upon his bed. Then he wrote the dream, and told the sum of the matters.

— in the first year of Belshazzar, king of Babylon, who was coregent with his father Nabonidus and the grandson and adopted son of Nebuchadnezzar, according to the secular accounts; and Daniel had a dream and visions of his head,

— distinct images of his mind, quite distinct from confused pictures, upon his bed, that is, during the night then immediately or soon after it transpired he wrote the dream and told the sum of the matters, setting forth the main facts in due order and omitting matters of secondary importance such as details pertaining to the appearance of the beasts.

2 Daniel spoke and said, “I saw in my vision by night, and behold, the four winds of the heaven strove upon the great sea.

— Daniel spoke and said in introducing his narration of the strange experience which befell him, and he saw in his vision by night and, behold, the four winds of the heaven from the four main points of the compass, strove upon the great sea, storming along against one another upon the face of the ocean.

3 And four great beasts came up from the sea, diverse one from another. — and four great beasts, monstrous in size and awful in look, came up from the sea, world-powers rising out of the turbulent political sea of the heathen world, one diverses from another, one after the other issuing from the great deep.

4 The first was like a lion, and had eagle’s wings. I beheld till the wings thereof were plucked, and it was lifted up from the earth, and made to stand upon the feet as a man, and a man’s heart was given to it.

— the first was like a lion and had eagle’s wings, emblem of kingly power and authority; Daniel beheld till the wings were plucked off, taking from the beast the ability to fly;

— and it was lifted up from the earth to which it was confined after having been deprived of its unrestrained motion and made stand upon the feet as a man, standing upon its hind feet in an upright position and a man’s heart was given to it so that it partook of the mind and the feelings of a human being;

— the interpretation of this vision may briefly be given as follows. The lion with the eagle’s wings was the Babylonian Empire, whose victorious progress was halted about the time that Nebuchadnezzar was stricken with the peculiar madness, which caused him to seek the fellowship of beasts, which, however, later received at least some understanding of the true God.

5 And behold, another beast, a second, like unto a bear. And it raised up itself on one side, and it had three ribs in the mouth of it between the teeth of it; and they said thus unto it, ‘Arise, devour much flesh.’

— and behold another beast, a second, like to a bear, appearing later in point of time and it raised up itself on one side so that it leaned over sideways as it lifted the shoulder on that side to move forward;

— the bear symbolises the Medes, an ancient people, and the Persians, a more modern tribe, formed one united sovereignty in contrast to other kingdoms; the three ribs in its mouth are Media, Lydia, and Babylon, brought under the Persian sway; or Darius the Mede; Cyrus, Ahasuerus, and Darius, forming three ribs.

6 After this I beheld, and lo another, like a leopard, which had upon the back of it four wings of a fowl. The beast had also four heads; and dominion was given to it.

— after this Daniel beheld and lo, a third animal coming on the scene somewhat later in history, like a leopard which had upon the back of it four wings of a fowl, enabling it to move with great speed;

— the beast had also four heads, indicating that its authority would be divided among four sovereigns; and dominion was given to it, great authority and power in the worl; the leopard upon whose back wings appeared is the Grecian Empire, which, under Alexander the Great, spread over the world with great rapidity.

7 After this I saw in the night visions, and behold, a fourth beast, dreadful and terrible, and strong exceedingly; and it had great iron teeth. It devoured, and broke in pieces, and stamped the residue with the feet of it; and it was diverse from all the beasts that were before it, and it had ten horns.

— after this, behold a fourth beast, dreadful and terrible, of awe-inspiring fierceness, and strong exceedingly and it had great iron teeth, symbolizing the lust of conquest and destruction; it devoured and brake in pieces, greedily feeding on whatever it could get into its power and stamped any residue, whatever it could not devour with the feet of it, bent upon annihilating all that stood in its way;

— and it was diverse from all the beasts that were before it so that the entire animal kingdom could furnish no beast to which it was similar; and it had ten horns, giving further impression of power and ferocity;

— the fourth beast is the Roman Empire with its insatiable fierceness and love of conquest, whose spiritual descendant and successor is the kingdom of the Pope at Rome, just as delineated in the Book of Revelation. The ancient empire indeed came to an end, but it was revived in the empire of Charles the Great, and the political power of the Pope is felt in practically every nation of the earth today.

8 I considered the horns, and behold, there came up among them another little horn, before whom there were three of the first horns plucked up by the roots. And behold, in this horn were eyes like the eyes of man, and a mouth speaking great things.

— Daniel considered the horns, observing them very closely and behold, there came up among them another little horn, springing up as the eleventh and at first insignificant in size, before whom there were three of the first horns plucked up by the roots, to make room for the newcomer;

— and behold, in this horn were eyes like the eyes of man, symbols of understanding, although not possessing the characteristics of divinity, and a mouth speaking great things, full of proud and blasphemous boasting;

— the fourth beast, the Roman Empire, also brought forth the Catholic Church. Practically every feature of the description fits the rule of this Roman Church from the very start. The kingdom of the Pope grew up like a horn, exerting its political power very gradually, but none the less surely. From small beginnings it developed until it reached a station in which it practically controlled the fate of nations.

The Popes have, in many cases, made use of the highest wisdom, together with an almost diabolical cunning, to further their cause. By dint of their cunning they made their authority felt in the counsels of nations; they have impressed people with their power far above the real status of affairs.

The kingdom of the Pope is unlike every other kingdom, since he exerts political power under the guise of spreading the kingdom of God. Time and again the Pope of Rome has spoken blasphemous words against the one true God. History records numerous instances of persecutions carried on by Popes and their millions, as during the terrible inquisitions.

Popes have altered the Word of God to suit their own convenience and to serve their selfish interests. In spite of the reverses which the kingdom of Antichrist has suffered in the past, as when Emperor Otto I deposed Pope John XII, when the councils of the fifteenth century tried to effect at least an outward reformation, and, above all, when Martin Luther carried the fight into the enemy’s ranks, the kingdom of Antichrist will remain till the end of time. Cf II Thessalonians 2; Revelation 17.

The prophecy of Daniel was fulfilled and is being fulfilled in a most remarkable manner, a fact which tends to strengthen our faith in every word of the Bible.

9 “I beheld till the thrones were cast down, and the Ancient of Days sat down, whose garment was white as snow and the hair of His head like the pure wool. His throne was like the fiery flame, and His wheels as burning fire.

— Daniel beheld, till the thrones were cast down by a great act of judgement by the Ancient of Days, symbol of the eternal and majestic God, who sit, whose garment was white as snow and the hair of his head like the pure wool, both symbols of unsullied purity and holiness;

— his throne was like the fiery flame, flashing as though composed of a fiery mass and His wheels as burning fire, symbolical of the fiery zeal with which the Lord punishes the transgressors but also purifies His people and prepares them for the future glorification.

10 A fiery stream issued and came forth from before Him. Thousand thousands ministered unto Him, and ten thousand times ten thousand stood before Him: the judgement was set, and the books were opened.

— a fiery stream issued and came forth from before God, to devour the sinful and hostile forces of the world and to purify the children of the Kingdom. Thousand thousands ministered unto him and ten thousand times ten thousand stood before him, an uncounted number of holy angels ready to do his will;

— the Judgement was set, everything was made ready for the trial and the books were opened, namely, the books of record in which the deeds of men were entered to serve as the basis of the sentence to be pronounced upon men by the heavenly Judge.

11 “I beheld then because of the voice of the great words which the horn spoke; I beheld even till the beast was slain, and his body destroyed and given to the burning flame.

— Daniel beheld them because of the voice of the great words which the horn spoke for it was due to the boasting of the ruler represented by the last horn that judgement and destruction came upon the world;

— Daniel beheld even till the beast was slain, namely, the fourth, the fierce and destructive beast and his body destroyed and given to the burning flame, whose devouring fiery streams issued from the throne of the eternal Judge.

12 As concerning the rest of the beasts, they had their dominion taken away, yet their lives were prolonged for a season and time. — as concerning the rest of the beasts, the three which were first described, they had their dominion taken away, their power was also taken away in the general judgement;

— yet their lives were prolonged for a season and time, or rather “for the duration of their life was fixed” as to the season and time; God had determined beforehand how long their dynasty should last;

— in the Talmud: Sanhedrin 98a:13 – Sefaria: Rabbi Alexandri explains: If they merit redemption through repentance and good deeds I will hasten the coming of the Messiah. If they do not merit redemption, the coming of the Messiah will be in its designated time.

13 “I saw in the night visions, and behold, one like the Son of Man came with the clouds of heaven, and came to the Ancient of Days, and they brought Him near before Him.

— Daniel saw in the night visions and behold, one like the Son of Man came with the clouds of heaven, Rashi: one like a man coming: that is the King Messiah;

— in the Talmud: Sanhedrin 98a:13 – Sefaria: Rabbi Alexandri explains: If the Jewish people merit redemption, the Messiah will come in a miraculous manner with the clouds of heaven. If they do not merit redemption, the Messiah will come lowly and riding upon a donkey.

— one like the Son of Man riding upon them as on a celestial chariot, and came to the Ancient of Days, and they brought the Son before the Father; it is on the basis of this passage, which describes the formal inauguration of the Messiah that he applied the name “Son of Man” so frequently in the gospels;

— although Jewish authority acknowledges that this book Daniel is a Sacred Text, they relegated it to “Writings” so that this book is not among the Prophets; it isn’t a prophecy, they didn’t quite like it, despite Rashi’s statement above; backed by the Talmud. The reasons they give are based on shallow reasoning as the Prophet Isaiah speaks of his own people, Israel, which include their own blind shepherd, “Hear, ye deaf; and look, ye blind, that ye may see,” Isaiah 42:18.

— their stout-hearted shepherd have induced themselves to degrade Daniel is another prophecy of the time of the Messiah’s coming in this book, that he is the Son of God; and when their eyes are open, they will see the one whom they have pierced, and they will mourn for him as one mourns for an only child, and grieve bitterly for him as one grieves for a firstborn son, Zechariah 12:10.

14 And there was given Him dominion and glory and a Kingdom, that all people, nations, and languages should serve Him. His dominion is an everlasting dominion, which shall not pass away, and His Kingdom that which shall not be destroyed.

— and there was given him dominion and glory and a kingdom, divine authority over the domain of the earth, that all people, nations and languages should serve Him;

— his dominion is an everlasting dominion which shall not pass away and his kingdom that which shall not be destroyed. The description clearly shows that the Son of Man is a person distinct from the Father, and that the fact of his eternal dominion and power is a direct argument for His deity. Cf Revelation 11:15; Revelation 19:16.

15 “I, Daniel, was grieved in my spirit in the midst of my body, and the visions of my head troubled me.

— Daniel grieved in his spirit in the midst of his vision for the body contains the spirit as the scabbard contains the sword, and the visions in his head troubled him; he felt most apprehensive concerning them.

16 I came near unto one of those who stood by, and asked him the truth of all this. So he told me and made me know the interpretation of the things:

— Daniel came near unto one of them, perhaps an angel, that stood by, one of those engaged in the service of God, and asked him the truth of all this, the true explanation of the judgement scene which was here enacted. So he told Daniel and made him know the interpretation of the things, so that Daniel understood the vision in all its parts.

17 ‘These great beasts, which are four, are four kings who shall arise out of the earth. — these great beasts, which are four, are four kings; the heads of mighty empires, each one the founder of a dynasty, which shall arise out of the earth, from the surface of the earth, of the earth, earthy.

18 But the saints of the Most High shall take the Kingdom and possess the Kingdom for ever, even for ever and ever.’ — but the Elects of the Most High shall take the kingdom, receiving it as a gift from above and possess the kingdom forever, even forever and ever;

— the Sainsts of the covenant nation, the congregation of the Lord, gathered from of all the nations are by virtue of their faith in the Messiah, possessors of the kingdom of God, they enjoy all the blessings of the Lord in this relationship to the Son of God and to their heavenly Father here in time and hereafter in eternity.

19 “Then I would know the truth of the fourth beast, which was diverse from all the others, exceeding dreadful, whose teeth were of iron and his nails of brass, which devoured, broke in pieces, and stamped the residue with his feet;

— then Daniel would know the truth of the fourth beast, that is, Daniel was anxious to know about this beast also, which was diverse from all the others, so utterly different from them;

— exceeding dreadful, whose teeth were of iron and his nails of brass, the feature of the brazen claws being added in this description; which devoured, brake in pieces and stamped the residue with his feet.

20 and of the ten horns that were in his head, and of the other which came up and before whom three fell, even of the horn that had eyes and a mouth that spoke very great things, whose look was more stout than his fellows.

— and of the ten horns that were in his head and of the other which came up and before whom three fell, even of that horn that had eyes and a mouth that spake very great things, in boastful blasphemy, whose look was more stout than his fellows, that is, his appearance was such as to inspire terror.

21 I beheld, and the same horn made war with the saints and prevailed against them — Daniel beheld and the same horn made war with the saints and prevailed against them, this being apart of its campaign of destruction, it involved a temporary defeat of the forces of the Lord,

22 until the Ancient of Days came, and judgement was given to the saints of the Most High; and the time came that the saints possessed the Kingdom.

— until the Ancient of Days came, the true and only God coming to judgement upon his enemies, and judgement was given to the saints of the Most High for the Lord took their part and effected their deliverance from the oppression of the beast;

— and the time came that the saints possessed the kingdom, the Kingdom of God holding the blessings of the Lord even here in time, in spite of all hostility of Satan and his evil forces and entering into undisturbed possession of them in the Kingdom of God.

23 “Thus he said: ‘The fourth beast shall be the fourth kingdom upon earth, which shall be diverse from all kingdoms, and shall devour the whole earth, and shall tread it down and break it in pieces.

— thus he said, the fourth beast shall be the fourth kingdom upon earth, following the Babylonian, the Medo-Persian and the Greek empire, respectively, which shall be diverse from all kingdoms and shall devour the whole earth and shall tread it down and break it in pieces, the general effect of its rule being decidedly destructive.

24 And the ten horns out of this kingdom are ten kings that shall arise; and another shall rise after them, and he shall be diverse from the first, and he shall subdue three kings.

— and the ten horns out of this kingdom are ten kings that shall arise, that is, the Roman Empire, upon its disintegration, would be resolved into a number of smaller states, all of which would, however, carry on the traditions of the mother state and still be one in spirit with her;

— and another shall rise after them, a ruler wielding a great deal of power and he shall be diverse from the first, differing from his predecessors and he shall subdue three kings, causing them completely to lose their identity.

25 And he shall speak great words against the Most High, and shall wear out the saints of the Most High, and think to change times and laws; and they shall be given into his hand until a time, and times, and the dividing of time.

— and he shall speak great words against the Most High in blasphemies of an unusually vicious character and shall wear out the saints of the Most High and think to change times and laws, setting aside human and divine laws at will;

— and they shall be given into his hand for him practically to work his will as he chose until a time and times and the dividing of time, the entire length of time, divided into three distinct periods being figured in terms of God’s time;

— changing of times, from Sabbaths to Sundays; her sabbaths where the original Sun-worshippers were the Samaritans, brought from Assyria: And the king of Assyria brought men from Babylon, and from Cuthah, and placed them in the cities of Samaria instead of the children of Israel; and they possessed Samaria and dwelt in the cities thereof, II Kings 17:24.

26 “‘But the judgement shall sit, and they shall take away his dominion, to consume and to destroy it unto the end. — but the judgement shall sit, the sentence will be carried out and they shall take away his dominion to consume and to destroy it unto the end so that its final destruction is not to be expected before the end of the world.

27 And the kingdom and dominion, and the greatness of the kingdom under the whole heaven, shall be given to the people of the saints of the Most High, whose Kingdom is an everlasting Kingdom, and all dominions shall serve and obey Him.’

— and the kingdom and dominion and the greatness of the kingdom under the whole heaven, throughout the world, shall be given to the people of the saints of the Most High so that the Kingdom of the Lord would finally be victorious whose kingdom is an everlasting kingdom and all dominions shall serve and obey him.

28 “Here is the end of the matter. As for me, Daniel, my cogitations much troubled me, and my countenance changed in me; but I kept the matter in my heart.”

— here is the end of the matter, this is the gist of the vision. As for Daniel, his heart troubled him much, namely, after he awoke from his dream and his countenance changed, his face showed the effect of his worry over the matter; but Daniel kept the matter to himself.

Daniel 8

8: The ram and the he-goat (8:1–27 – Babylonian era; Hebrew)

1 In the third year of the reign of King Belshazzar a vision appeared unto me, even unto me, Daniel, after that which appeared unto me at the first.

— in the third year of the reign of Belshazzar, two years after Daniel had had the vision of the four monarchies, a vision appeared unto him, after which appeared unto him. It is evident that this vision did not come to Daniel in a dream, but that he was awake and conscious while this information came to him.

2 And I saw in a vision; and it came to pass when I saw, that I was at Shushan in the palace, which is in the province of Elam; and I saw in a vision, and I was by the river of Ulai.

— and Daniel saw in a vision in a state of ecstasy; and it came to pass when he saw that he was at Shushan or Susa in the palace, which is in the province of Elam, for Susa was the capital of this province during the Babylonian supremacy while under Persian reign it was located in the satrapy of Susiana;

— and Daniel saw in a vision and he was by the river of Ulai, or Eulaeus, on which Susa was situated. Daniel evidently in his capacity as one of the foremost officials of the empire, visited various provinces from time to time or he may even have had a winter home in this city.

3 Then I lifted up mine eyes and saw, and behold, there stood before the river a ram which had two horns; and the two horns were high, but one was higher than the other, and the higher came up last.

— then Daniel lifted up his eyes and saw and, behold, there stood before the river, a ram not in a flock but alone which had two horns; and the two horns were high, both of them expressive of royalty and power but one was higher than the other, and the higher the one possessing the greater power, came up last, it was later in point of time;

— the ram which thou sawest having two horns are the kings of Media and Persia, or the Medo-Persian Empire, v 20 below; which destroyed the Babylon empire in 539 BC and ruled to 331 BC.

4 I saw the ram pushing westward and northward and southward, so that no beasts might stand before him, neither was there any that could deliver out of his hand; but he did according to his will and became great.

— Daniel saw the ram pushing westward and northward and southward to subdue all the countries located in these directions so that no beasts might stand before him, neither was there any that could deliver out of his hand, his power, for the time being was absolute;

— but he did according to his will and became great so that the empire which he represented became a world power.

5 And as I was considering, behold, a hegoat came from the west on the face of the whole earth, and touched not the ground; and the goat had a notable horn between his eyes. — and as Daniel was considering, behold, an he-goat came from the west, from Europe, across Asia Minor;

6 And he came to the ram that had two horns, which I had seen standing before the river, and ran unto him in the fury of his power.

— and he came to the ram that had two horns, not stopping for any consideration, which Daniel had seen standing before the river, and ran unto him in the fury of his power, in irresistible mighty rage.

— then the Greco-Macedonian Empire came on the scene with its first great king, Alexander the Great (verses 6 and 7); the conquest of the Medo-Persian Empire by Alexander the Great occurred in 331 BC.

The ram that had two horns

7 And I saw him come close unto the ram, and he was moved with fury against him, and smote the ram and broke his two horns; and there was no power in the ram to stand before him, but he cast him down to the ground and stamped upon him. And there was none that could deliver the ram out of his hand.

— and Daniel saw him come close unto the ram, and he was moved with choler against him with sudden, explosive anger and smote the ram in a fierce overthrow and brake his two horns; and there was no power in the ram to stand before him;

8 Therefore the he-goat waxed very great; and when he was strong, the great horn was broken, and in its place came up four notable ones toward the four winds of heaven.

— therefore the he-goat waxed very great, his power developed mightily; and when he was strong, just as he reached the highest point of his might;

— the great horn was broken, the unity of the attacking power was disrupted with the death of its leader: and for it came up four notable ones, four leaders, who divided the power among themselves toward the four winds of heaven.

— the horn in the goat’s head symbolized the “first king” of the Greco-Macedonian Empire; that was Alexander the Great; but this horn was suddenly “broken!” Alexander the Great died suddenly of a fever in Babylon little more than thirty years of age!

9 And out of one of them came forth a little horn, which waxed exceeding great, toward the south and toward the east and toward the pleasant land.

— and out of one of them came forth a little horn, sprouting in a diminutive manner like the branches in the prongs of an antelope which waxed exceeding great toward the south and toward the east and toward the pleasant land, Judea, the glorious land, the land of God’s chosen people;

— this “little horn” appears coming out of one of the four divisions of Alexander’s empire.

10 And it waxed great, even to the host of heaven; and it cast down some of the host and some of the stars to the ground, and stamped upon them.

— and it waxed great, even to the host of heaven, to the congregation of the Lord’s people, for the Jews were at that time representatives of the Lord’s Kingdom on earth; and it cast down some of the host and of the stars to the ground and stamped upon them, presuming, in its pride to wage warfare even against the stars (saints) of the Lord;

— the “little horn” will persecute the true Church; the “holy people” who shall shine in the resurrection like the stars of heaven (compare Daniel 8:10, 24 with Daniel 12:3). He seems like Antiochus Epiphanes!

11 Yea, he magnified himself even to the prince of the host; and by him the daily sacrifice was taken away, and the place of his sanctuary was cast down.

— yea, he, Antiochus Epiphanes, magnified himself even to the prince of the host, placing himself on a level with the most high God and by him the daily sacrifice was taken away, that is, he interfered with the worship of the true God as then carried on in the Temple, and the place of his Sanctuary was cast down, profaned with blasphemous behavior;

— some misguided Adventists say the heavenly Sanctuary was “cast down” – it’s just baloney: all the heavenly angels and even God allows this to happen around his Throne is more than ludicrous? (more at the end)

12 And a host was given him against the daily sacrifice by reason of transgression, and it cast down the truth to the ground; and it practiced, and prospered.

— and an host was given him against the daily sacrifice by reason of transgression, that is, “warfare was inaugurated against the daily sacrifice with outrage,” with idolatrous worship by the heathen ruler, Antiochus Epiphanes, represented by the last horn, and it cast down the truth to the ground; and it practiced and prospered; it accomplished this much, it was successful by divine permission.

13 Then I heard one saint speaking, and another saint said unto that certain saint who spoke, “How long shall be the vision concerning the daily sacrifice and the transgression of desolation, to give both the sanctuary and the host to be trodden under foot?”

— then Daniel heard one saint, one of the Lord’s saints speaking and another saint said unto that certain saint which spoke as they were conversing, the interruption being made in the interest of Daniel;

— how long shall be the vision concerning the daily sacrifice, that is, how long the destruction of the Lord’s worship, continue and the transgression of desolation, the horrible transgression which had just been described to give both the Sanctuary and the host to be trodden under foot?

14 And he said unto me, “Until two thousand and three hundred days; then shall the sanctuary be cleansed.” — and he said unto Daniel, Unto two thousand and three hundred days;

— literally, “evening-mornings” then shall the Sanctuary be cleansed or “justified” which may mean deconsecrated, (the original “days” in Hebrew is “bō·qer e·reḇ” which is morning/evening). The figures and further analysis are given at the end of this chapter

— the doctrine of the Investigative Judgement, which began on October 22, 1844, is an integral part of the Seventh-day Adventist doctrine of the sanctuary, teaching that a judgement had begun on that year’s Day of Atonement, when Christ entered the Most Holy Place in heaven to start an “investigative judgement.”

— one of the mysteries is that according to Jewish reckoning, there is no way Yum Kippur, or Day of Atonement, on Tishrei 10, 5605 could be so late as October 22 in year 1844; or of any year; and in the year 1844 (Hebrew year 5605) the Day of Atonement was on September 23;

— the only possibility of October 22, 1844 being a Day of Atonement would be following a Samaritan calendar, which, started nefariously by king Jeroboam of the Northern 10-Tribes, is at times, a month late, (more on this at the end).

15 And it came to pass, when I, even I Daniel, had seen the vision and sought for the meaning, then behold, there stood before me one with the appearance of a man.

— and it came to pass when Daniel, even he had seen the vision and sought for the meaning, pondering over it, viewing it from every angle, then, behold there stood before me as the appearance of a man the apparition coming with startling suddenness.

16 And I heard a man’s voice between the banks of Ulai, who called and said, “Gabriel, make this man to understand the vision.”

— and Daniel heard a man’s voice, between the banks of Ulai, coming from between the two branches of the Eulaeus River, which called and said, Gabriel, make this man to understand the vision. So the being who appeared to Daniel in the aspect of a man was one of the Lord’s angels.

17 So he came near where I stood. And when he came I was afraid and fell upon my face, but he said unto me, “Understand, O son of man,for at the time of the end shall be the vision.”

— so he came near where Daniel stood; and when he came, Daniel as afraid, the close proximity of a holy being filled him with fear and fell upon Daniel’s face; but he said unto him;

— Understand, O son of man; for at the time of the end shall be the vision, that is, it gives information concerning occurrences at the end of time, the final period of the earth’s history.

18 Now as he was speaking with me, I was in a deep sleep with my face toward the ground; but he touched me and set me upright.

— now, as he was speaking with Daniel, who was in a deep sleep on his face toward the ground in a state of numbness or ecstasy; but he touched Daniel and set him upright, strengthening him for the time being that he might witness the rest of the vision.

19 And he said, “Behold, I will make thee know what shall be in the last end of the indignation, for at the time appointed the end shall be.

— CSB and said, “I am here to tell you what will happen at the conclusion of the time of wrath, because it refers to the appointed time of the end; when the wrath of God would be poured out upon the godless world; for at the time appointed the end shall be.

20 The ram which thou sawest having two horns, these are the kings of Media and Persia. — the ram which thou sawest having two horns are the kings of Media and Persia, the Medo-Persian monarchy in its entire historical development.

— this empire subdued, under Persian leadership: toward the west, Babylon, Mesopotamia, Syria, and the countries of Asia Minor; toward the north, Colchis, Armenia, Iberia, and the states along the Caspian Sea; toward the south, Judea, Egypt, Ethiopia and India.

21 And the rough goat is the king of Greece; and the great horn that is between his eyes is the first king. — and the rough goat, moving eastward across Asia Minor in victorious advance, is the king of Grecia, literally “of Javan”

— Macedonia, Greece and the Ionian colonies being included in the term; and the great horn that is between his eyes is the first king, Alexander the Great, the founder of this world-power.

22 Now that one being broken, in whose place four stood up for it, four kingdoms shall stand up out of the nation, but not in his power. — now, that being broken, whereas four stood up for it, or “concerning the horn, that it was broken and that four then took its place,”

— this is the meaning: four kingdoms shall stand up out of the nation, out of the world of nations united under the rule of the first king, but not in his power, not equal to the founder, neither singly nor all taken together.

23 And in the latter time of their kingdom, when the transgressors are come to the full, a king of fierce countenance and understanding dark sentences shall stand up.

— and in the latter time of their kingdom, that is, after these dynasties had been in existence for some time, when the transgressors are come to the full, when the apostate Jews would once more have fulfilled the measure of their wickedness;

— a king of fierce countenance, shameless, one like Antiochus Epiphanes, without the slightest regard for God and men, and understanding dark sentences, hiding his true purposes behind ambiguous statements, shall stand up, coming into power as the ruler of that section of the Greek Empire.

24 And his power shall be mighty, but not by his own power; and he shall destroy wondrously, and shall prosper and perform, and shall destroy the mighty and the holy people.

— and one like Antiochus Epiphanes, his power shall be mighty, but not by his own power, with the permission of God; and he shall destroy wonderfully, so that men would be astonished at his activities in this respect, and shall prosper and practice and shall destroy the mighty and the holy people, venting his spite both upon the warlike enemies opposing him and upon the congregation of the saints;

— the “little horn” which was transformed into the pagan papal Roman Church, has all along persecutes the true Church — the “holy people” who shall shine in the resurrection like the stars of heaven (compare Daniel 8:10, 24 with Daniel 12:3).

25 And through his policy also he shall cause deceit to prosper in his hand; and he shall magnify himself in his heart, and by using peace shall destroy many. He shall also stand up against the Prince of princes, but he shall be broken without raising a hand.

— and through his, the “little horn” policy also he shall cause craft to prosper in his hand, that is, in accordance with his cunning he would succeed in his deception in various hypocritical plans which he had decided upon; and he shall magnify himself in his heart, becoming proud by reason of these successful maneuvers;

— and by peace shall destroy many, while they were living in care-free security, the suddenness of the attack causing them to yield without a struggle; he shall also stand up against the Prince of princes, presuming to set himself even against God. But he shall be broken without hand; God Himself taking his punishment in hand.

26 “And the vision of the evening and the morning which was told is true. Therefore shut thou up the vision, for it shall be for many days.”

— and the vision of the evening and the morning which was told, concerning the length of the time of the affliction, is true; wherefore shut thou up the vision, to preserve it for such later day, for it shall be for many days, the vision, being concerned with things of the distant future, would retain its prophetic value and should therefore not be revealed generally at this time.

27 And I, Daniel, fainted and was sick several days. Afterward I rose up and did the king’s business; and I was astonished at the vision, but none understood it.

— and Daniel, overcome by the startling and overwhelming character of the revelation, fainted and was sick certain days. Afterward Daniel rose up and did the king’s business, attending to the duties of his office as before; he kept his counsel concerning it, but none understood it, for the full significance of the revelation he received would be possible only with its fulfillment.

— and Daniel kept his counsel concerning it, but none understood it, for the full significance of the revelation he received would be possible only with its fulfillment. Antiochus Epiphanes is rightly regarded in history as a type of Antichrist, the papacy of Rome, for he made every effort to drive out the worship of the true God in the Holy Land and to substitute instead a veneration of himself.

~~~

More on the 2300 days when the daily sacrifices are taken away (Daniel 8:13-14)

First read Daniel 8:13-14

Then I heard one saint speaking, and another saint said unto that certain saint who spoke, “How long shall be the vision concerning the daily sacrifice and the transgression of desolation, to give both the sanctuary and the host to be trodden under foot?”

And he said unto me, “Until two thousand and three hundred days; then shall the sanctuary be cleansed” Daniel 8:13-14

A key to this mysterious time period was hidden from Daniel’s understanding — was not to be revealed until the latter days! It is a prophecy for our time — this climactic 21st Century!

SDAs explain this prophecy by assuming the “sanctuary” is in heaven and claim that this vision of “2300 days” commenced in 457 BC and ended in 1844, (using a day for a year principle, hence the “2300 days” represent 2300 years).

First Disappointment October 22, 1843; Second Disappointment October 22, 1944

They claim that during this time of 2300 years the “sanctuary” that was cast down — the Holy of Holies in heaven itself — God’s very throne — was to be “cleansed” beginning on October 22, 1844 (which is Cheshvan 9, not Yum Kippur). The only possibility of October 22, 1844 being a Day of Atonement would be following a Samaritan calendar, where they make their observation from Mount Gerizim, which, started by a reprehensible king, Jeroboam of the Northern 10-Tribes, is often times, a month late.

Oh Goodness! How could “the little horn” cast down the Holy of Holies in heaven? Insanity asides, how could well over 20 millions believe such balderdash today? Such thinking are just Nonsense! Unless, of course, they were deceived by a Prophetess, Jezebel, see Revelation 2:20.

“O Blind Guides! Who warned you to flee from the wrath to come?” The first thing that these misguided need to clean is to clean their own brains. God the Almighty is well capable of looking after his Holy of Holies in heaven! Or, is he not so Almighty?

Whatever the answer is, it has to do with an earthly event concerning the Sanctuary or the Temple in Jerusalem. But notice the little horn takes away the daily sacrifice for “2300 days.” Were there any daily sacrifices taken away since the writing of Daniel?

One possible answer is that this prophecy of the taking away of the evening and morning sacrifice has already been fulfilled by Antiochus Epiphanes. This is rather possible! Notice why: what happened to the daily sacrifice in the days of Antiochus Epiphanes (168-165 BC).

The wicked deeds of Antiochus Epiphanes are recorded in Daniel 11:31. He polluted the ancient sanctuary. He took away the daily sacrifice, and the 1150 days is one possibility; or perhaps it could be a preamble.

Now consider who the “little horn” in this prophecy is. It spring out from the King of the North; which originally was Syria, the Seleucid Empire — north of Palestine. But Syria was soon swallowed by ROME. The Roman system of government became the “King of the North.”

Later the “little horn” became the papal Roman Church, which persecutes the true Church — the “holy people” shall shine in the resurrection like the stars of heaven (compare Daniel 8:10, 24 with Daniel 12:3).

The papal Roman Church had existed to our time in Europe, Asia and now all over the world. In the Middle Ages it was called the Holy Roman Empire, and the church ever since was and is the Roman Catholic Church.

Notice Daniel 8:26: “And the vision of the evening and the morning which was told is true….” The vision of “2300 days” is actually called in the Scripture “the vision of the evening and the morning”

The word “days” this note reveals that the original Hebrew of the word “days” is “evening morning” (the original “days” in Hebrew is “bō·qer e·reḇ” which is morning and evening). This prophecy is NOT referring to 24-hour days but to evenings/mornings; that is, the evening and the morning sacrifice!

According to verse 11 the little horn takes away the DAILY SACRIFICE. The daily sacrifice was offered in the evening and in the morning. In Exodus 29:39, “The one lamb thou shalt offer in the morning, and the other lamb thou shalt offer at evening.”

Verse 14 in other versions “two thousand three hundred evenings and mornings.” In other words, here is a prophecy that two thousand three hundred evening and morning sacrifices would cease to be offered.

Since the daily sacrifice was offered TWICE A DAY, this prophecy is actually speaking of one thousand one hundred fifty (1150) days. In 1150 days there would be exactly two thousand three hundred sacrifices offered at evening and morning.

Some excerpts from Wikipedia (Hanukkah)

When the Second Temple in Jerusalem was looted and services stopped, Judaism was outlawed. In 167 BCE, Antiochus ordered an altar to Zeus erected in the Temple. He banned brit milah (circumcision) and ordered pigs to be sacrificed at the altar of the temple.

By 164 BCE, the Jewish revolt against the Seleucid monarchy was successful. The Temple was liberated and rededicated. The festival of Hanukkah was instituted to celebrate this event. Judah ordered the Temple to be cleansed, a new altar to be built in place of the polluted one and new holy vessels to be made.

We may not be sure of the exact dates, but one account says the abomination took place on the 15th of Kislev (1 Maccabees 1:54) in 167 BC, and at the end of this 1150-day period the sanctuary is to be “cleansed” or “justified” and on another account this cleansing was established on the 25th of Kislev in 164 BC to celebrate this liberation:

Hanukkah; which would be roughly 1105 days, short of 1150 days by 45 days, or 90 “evening morning, bō·qer e·reḇ.” Thus this prophecy of “2300 days” could have been or partially fulfilled by the abomination set up by Antiochus Epiphanes until its liberation.

And finally, such a prophecy could be dual, that is, another possibility could reoccur if the third Temple is to be built in Jerusalem in the future and another transgression of desolation causing the daily sacrifices to cease. This final time, it could be fulfilled exactly “2300 days.”

And skipping forward to Daniel 12:11 “And from the time that the daily sacrifice shall be taken away and the abomination that maketh desolate set up, there shall be a thousand two hundred and ninety days.”

And in Matthew 24:15 “When ye therefore shall see the abomination of desolation, spoken of by Daniel the prophet, standing in the holy place (whoso readeth, let him understand).” There we are, another transgression of desolation yet in the future. How will all these play out, well, we’ll have to wait and see.

“All Thy Lovers” – Saudi Arabia

•April 7, 2023 • Leave a Comment

Saudi Arabia makes its Eurasian shift. Her recent reconciliations with Iran and Syria under Chinese-Russian guidance is perceived as a step toward reducing Riyadh’s dependence on the US, while also advancing Beijing and Moscow’s political and economic influence in West Asia.

Saudi Arabia’s “Pivot to Asia” in Progress!

The Cradle by Agha Hussain ~ April 3, 2023

On 6 March, 2023, Iranian and Saudi officials held a meeting in Beijing where they agreed to restore bilateral relations. The agreement was significant not only for the mutual de-escalation of tensions in West Asia, but also for Saudi Arabia’s growing importance in the process of Eurasian integration led by China and Russia.

By welcoming Chinese mediation, the kingdom has positioned itself as an independent actor capable of opening doors for Beijing and Moscow in a region where they have traditionally been overshadowed by a great power rival, the US. This move boosts Saudi Arabia’s importance in the geopolitical landscape and strengthens its ties with Beijing and Moscow.

Asserting autonomy from the US

For much of its history, Saudi Arabia was a staunch ally of the US in the Persian Gulf region. However, Crown Prince Mohammed bin Salman’s (MbS) military quagmire in Yemen – among other things – damaged Washington’s perception of the kingdom as a stable and reliable outpost in the region. The feeling was mutual and forced MbS to seek assistance from other nations to help lower tensions on Saudi frontiers.

Between 2021 and 2022, Riyadh engaged in several rounds of an Iraq-hosted dialogue with Iran to negotiate assistance from Tehran in preventing its allies in Yemen and Iraq from attacking Saudi territory.

What is particularly noteworthy to China and Russia is that MbS did not use this diplomacy as a means to restore the US’ traditional centrality in the kingdom’s regional and security policies. Instead, he made a point of cooperation with Beijing and Moscow while simultaneously snubbing Washington.

For example, in October 2022, Saudi Arabia partnered with OPEC+ partner Russia to cut oil production, breaking commitments made to US President Joe Biden during his July visit to Jeddah. MbS also overshadowed Biden’s trip with a much grander welcome for Chinese President Xi Jinping in December, during which Riyadh also hosted the first China-Gulf Cooperation Council (GCC) Summit to underscore the Saudi view of China as a regional partner rather than just a bilateral one.

Against this backdrop, the Saudi decision to sign a Chinese-brokered deal with Iran without Washington’s involvement has been interpreted as a “middle-finger to Biden,” in the words of former US State Department analyst Aaron David Miller.

Similarly, Riyadh’s nascent Russian-brokered detente with Syria, whose Iran and Russia-allied government is still opposed by the US, also illustrates Saudi Arabia’s willingness to move away from its traditional pro-American stance.

Moving the region eastward

To China and Russia, these moves by MbS signify more than just diplomatic victories over the US. They represent Saudi Arabia’s support for their efforts to shape the dynamics in the Persian Gulf, where both Eurasian powers have hitherto kept a low profile on account of the decades-long western domination of the region – now on its way out.

Facilitated by Saudi Arabia, Beijing, and Moscow can engage the Persian Gulf as a bridgehead to expand their influence in the broader West Asian region and thus advance their Eurasian integration designs.

China, in particular, has taken the lead in this regard with its ambitious, multi-trillion-dollar Belt and Road Initiative (BRI). The Persian Gulf is already well integrated with the BRI thanks to the burgeoning Chinese-GCC energy trade and China’s growing investments in industrial parks and ports across the GCC. However, the conflicts and disorder across the rest of West Asia have thus far hindered China’s ability to make significant BRI investments in the region.

As noted in a March 2022 analysis for Inside Arabia, China views the stability of its economic interests in the Persian Gulf as essential to the success of its plans, and sees its Sino-GCC ties as a model for stabilizing the wider West Asia under the BRI. To this end, China has supported GCC-led conflict resolution efforts in Yemen and has also put forward its Five Point Initiative in March 2021, calling for region-wide stabilization efforts and the establishment of an indigenous security architecture.

In this context, the Iran-Saudi normalization deal is great news for China. It affirms Beijing’s idea that its partnerships in the Persian Gulf can serve as a starting point for stabilization efforts for the whole of West Asia; after all, Tehran and Riyadh’s rivalry played out far more in places like Yemen, Lebanon, Syria, Iraq, and Palestine than it did in the Gulf itself.

The Beijing Agreement was not only a positive development for China’s BRI, but also for the Russian-led International North-South Transport Corridor (INSTC). Just as Moscow supports the BRI as a means of promoting multipolarity and decreasing US dominance, it has actively worked to advance the INSTC, which connects India by sea to Iran and then to northern Europe via Azerbaijan and Russia.

With the calming of tensions between Iran and Saudi Arabia, the INSTC stands to benefit from increased economic opportunities. Russia can explore possibilities such as increasing its own trade with the Persian Gulf via Iran through the INSTC and, further, with the rest of West Asia. Thus, the Iran-Saudi detente is good news for Russia’s own connectivity projects and regional integration efforts.

Bolstering the SCO

On 29 March, 2023, Saudi Arabia announced its intention to become a dialogue partner of the Shanghai Cooperation Organization (SCO), an institution founded by China to foster multilateral security and diplomatic coordination on regional issues in Eurasia.

The SCO already includes China, Russia, India, Pakistan, Kazakhstan, Kyrgyzstan, Uzbekistan, and Tajikistan, covering China’s immediate Eurasian neighborhood in Central and South Asia as well Russia.

With the ongoing accession of Iran as a full member of the SCO, Saudi Arabia’s entry as a dialogue partner would bring two of the most important states in terms of conflict resolution in West Asia into the organization’s ranks.

This is the kind of expansion of the SCO’s membership, scope, and relevance that is sought by China and also Russia. Moscow has long viewed the SCO as an ideal platform to present a unified Sino-Russian front against US interests, with an early example of this being the SCO’s July 2005 Astana Summit declaration demanding the withdrawal of US military presence from Central Asia.

Thus, an extension of the SCO’s mandate to West Asian issues offers Moscow the opportunity to push for Sino-Russian cooperation against the US in West Asia as well, continuing in the spirit of their Eurasian partnership as enshrined in the SCO.

Riyadh’s new horizons in Eurasia

Arguably, Saudi Arabia’s move toward the SCO is highly advantageous to both China and Russia. By proving its utility to the latters’ efforts for a bigger, more interconnected Eurasian community, the kingdom is also well-placed to pursue its own ends in Eurasia that pertain to Saudi national interests.

For instance, Saudi Arabia can double down on its plans for significant investments in Central Asia, a part of the Eurasian space that Russia closely monitors for any signs of activity by countries it sees as antagonistic to its Eurasian designs.

The Central Asian republics’ attempts to diversify their economies away from oil and gas present lucrative investment opportunities to Riyadh as it seeks its own diversification beyond energy under the ambit of MbS’ mega-project, Vision 2030.

Additionally, Saudi Arabia can leverage its elevated reputation with China and Russia to deter potential opposition from competitors to its moves in Eurasia. An example of this is Riyadh’s investments in the Turkmenistan-Afghanistan-Pakistan-India (TAPI) gas pipeline project, a rival to neighboring Iran’s own ambitions to penetrate the large South Asian gas market.

If Riyadh lacked a Eurasian understanding with Beijing and Moscow, Tehran – considered a vital Eurasian state – would be tempted to raise alarm over its dealings with Ashgabat, which also buys Saudi defense equipment.

The kingdom’s Eurasian pivot

The move toward a more diversified foreign policy has been a relatively smooth transition for Saudi Arabia. Despite its major military failure in Yemen and resulting security concerns, the kingdom has been successful in finding new partners.

By embracing the Eurasian paradigm promoted by China and Russia, Saudi Arabia is able to fill the gaps exposed in its foreign policy after the breakdown of its strategic rapport with Washington in the region.

This ultimately presents flexibility for the kingdom to pursue its own national interests, while also contributing to the larger goal of a more interconnected Eurasian community.

“For the day of the Lord is near upon all the nations. As you have done, it shall be done to you; your dealings will return upon your own head” Obadiah 1:15

“Behold, therefore I will gather all thy lovers with whom thou hast taken pleasure, and all them that thou hast loved, with all them that thou hast hated. I will even gather them round about against thee and will uncover thy nakedness unto them, that they may see all thy nakedness” Ezekiel 16:37

For I will be unto Ephraim as a lion, and as a young lion to the house of Judah; I, even I, will tear and go away; I will take away, and none shall rescue him. Hosea 5:14

For more about the South, a prophecy of Esau or Edom, see Obadiah

For more on the enemy from the South, see A Sword from the South!

For more into another Captivity: see Ezekiel Timeline – 190/40 Years

If Mexican Cartels are designated as Terrorists!

•April 6, 2023 • Leave a Comment

What would happen if the Mexican cartels are designated as a Foreign Terrorist Organizations by the US?

Mexico Daily Post ~ April 1, 2023

The powerful Mexican drug cartel responsible for the kidnapping of four US citizens — and the death of two of them — could be designated as a Foreign Terrorist Organization by the US.

Secretary of State Antony Blinken said in a hearing in March that the department is considering the designation for the Mexican drug cartels, which could include the Gulf Cartel, the cartel responsible for the attack.

The foreign terrorist (FTO) designation has been attracting interest as a tool to use against the cartel in recent years.

What would happen if Mexican Cartels are designated as Foreign Terrorist Organizations?

Why is it being considered?

The killing of the two American citizens crossed a “red line,” says Javed Ali, associate professor of practice at the Gerald R Ford School of Public Policy at the University of Michigan.

The Mexican drug cartels also traffic fentanyl, which is responsible for soaring opioid deaths in the US — over 70,000 Americans died of synthetic opioid overdoses in 2021, most of them caused by fentanyl that comes from Mexico.

Last year, the DEA seized enough fentanyl to kill every American, more than 50 million fentanyl-laced pills and over 10,000 pounds of fentanyl powder, the vast majority of it at the southern border.

Ali thinks now is the right time to designate the cartels as terrorist organizations, arguing that the US is not currently using “all the tools we have” to counter them.

What makes a group a Foreign Terrorist Organization?

In order to be labeled an FTO a group or network has to meet three criteria:

Must be foreign-based, Engages in terrorist activity, The terrorist activity threatens US citizens or US national security. How many Foreign Terrorist Organizations are there?

There are over 30 groups designated by the State Department, but none operate solely as drug cartels.

What would re-labeling a group as an FTO actually do?

An FTO designation unlocks the option for more foreign sanctions and a material support charge, which makes it much easier to indict someone on lesser charges if affiliated with the terrorist organization.

“It certainly stigmatizes them,” said Ali. “I would think the last thing a Mexican drug cartel wants is to be labeled by the United States as a terrorist organization. That’s bad for business.”

Does Congress have a role in categorizing a group as an FTO?

The secretary of state makes the designation, in coordination with the attorney general and treasury secretary. Then, it is sent to Congress for review and if it raises no issue with the designation, after seven days, it’s published in the Federal Register, making it official.

Rep. Chip Roy, Republican of Texas, has introduced legislation that asks Blinken to target several cartels for FTO designation: the Gulf Cartel, Cartel Del Noreste, Cartel de Sinaloa, and Cartel de Jalisco Nueva Generacion.

On February, 21 Republican attorneys general called on President Joe Biden and Blinken to declare Mexican drug cartels as FTOs.

How would the designation affect drug cartels?

It won’t stop the cartels, Ali says, but it would get their attention — and the attention of anyone working with them. Because of the material support charge available to the US after an FTO designation, the charges would be far more severe for even a low-level offense, such as giving money to the cartel. Donating to a foreign terrorist organization can result in a maximum sentence of up to 20 years in prison.

Officially labeling the Mexican drug cartels as terrorists emphasizes the national security threat they pose and confer authorizations the US hopes would have a chilling effect.

Downsides to FTO designation?

But there are potential disadvantages to making the designation. It could adversely affect US-Mexico relations.

“We have enormous authority already in dealing with drug trafficking organizations, in terms of all the policing capabilities we have to deal with them, particularly in the United States,” says Pamela Starr, an international relations professor at the University of Southern California.

“What it would do, however, is undermine bilateral cooperation with Mexico, and that would dramatically undermine our capacity to deal with the challenges in Mexico.”

And the FTO designation might also damage Mexico’s appeal as a tourist destination by contributing to the perception that it’s less safe.

Starr also warns the designation could radicalize drug cartels further. “My real concern is that if you treat organized crime as if it were a terrorist organization, they might begin to employ terrorist tactics,” Starr said.

In a worst-case scenario, the cartel could increase the targeting of US citizens, according to Ali.

But Ali argues the FTO designation for Mexican drug cartels is worthwhile. “This level of activity is absolutely having an impact on our national security, more from the flow of drugs in the US than the targeting of Americans in Mexico. But it still gives you another tool. Why not use it when the status quo doesn’t seem to be working?”

For more about the South, a prophecy of Esau or Edom, see Obadiah

For more on the enemy from the South, see A Sword from the South!

For more into another Captivity: see Ezekiel Timeline – 190/40 Years

Daniel (Ch 5-6)

•April 6, 2023 • Leave a Comment

In Daniel 12:4 “but thou, O Daniel, shut up the words, and seal the book that I may tell you that which shall befall you in the last days,” and so we are trying to understand this prophecy in the last days.

They drank wine, and praised the gods of gold and of silver, of brass, of iron, of wood, and of stone

Daniel 5

5: Belshazzar’s feast (5:1–6:1 – Babylonian era; Aramaic)

1 Belshazzar the king made a great feast for a thousand of his lords, and drank wine before the thousand. — Belshazzar, the king, the son of Nabonidus,

— apparently the grandson of Nebuchadnezzar, made a great feast to a thousand of his lords and drank wine before the thousand, the banquet becoming a drunken orgy. He was in command of the capital at that time and excelled in most of the vices for which ancient rulers were known.

2 Belshazzar, while he tasted the wine, commanded to bring the golden and silver vessels which his father Nebuchadnezzar had taken out of the temple which was in Jerusalem, that the king and his princes, his wives and his concubines might drink therein.

— Belshazzar, while he tasted his wine, sitting on a platform or dais, when he had just gotten under the influence of the wine’s intoxicating power, commanded to bring the golden and silver vessels which his father, or grandfather, Nebuchadnezzar had taken out of the Temple which was in Jerusalem, Cf Jeremiah 52:19; II Kings 25:14-17;

— that the king, his princes and governors, the foremost nobles of the realm, their wives and concubines, whose presence at the royal banquets is mentioned also by secular historians, might drink therein, using them to parade their drunken mockery.

3 Then they brought the golden vessels that were taken out of the temple of the house of God which was at Jerusalem; and the king and his princes, his wives, and his concubines drank from them.

— then they brought the golden vessels that were taken out of God’s Temple which was at Jerusalem; and the king and his princes, his wives and his concubines, drank in them. This act can in no wise be excused or condoned, not even as an act of religion, as a libation to the God of the Jews: it was a deed of reckless profanity.

4 They drank wine, and praised the gods of gold and of silver, of brass, of iron, of wood, and of stone. — they drank wine and, in their intoxication, praised the gods of gold, silver, brass, iron, wood and stone. It was thus essentially an exaltation of their idols above Yehovah of whom they thought that they had conquered in battle.

5 In the same hour came forth fingers of a man’s hand, and wrote opposite the candlestick upon the plaster of the wall of the king’s palace; and the king saw the part of the hand that wrote.

— in the same hour, suddenly, while they were still in the midst of their drunken revelry came forth fingers of a man’s hand and wrote, or were writing, over against the candlestick upon the plaster of the wall of the king’s palace, which had no paneling or tapestry;

— and the king saw the part of the hand, the extremity of the moving fingers, that wrote upon a spot of the wall which was particularly exposed to the light from the lamp above the king, he suddenly beheld the mysterious and terrifying phenomenon of the hand engaged in writing.

6 Then the king’s countenance was changed and his thoughts troubled him, so that the joints of his loins were loosed and his knees smote one against another.

— then the king’s countenance was changed, literally, then the king, his color was changed unto him and his thoughts troubled him as his guilty conscience filled him with terror so that the joints of his loins were loosed, they no longer possessed the strength to hold the body together firmly and his knees smote one against another.

7 The king cried aloud to bring in the astrologers, the Chaldeans, and the soothsayers. And the king spoke and said to the wise men of Babylon, “Whosoever shall read this writing and show me the interpretation thereof, shall be clothed with scarlet and have a chain of gold about his neck, and shall be the third ruler in the kingdom.”

— the king cried aloud, his terror causing him to raise his voice with might, to bring in the astrologers, the Chaldeans, and the soothsayers, that is, all the wisest men of the realm;

— and the king spoke and said to the wise men of Babylon, as many as followed his summons at once, Whosoever shall read this writing and show me the interpretation thereof, explaining its meaning and applying its significance;

— shall be clothed with scarlet with the costly purple garments worn by Oriental rulers and have a chain of gold about his neck, this golden necklace serving as the mark of special favor from the king, and shall be the third ruler in the kingdom, occupying the highest position in the realm, next to its emperor and regent;

— and be the third ruler in the kingdom; as it was considered the king the first, the king’s son as the second, and the interpreter of the vision to be the third.

8 Then came in all the king’s wise men; but they could not read the writing, nor make known to the king the interpretation thereof. — then came in all the wise men, one after the other appearing in agreement with his summons; but they could not read the writing nor make known to the king the interpretation thereof. In other words, they had to confess their complete failure.

9 Then was King Belshazzar greatly troubled, and his countenance was changed in him, and his lords were dismayed. — then, on account of the utter inability of the wise men to give him the desired information, was King Belshazzar greatly troubled,

— he was filled with deepest apprehension and trepidation and his countenance was changed in him and his lords were astonied, not only being filled with alarm but also with confusion which showed itself in excited movements.

10 Now the queen, by reason of the words of the king and his lords, came into the banquet house. And the queen spoke and said, “O king, live for ever! Let not thy thoughts trouble thee, nor let thy countenance be changed.

— now the queen, the queen mother, or dowager, very likely the wife of Nebuchadnezzar, by reason of the words of the king and his lords, the sound of which as they raised their voices in their excitement;

— came into the banquet house; and the queen spake and said, O king, live forever! the customary address in her mouth detracting in no way from the quiet dignity of her coming. Let not thy thoughts trouble thee, nor let thy countenance be changed by the terror inspired by the mysterious writing on the wall.

11 There is a man in thy kingdom in whom is the spirit of the holy gods. And in the days of thy father, light and understanding and wisdom, like the wisdom of the gods, was found in him whom King Nebuchadnezzar thy father — the king, I say, thy father — made master of the magicians, astrologers, Chaldeans, and soothsayers.

— there is a man in thy kingdom in whom is the spirit of the holy gods, the queen-mother thus repeating the very language of Nebuchadnezzar, Daniel 4:8; 9:18;

— and in the days of thy father, or grandfather, light and understanding and wisdom, like the wisdom of the gods was found in him; whom the King Nebuchadnezzar, thy father, the king, I say, thy father, the repetition serving to give her words greater emphasis, made master of the magicians, astrologers, Chaldeans and soothsayers, Daniel 4:9.

12 Inasmuch as an excellent spirit, and knowledge, and understanding, interpreting of dreams, and interpreting of hard sentences and dissolving of doubts were found in the same Daniel whom the king named Belteshazzar, now let Daniel be called and he will show the interpretation.”

— forasmuch as an excellent spirit, a most extraordinary talent, and knowledge and understanding, interpreting of dreams and showing of hard sentences, giving the explanation of riddles and conundrums, and dissolving of doubts, literally “untying knots” that is, finding the solutions of the most intricate problems;

— were found in the same Daniel, whom the king named Belteshazzar. Now, let Daniel be called, and he will show the interpretation; for Daniel was probably deprived of the office to which Nebuchadnezzar had promoted him; or Belshazzar might easily have been forgotton of his services.

13 Then was Daniel brought in before the king. And the king spoke and said unto Daniel, “Art thou that Daniel who art of the children of the captivity of Judah, whom the king my father brought out of Jewry?

— then was Daniel brought in before the king; and the king spoke unto Daniel, Art thou that Daniel which art of the children of the captivity of Judah, whom the king, my father, brought out of Jewry? The question was intended merely to fix the identity of Daniel beyond the slightest doubt and as such required no answer.

14 I have even heard of thee that the spirit of the gods is in thee, and that light and understanding and excellent wisdom are found in thee.

— I have even heard of thee that the spirit of the gods is in thee, the king omitting the adjective “holy” which the queen-mother had used, and that light and understanding and excellent wisdom is found in thee.

15 And now the wise men, the astrologers, have been brought in before me, that they should read this writing and make known unto me the interpretation thereof; but they could not show the interpretation of the thing.

— and now the wise men, the astrologers, the soothsayers only being mentioned as representing the entire class of wise men of the kingdom, have been brought in before me that they should read this writing and make known unto me the interpretation thereof; but they could not show the interpretation of the thing, they could not give the explanation of the words on the wall.

16 And I have heard of thee that thou canst make interpretations and dissolve doubts. Now if thou canst read the writing and make known to me the interpretation thereof, thou shalt be clothed with scarlet, and have a chain of gold about thy neck, and shalt be the third ruler in the kingdom.”

— and I have heard of thee that thou can make interpretations and dissolve doubts, untie the hardest knots; now, if thou can read the writing and make known to me the interpretation thereof, thou shalt be clothed with scarlet and have a chain of gold about thy neck and shalt be the third ruler in the kingdom;

— like Belshazzar, the unbelievers are often troubled by the terrors of an evil conscience and readily have recourse to almost any solution which offers in order to know their fate or to gain peace of mind.

17 Then Daniel answered and said before the king, “Let thy gifts be to thyself, and give thy rewards to another; yet I will read the writing unto the king, and make known to him the interpretation.

— then Daniel answered and said before the king, Let thy gifts be to thyself, and give thy rewards, the presents which he intended as a fee to Daniel, to another, the prophet of Yehovah rejecting everything which might afterwards be construed as having influenced him in his message;

— yet I will read the writing unto the king and make known to him the interpretation, as an act of loyalty to both the earthly ruler and the heavenly Sovereign; for he intended to speak without reservation, no matter whether the result would please or displease the king.

18 O thou king, the Most High God gave Nebuchadnezzar thy father a kingdom, and majesty and glory and honor.

— O thou king, the formal and solemn address bringing out the importance of the message from the outset and placing its entire import into direct relation to the king, the most high God gave Nebuchadnezzar, thy father, a kingdom, majesty, glory and honor, far above that enjoyed by Belshazzar.

19 And for the majesty that He gave him, all people, nations, and languages trembled and feared before him. Whomever he would he slew; and whomever he would he kept alive; and whomever he would he set up; and whomever he would he put down.

— and for the majesty that God gave him, the imperial authority and supremacy which he enjoyed, all people, nations and languages trembled and feared before him, were in a constant state of fear and trepidation lest they incur his displeasure;

— whom he would he slew and whom he would he kept alive, being the absolute master of life and death; and whom he would he set up and whom he would he put down for both the advancement and the demotion of the subjects of his realm were matters of his whim.

20 But when his heart was lifted up and his mind hardened in pride, he was deposed from his kingly throne, and they took his glory from him.

— but that is in spite of this unexampled position of power, when his heart was lifted up and his mind hardened in pride, so that he thought he could deal proudly with an utter disregard of the will of the Lord, he was deposed from his kingly throne and they took his glory from him as related earlier.

21 And he was driven from the sons of men; and his heart was made like the beasts, and his dwelling was with the wild asses. They fed him with grass like oxen, and his body was wet with the dew of heaven, till he knew that the Most High God ruled in the kingdom of men, and that He appointeth over it whomsoever He will.

— and he was driven from civilization, excluded from their society, and his heart was made like the beasts, and his dwelling was with the wild asses, this picturesque item being added for the sake of further embellishment of the narrative;

— they fed him with grass like oxen and his body was wet with the dew of heaven till he knew that the most high God ruled in the kingdom of men and that he appoints over it whomsoever he will, that is, until he gave all honor and glory to the true God alone; this lesson is now driven home.

22 And thou his son, O Belshazzar, hast not humbled thine heart though thou knewest all this,

23 but hast lifted up thyself against the Lord of heaven. And they have brought the vessels of His house before thee, and thou and thy lords, thy wives, and thy concubines have drunk wine from them; and thou hast praised the gods of silver and gold, of brass, iron, wood, and stone, which see not nor hear nor know. And the God in whose hand thy breath is, and whose are all thy ways, hast thou not glorified.

— but hast lifted up thyself against the Lord of heaven in blasphemous pride; and they have brought the vessels of his house of the Temple of the one true God before thee and thou and thy lords, thy wives and thy concubines have drunk wine in them; and thou hast praised the gods of silver and gold,

— of brass, iron, wood, and stone, which see not, nor hear nor know, Cf Deuteronomy 4:28; Psalms 115:5, Psalms 135:15 and the God in whose hand thy breath is, and whose are all thy ways, the one Creator and Ruler of the universe hast thou not glorified as was the solemn duty resting upon him.

24 “Then was the part of the hand sent from Him, and this writing was written. — then was the part of the hand, the outstretched fingers of the writing hand sent from Him and this writing was written to announce the doom which was now inevitable.

25 And this is the writing that was written: Mene, Mene, Tekel, Upharsin. — and this is the writing that was written, Mene, Mene, Tekel, Upharsin, literally, “numbered, numbered, weighed and divided.”

26 This is the interpretation of the thing. Mene: God hath numbered thy kingdom, and finished it.

— Mene, Mene: God hath numbered thy kingdom, and finished it; God had fixed the number of years, how long that monarchy should last and also the number of years that he should reign over; and both these numbers were now completed;

— for that very night Belshazzar was slain and the kingdom translated to another nation: and a dreadful thing it is to be numbered to the sword, famine and pestilence or any sore judgement of God for sin so more especially to be appointed to everlasting wrath and to be numbered.

27 Tekel: Thou art weighed in the balances, and art found wanting.

— Tekel: thou art weighed in the balances, namely, in those of God’s justice and judgement, his character analyzed according to the demands of God’s holiness, and art found wanting, below weight in moral worth and capacity.

28 Peres: Thy kingdom is divided, and given to the Medes and Persians.”

— Peres: thy kingdom is divided, severed, cut into two pieces, should be broken up and separated from him: and given to the Medes and Persians; to Cyrus the Persian who was a partner for a while with his uncle Darius in the reign of the empire: there is also an elegant play of words in “Peres” and “Persians.”

29 Then commanded Belshazzar, and they clothed Daniel with scarlet and put a chain of gold about his neck, and made a proclamation concerning him, that he should be the third ruler in the kingdom.

— then commanded Belshazzar, in accordance with his promise and they clothed Daniel with scarlet with royal purple and put a chain of gold about his neck and made a proclamation concerning him that he should be the third ruler in the kingdom, next in power to Nabonidus and Belshazzar.

30 In that night was Belshazzar the king of the Chaldeans slain. — that night was Belshazzar, king of the Chaldeans, slain; that when his city was taken by the victorious armies of the enemy, who took the city, who led Darius’ army up the river Euphrates into the city of Babylon, its course being turned;

— the inhabitants of which being revelling while the gates open, these men went up to the king’s palace, the doors of which being opened by the king’s orders to know what was the matter, they rushed in and finding him standing up with his sword drawn in his own defence, they fell upon him and slew him.

31 And Darius the Mede took the kingdom, being about threescore and two years old. — and Darius, the Median, took the kingdom, being about threescore and two years ol;

— there is evidence from secular sources that Darius the Mede whose other name was Gobryas was an uncle of Cyrus. It was known that Darius reigned not long, two years and not alone, but Cyrus with him and that Cyrus would reign thirty years, for he lived until he was seventy years of age, that is, he began to reign when he was forty;

— most authorities recognized that year, the fall of Babylon, as 539 BC; but in the Jewish calendar, the writing on the wall, as 3389 (or 372 BCE; a difference of 167 years); which is also the year Daniel was thrown into the lion’s den; which seems events were moving very fast!

— Daniel being thrown into the lion’s den, as spelt out in the next chapter, chapter 6, should be a year or two later! More likely, the fall of Babylon was earlier for the Jewish date, making the difference of 167 smaller; but Cyrus was prophecised to free the Jews, allowing them back to Jerusalem; which happened the next year in 371 BCE, which makes sense!

Daniel 6

6: Daniel in the lions’ den (6:2–29 – Median era with mention of Persia; Aramaic)

1 It pleased Darius to set over the kingdom a hundred and twenty princes, who should be over the whole kingdom;

— when Darius had fully taken over the kingdom of Persia, it pleased him to set an hundred and twenty princes, called satraps in secular history and divided the kingdom into twenty provinces and set governors over each, which should be over the whole land as governors of the smaller sections or provinces into which the empire was divided.

2 and over these, three presidents, of whom Daniel was first, that the princes might give account unto them and the king should have no damage.

— and over these three presidents, chief prefects, or ministers of whom Daniel, now an old man was first, not higher in rank but first in dignity, that the princes might give accounts unto them, the satraps thus being responsible to their superiors chiefly in financial matters and the king should have no damage, his interests being taken care of by virtue of this statesmanlike arrangement.

3 Then this Daniel was preferred above the presidents and princes, because an excellent spirit was in him; and the king thought to set him over the whole realm.

— then this Daniel was preferred above the presidents and princes, that is, he showed himself superior to them because an excellent spirit was in him (Daniel 5:12); and the king thought to set him over the whole realm. This intention the king very likely made known with the result that it stirred up the jealousy of the other presidents.

4 Then the presidents and princes sought to find occasion against Daniel concerning the kingdom, but they could find no occasion nor fault, inasmuch as he was faithful; neither was there any error or fault found in him.

— then the presidents and princes, actuated by an envy which caused them to disregard the best interests of the kingdom sought to find occasion against Daniel concerning the kingdom, that is, they tried to find some delinquency in the work of his official position;

— but they could find none occasion nor fault, no reason for impeachment, no ground for an accusation, forasmuch as he was faithful, neither was there any error or fault found in him, he was beyond reproach in his entire administration.

5 Then said these men, “We shall not find any occasion against this Daniel unless we find it against him concerning the law of his God.” — after conferring with one another concerning ways and means of removing the hated rival, then said these men, We shall not find any occasion against this Daniel;

— except we find it against him concerning the law of his God, regarding the practice of his religion. This is the course which is often followed by the enemies of the believers: if they cannot discredit in any matter pertaining to his duty, they try to show that the observance of his religious worship is dangerous to the state.

6 Then these presidents and princes assembled together before the king, and said thus unto him, “King Darius, live for ever!

7 All the presidents of the kingdom, the governors and the princes, the counselors and the captains, have consulted together to establish a royal statute and to make a firm decree, that whosoever shall ask a petition of any god or man for thirty days, except of thee, O king, he shall be cast into the den of lions.

— all the presidents of the kingdom, a statement which stretched the truth rather dangerously, the governors and the princes or satraps, the counselors and the captains, the lower officials; have consulted together to establish a royal statute and to make a firm decree,

— rather, “that the king ought to establish a statute and issue an interdict,” that whosoever shall ask a petition of any God or man for thirty days, within the next thirty days, save of thee, O king, he shall be cast into the den of lions. The request was cleverly worded to flatter the king, particularly since it seemed to be the desire of all the officials of the realm.

8 Now, O king, establish the decree and sign the writing, that it be not changed, according to the law of the Medes and Persians, which altereth not.”

— now O king, establish the decree and sign the writing, recording the proclamation by stamping it with his official seal, that it be not changed, according to the law of the Medes and Persians, which alter not, it could not be repealed in the Medo-Persian Empire.

9 Therefore King Darius signed the writing and the decree. — signed the writing and the decree, placing his royal seal upon the interdict and thus establishing it for his entire realm.

10 Now when Daniel knew that the writing was signed, he went into his house; and his windows being open in his chamber toward Jerusalem, he kneeled upon his knees three times a day, and prayed and gave thanks before his God, as he did formerly.

— now when Daniel knew that the decree was signed, when he found out that the edict was established by the affixing of the king’s seal, he went into his house, and his windows being open in his chamber in the upper story of his house, toward Jerusalem where he couldn’t be disturbed in his prayers;

— he kneeled upon his knees three times a day, according to ancient Jewish custom, Psalms 55:17, and prayed and gave thanks before his God as he did aforetime, the royal decree changing his custom of daily worship not one bit.

11 Then these men assembled, and found Daniel praying and making supplication before his God.

12 Then they came near, and spoke before the king concerning the king’s decree: “Hast thou not signed a decree, that every man that shall ask a petition of any god or man within thirty days, except of thee, O king, shall be cast into the den of lions?” The king answered and said, “The thing is true, according to the law of the Medes and Persians, which altereth not.”

— then they came, they arranged for an audience immediately and spoke before the king concerning the king’s decree, reminding him of it, insisting on calling it to his remembrance; hast thou not signed a decree that every man that shall ask a petition of any God or man within thirty days, save of thee, O king, shall be cast into the den of lions?

— the king answered without hesitancy and guile, for he was not aware of their hidden intention, and said, the thing is true, according to the law of the Medes and Persians, which alter not, thereby indicating the certain punishment of anyone who might transgress the royal edict.

13 Then answered they and said before the king, “That Daniel, who is of the children of the captivity of Judah, regardeth not thee, O king, nor the decree that thou hast signed, but maketh his petition three times a day.”

— then answered they and said before the king, full of joyful satisfaction over the fact that the king’s answer suited their design so well, That Daniel, to whom they refer with sneering contempt, which is of the children of the captivity of Judah, whom one might always reasonably suspect of an act of rebellion against the king’s authority;

— regard not thee, O king, nor the decree that thou hast signed, the intimation being that Daniel maliciously spurned the edict and thereby openly challenged the king’s authority, but make his petition three times a day.

14 Then the king, when he heard these words, was sorely displeased with himself, and set his heart on Daniel to deliver him; and he labored till the going down of the sun to deliver him.

— then the king, when he heard these words, was sore displeased with himself, literally “sorrow came on him” he was deeply grieved and troubled by this turn of events and set his heart on Daniel to deliver him for he prized Daniel’s ability and faithfulness very highly;

— and he labored till the going down of the sun to deliver him, he pondered over the matter and held the conspirators off in the hope that some way of escape might be found before morning.

15 Then these men assembled unto the king, and said unto the king, “Know, O king, that the law of the Medes and Persians is: that no decree nor statute which the king establisheth may be changed.”

— then these men assembled unto the king, pressing in a most importunate and tumultuous manner and said unto the king, Know, O king, that the law of the Medes and Persians is, That no decree nor statute which the king establishes may be changed. The success of their entire infamous plan, in fact, was based upon this tradition.

16 Then the king commanded, and they brought Daniel and cast him into the den of lions. Now the king spoke and said unto Daniel, “Thy God whom thou servest continually, He will deliver thee.”

— then the king, unable to find an excuse or to hold out against the conspirators, commanded and they brought Daniel and cast him into the den of lions, the execution following the sentence at once as custom required;

— now the king spake and said unto Daniel, since he was powerless to help him in this extremity, thy God, whom thou servest continually, he will deliver thee. This did not amount to a confession of the true God, but was merely a pious wish that the God of the Jews might prove equal to this emergency.

17 And a stone was brought and laid upon the mouth of the den, and the king sealed it with his own signet and with the signet of his lords, that the purpose might not be changed concerning Daniel.

— and a stone was brought, probably one used for similar executions and laid upon the mouth of the den over the opening through which the condemned were cast down; and the king sealed it with his own signet and with the signet of his lords of the highest officers in his realm;

— that the purpose might not be changed concerning Daniel, that is, that no one might interfere, either by attempting to liberate him or by working his evil will upon him. It is significant that Daniel made no effort to have his execution delayed or suspended but calmly placed the outcome in God’s hands.

18 Then the king went to his palace and passed the night fasting; neither were instruments of music brought before him, and his sleep went from him.

— then the king went to his palace and passed the night fasting, unable to sleep or eat for worry about the fate of Daniel; neither were instruments of music brought before him, rather “neither were concubines brought to him” and his sleep went from him, he was in genuine distress, decidedly ill at ease on account of the course into which he had been drawn.

19 Then the king arose very early in the morning and went in haste unto the den of lions.

20 And when he came to the den, he cried with a lamentable voice unto Daniel; and the king spoke and said to Daniel, “O Daniel, servant of the living God, is thy God, whom thou servest continually, able to deliver thee from the lions?”

— and when he came to the den, he cried with a lamentable voice which testified to the sorrow possessing his heart, unto Daniel; and the king spake and said to Daniel, O Daniel, servant of the living God, whom he was ready to acknowledge as such in accordance with Daniel’s confession is thy God whom thou servest continually, with constant unflagging devotion able to deliver thee from the lions?

21 Then said Daniel unto the king, “O king, live for ever!

22 My God hath sent His angel, and hath shut the lions’ mouths, that they have not hurt me, inasmuch as before Him innocency was found in me; and also before thee, O king, have I done no hurt.”

— my God hath sent his angel who may even have been visible to the eye of Daniel and hath shut the lions’ mouths that they have not hurt me, forasmuch as before him innocency was found in me, God had declared him not guilty by preserving him so wonderfully;

— and also before thee, O king, have I done no hurt, that is, by transgressing the edict of the king he had not become guilty of rebellion against the person of the king as the king’s personal interest in his case also demonstrated.

23 Then was the king exceeding glad for him, and commanded that they should take Daniel up out of the den. So Daniel was taken up out of the den, and no manner of hurt was found upon him, because he believed in his God.

— then was the king exceeding glad for him on account of the miraculous deliverance which Daniel had experienced and commanded that they should take Daniel up out of the den through an opening which made it convenient for him to be removed;

— so Daniel was taken up out of the den and no manner of hurt was found upon him, not so much as a scratch from the paw of one of the ravening beasts because he believed in his God and this firm confidence was rewarded by the Lord in this manner.

24 And the king commanded, and they brought those men who had accused Daniel, and they cast them into the den of lions — them, their children, and their wives; and the lions had the mastery of them, and broke all their bones in pieces before they came to the bottom of the den.

— and the king who now realized that the enemies of Daniel had used him as their instrument in trying to vent their jealous spite, commanded and they brought those men which had accused Daniel and they cast them into the den of lions, them, their children and their wives according to the custom of the country and since they were guilty of the same wickedness as the men;

— and the lions had the mastery of them, fell upon them and overwhelmed them and brake all their bones in pieces or ever they came at the bottom of the den; they were reduced to a pulp before their bodies reached the bottom of the pit.

25 Then King Darius wrote unto all people, nations, and languages that dwell in all the earth: “Peace be multiplied unto you.

— then King Darius, still under the influence of the miraculous deliverance which he had witnessed, wrote unto all people, nations and languages that dwell in all the earth, in issuing a solemn proclamation, Peace be multiplied unto you.

26 I make a decree that in every dominion of my kingdom men tremble and fear before the God of Daniel. For He is the living God and steadfast for ever, and His Kingdom, that which shall not be destroyed, and His dominion shall be even unto the end.

— I make a decree that in every dominion of my kingdom, as far as his kingly power extended, men tremble and fear, in reverent awe before the God of Daniel; for he is the living God and steadfast forever, eternal and unchanging, and his kingdom that which shall not be destroyed and his dominion shall be even unto the end, outlasting all earthly kingdoms.

27 He delivereth and rescueth, and He worketh signs and wonders in heaven and in earth, who hath delivered Daniel from the power of the lions.”

— he delivers and rescues, literally “He is a Deliverer and Rescuer” and he worketh signs and wonders in heaven and in earth such as are outside the laws of nature who hath delivered Daniel from the power of the lions who would ordinarily have torn him to pieces in the twinkling of an eye.

28 So this Daniel prospered in the reign of Darius and in the reign of Cyrus the Persian. — so this Daniel, the same one of whom the princes had spoken so contemptuously, prospered in the reign of Darius and in the reign of Cyrus, the Persian for the Persian monarchy followed shortly after the Median;

— the miracles which the Lord performs in the interest of his children are intended to serve, among other things, for the unbelievers so that they also may realize that the God of Israel is the true living God, the only Savior and Redeemer.

“All Thy Lovers” – Mexico

•April 5, 2023 • Leave a Comment

‘Mexico is not a US colony!’

The Unitd States is findng some of her allies are shifting away from from her bloc. South Africa, Nicaragua, Iraq, Saudi Arabia, and lately Nicaragua and Honduras, are all sfifting away from the so-called Western bloc.

Mexico is the latest adding to the list. Last March, a series of far-right US politicians from the Republican Party have called for the military to invade Mexico, in the name of supposedly fighting drug cartels.

Extreme-right Congressmember Marjorie Taylor Greene claimed in a March 15 tweet that Mexican cartels “are planting bombs on our land in our country.” (She posted a photo which did not show a bomb, according to US Border Patrol, but rather “a duct-taped ball filled with sand that wasn’t deemed a threat to agents/public.”)

“Our US military needs to take action against the Mexican Cartels,” she insisted. “End this Cartel led war against America!”

But Greene is far from alone.

Republican Congressmember Dan Crenshaw has introduced multiple bills to authorize the US military to attack cartels in Mexico.

Legislation that Crenshaw introduced in January cites the 2001 Authorization for Use of Military Force (AUMF), which was passed a week after the 9/11 attacks, in order to justify the US military to invade Mexico.

In an op-ed, Crenshaw compared Mexican drug cartels to ISIS, al-Qaeda, Osama bin Laden, and Saddam Hussein.

In the US Senate, another Trump ally, Lindsey Graham, wants the US military to intervene in Mexico.

“We are going to unleash the fury and might of the US against these cartels”, Graham proclaimed in a March 8 press conference.

Graham compared Mexican drug cartels to ISIS and al-Qaeda, referring to them as “narcoterrorists” and calling to “give the military the authority to go after these organizations wherever they exist.”

Trump’s former CIA director and secretary of state, Mike Pompeo, published an article declaring, “It Is Time for America To Declare War on the Drug Cartels.”

“As Secretary of State, I suggested we use drones to strike the cartels,” he boasted.

With blatantly neocolonial rhetoric, Pompeo claimed that Mexico has a “total lack of sovereignty.” (In his memoir, Pompeo admitted that the Trump administration tried to overthrow Venezuela’s government because it supposedly put “out the welcome mat for Russia, China, Iran, Cuba, and the cartels in a twenty-first-century violation of the Monroe Doctrine,” referencing the 200-year-old colonial doctrine.)

Mexico’s President López Obrador replied with critical comments also came at a time of growing tensions between the United States and Mexico:

“We remind those hypocritical and irresponsible politicians that Mexico is an independent and free country, not a colony or a protectorate of the United States!” he declared.

“They can threaten us with committing some kind of abuse, but we will never, ever allow them to violate our sovereignty and trample on the dignity of our homeland!” the Mexican president added.

American decline is the idea that the United States of America is diminishing in power geopolitically, militarily, financially, economically, and even technologically. There has been debate over the extent of the decline, and whether it is relative or absolute.

“All thy lovers have forgotten thee!”

Regardless, this decline has been prophecised millennium ago. Adding to such dilemna, the United States will find itself more and more isolated; some friends will get cold feet, others will turn into adversaries.

“All thy lovers have forgotten thee; they seek thee not; for I have wounded thee with the wound of an enemy, with the chastisement of a cruel one for the multitude of thine iniquity, because thy sins were increased” Jeremiah 30:14

Their allies will not just forget Israel, but will make a vicious turn from allies to enemies. A more detailed parallel verse is found in Ezekiel 16:37

“Behold, therefore I will gather all thy lovers with whom thou hast taken pleasure, and all them that thou hast loved, with all them that thou hast hated. I will even gather them round about against thee and will uncover thy nakedness unto them, that they may see all thy nakedness” Ezekiel 16:37

When situation gets tough, the tough gets going and American allies (Germany, Italy, Spain and Turkey; South Africa, Algeria, Egypt and Saudi Arabia; South Korea, the Philippines and Japan) will take their own interests first, team up with designated enemies of the United States (Venezuela, Cuba, Nicaragua, Iran, North Korea, Russia and China) and will turn against the United States.

And this is not these countries’ doings, but it is God’s will that will cause these allies to be against the United States, and it is again God’s will through His Spirits that will trap the bird in a snare “And I will spread My net upon him, and he shall be taken in My [not China’s nor Russia’s] snare,” Ezekiel 17:20; and he will be like a beast caught in a cage squealing away to no avail, then uncover her nakedness, American nakedness.

For more about the South, a prophecy of Esau or Edom, see Obadiah

For more on the enemy from the South, see A Sword from the South!

For more into another Captivity: see Ezekiel Timeline – 190/40 Years

Daniel (Ch 3-4)

•April 4, 2023 • Leave a Comment

In Daniel 12:4 “but thou, O Daniel, shut up the words, and seal the book that I may tell you that which shall befall you in the last days,” and so we are trying to understand this prophecy in the last days.

Daniel 3

3: The fiery furnace (3:1–30/3:1-23, 91-97 – Babylonian era; Aramaic)

1 Nebuchadnezzar the king made an image of gold, whose height was threescore cubits and the breadth thereof six cubits. He set it up in the plain of Dura, in the province of Babylon. — an image of gold; probably the image is in the form of a human being;

— it may be solid gold, or could be a plate of gold and hollow within; or of wood overlaid with gold; for otherwise it must have took up a prodigious quantity of gold to make an image of such impressive dimensions; this image could be for himself, or his father Nabopolassar, but most probably for his chief god Bel; which was the name given to Daniel, Belteshazzar, being derived from Bel;

— whose height was threescore cubits, and the breadth thereof six cubits; a common cubit being half a yard, it was thirty yards high, probably excluding a pedestal, and three yards broad;

— he set it up in the Plain of Dura, very likely in the level country east of the Tigris, or in a plain near the capital in the province of Babylon, that there might be room enough for a vast number of worshippers to assemble together.

2 Then Nebuchadnezzar the king sent to gather together the princes, the governors, and the captains, the judges, the treasurers, the counselors, the sheriffs, and all the rulers of the provinces to come to the dedication of the image which Nebuchadnezzar the king had set up.

— then Nebuchadnezzar, the king, sent to gather together the princes, the governors and the captains, executive officers of superior rank with both civil and military duties;

— the judges, or chief officers of administration, the treasurers, the financial directors or managers of the public treasury, the counselors, those learned in the law, the sheriffs, the enforcement officials;

— and all the rulers of the provinces to come to the dedication of the image which Nebuchadnezzar, the king had set up, to have a great celebration in honor of the occasion, all the officials of the empire being the king’s guests during the festival.

3 Then the princes, the governors, and captains, the judges, the treasurers, the counselors, the sheriffs and all the rulers of the provinces were gathered together unto the dedication of the image that Nebuchadnezzar the king had set up;

— then the princes, the governors and captains, the judges; were gathered together, proudly obedient to the king’s summons; and they stood before and attended to all the rites and ceremonies of the dedication of the image when the word of command was given.

4 Then a herald cried aloud: “To you it is commanded, O people, nations, and languages, — O people, nations and subjects; the several kingdoms, states and provinces that belonged to the Babylonian monarchy who spoke different languages,

— now represented by their governors and officers; as the Armenians, Parthians, Medes, Persians; Moab (Jeremiah 48); Ammonites, Edomites, Edom, Mount Seir (Jeremiah 49, Ezekiel 35); Tyre, Sidon and Egypt (Ezekiel 26-32).

5 that at the time ye hear the sound of the cornet, flute, harp, sackbut, psaltery, dulcimer, and all kinds of music, ye fall down and worship the golden image that Nebuchadnezzar the king hath set up.

— that at what time ye hear the sound of all kinds of music, to fall down and worship the golden image that Nebuchadnezzar the king hath set up;

6 And whoso falleth not down and worshipeth shall the same hour be cast into the midst of a burning fiery furnace.”

— whoso falleth not down shall in the same hour be cast into the midst of a burning fiery furnace; such as were used to burn stones in for lime; the music was to draw; the furnace was to drive; men to this idolatrous worship; the one was to please and sooth the minds of men and so allure them the other to frighten them into obedience.

7 Therefore at that time when all the people heard the sound of the cornet, flute, harp, sackbut, psaltery, and all kinds of music, all the people, the nations, and the languages fell down and worshiped the golden image that Nebuchadnezzar the king had set up.

— therefore at that time, in accordance with the announcement of the herald, when all the people heard the sound of the cornet, flute, harp, sackbut, psaltery, and all kinds of music, all the people, represented here by their respective rulers, the nations, and the languages, as many as had appeared for the great celebration;

— fell down and worshiped the golden image that Nebuchadnezzar the king had set up. It is to be noted here that, whereas most of the heathens tolerated the gods of the countries conquered by them, they at the same time required of the subdued people a greater veneration for their own gods, whose superiority they considered fully established by the fact of their being victors.

8 Therefore at that time certain Chaldeans came near and accused the Jews. — wherefore at that time certain Chaldeans came near; that is, to King Nebuchadnezzar, either in his palace at Babylon but more likely in the plain of Dura:

— and accused the Jews; particularly Shadrach, Meshach and Abednego of not obeying the king’s command to worship the golden image: these Chaldeans immediately hasten to the king to give this information against them. Should it be asked, how came these three men to be present? it may be answered, they came here in obedience to the king’s orders as his officers who had summoned them to this place;

— no mention is made of Daniel; very probably he was not there for what reasons cannot be said; however no accusation is laid against him; perhaps his loyalty had been proven and was too great to be meddled with, being high in the king’s favour; or he was in charge of the capital when King Nebuchadnezzar travelled outside the center of power, like vice presidents today.

9 They spoke and said to King Nebuchadnezzar, “O king, live for ever!

10 Thou, O king, hast made a decree that every man who shall hear the sound of the cornet, flute, harp, sackbut, psaltery, and dulcimer, and all kinds of music, shall fall down and worship the golden image;

11 and whoso falleth not down and worshipeth, that he should be cast into the midst of a burning fiery furnace. — and whoso fall not down and worship; the image; the above is the decree.

12 There are certain Jews whom thou hast set over the affairs of the province of Babylon: Shadrach, Meshach, and Abednego. These men, O king, have not regarded thee. They serve not thy gods, nor worship the golden image which thou hast set up.”

— Shadrach, Meshach and Abednego; by name; they say nothing of the common people of the Jews who either were not present, being employed in a servile manner or were below their notice; nor of Daniel who was above them and out of their reach;

— they serve not thy gods; whom the king and the nation worshipped, as Bel, Nebo, Merodach and others: nor worship the golden image, which thou hast set up; they did not bow down to the image in reverence as had been ordered; this they knew would he most provoking to the king.

13 Then Nebuchadnezzar in his rage and fury commanded to bring Shadrach, Meshach, and Abednego. Then they brought these men before the king.

— commanded to bring Shadrach, Meshach and Abednego; that is, immediately before him; who very probably were not afar off: he did not order them in his wrath and fury to be slain directly as he did the wise men and soothsayers in another case;

— but to be brought before him and examined first, that he might know the truth of these allegations against them; which shows, amidst all his rage, he still retained some respect and esteem for them.

14 Nebuchadnezzar spoke and said unto them, “Is it true, O Shadrach, Meshach, and Abednego, that ye do not serve my gods, nor worship the golden image which I have set up?

15 Now if ye be ready so that at the time ye hear the sound of the cornet, flute, harp, sackbut, psaltery, and dulcimer, and all kinds of music, ye fall down and worship the image which I have made, it is well; but if ye worship not, ye shall be cast the same hour into the midst of a burning fiery furnace. And who is that God that shall deliver you out of my hands?”

— and who is that God that shall deliver you out of my hands? he knew their confidence in the God of Israel which he attempts to break and remove; he foresaw the objection they would make, which he endeavours to anticipate by this proud and vain boast, forgetting what he himself had said, Daniel 2:47.

16 Shadrach, Meshach, and Abednego answered and said to the king, “O Nebuchadnezzar, we do not fear to answer thee in this matter. — Shadrach, Meshach and Abednego answered and said to the king, O Nebuchadnezzar, the directness of their address giving added emphasis to their statement;

— we are not careful to answer thee in this matter, that is, it is needless for us to give any reply; they did not consider it necessary to search for a reasonable excuse or explanation.

17 If it be so, our God whom we serve is able to deliver us from the burning fiery furnace, and He will deliver us out of thine hand, O king. — if it be so, our God, whom we serve is able to deliver us from the burning fiery furnace, rather, “If our God is able to deliver us,”

— and he will deliver us out of thine hand, O king; this was not casting doubt upon the strength and ability of the Lord to help them; it only left the matter under the disposition of the gracious and goodwill of him whose actions are always right and good.

18 But if not, be it known unto thee, O king, that we will not serve thy gods, nor worship the golden image which thou hast set up.” — be it known unto thee, O king, that we will not serve thy gods, be it as it will, whether we are delivered or not; we are not sure of the one but we are at a point as to the other;

— nor worship the golden image which thou hast set up; come life, come death, we are ready; we had rather die than sin: they were all of one mind and agreed in this matter; a noble instance of spiritual fortitude and courage!

19 Then was Nebuchadnezzar full of fury, and the form of his visage was changed against Shadrach, Meshach, and Abednego. Therefore he spoke, and commanded that they should heat the furnace seven times more than it was wont to be heated.

— then was Nebuchadnezzar full of fury, of extreme and unreasonable anger, and the form of his visage was changed against Shadrach, Meshach and Abednego, his expression showing the extremity of the fury which possessed him;

— therefore he spake and commanded that they should heat the furnace seven times more than it was usually heated. He did not realize in the heat of his passion that he was really defeating his own ends; for the hotter the fire, the sooner his victims were liable to be put out of misery;

— as noted in the next chapter, in God’s judgement, Nebuchadnezzar was to suffer humility seven times, seven years, eating grass like oxen like a wild beast!

20 And he commanded the most mighty men who were in his army to bind Shadrach, Meshach, and Abednego, and to cast them into the burning fiery furnace.

21 Then these men were bound in their coats, their breeches, and their hats, and their other garments, and were cast into the midst of the burning fiery furnace.

22 Therefore because the king’s commandment was urgent and the furnace exceedingly hot, the flame of the fire slew those men who took up Shadrach, Meshach, and Abednego.

— and because the king’s commandment was urgent; or was ordered to be obeyed in haste and with expedition and dispatch, hence the men were cast into the furnace with clothes on; or those that cast them were not so careful of themselves:

— and the furnace exceeding hot; being heated seven times more than usual; Nebuchadnezzar himself was to suffer humility seven times, seven years, eating grass like oxen;

— the flame of the fire slew those men that took up Shadrach, Meshach and Abednego; which came out of the furnace; so that when those men took up the three youths and brought them so near to it as was necessary to cast them in, the flame and smoke catched their breath and suffocated them;

23 And these three men, Shadrach, Meshach, and Abednego, fell down bound into the midst of the burning fiery furnace. — and these three men fell down bound into the midst of the burning fiery furnace. The fire not so much as destroying what they were bound with and much less them; but being bound they fell; when those that cast them in were destroyed.

24 Then Nebuchadnezzar the king was astonished, and rose up in haste and spoke, and said unto his counselors, “Did not we cast three men bound into the midst of the fire?” They answered and said unto the king, “True, O king.”

— then Nebuchadnezzar was greatly astounded, and rose up in haste, due to his great agitation, and spoke and said unto his counselors, the ministers or governors, who formed his council;

— did not we cast three men bound into the midst of the fire? The king’s chair seems to have been placed opposite the side door of the furnace which was open to permit a strong draught to fan the fire and it was from here that he witnessed the execution; they answered and said unto the king, True, O king.

25 He answered and said, “Lo, I see four men loose, walking in the midst of the fire, and they have no hurt; and the form of the fourth is like the Son of God (like the Bar Elohim (Ben Elohim, Hebrew)).

— he answered and said, Lo, I see four men loose, no longer bound as they had been cast into, walking in the midst of the fire, not leaving it, but waiting for God’s time to leave them out, and they have no hurt as one might have expected by reason of the rough treatment accorded them;

— and on account of the compelling dignity of his appearance, the form of the fourth is like the Son of God, rather “like a son of the gods” one pertaining to a divine family and generation. The fourth man was a form of a God, sent for the protection of His pious servants, so that the flame could not harm them.

26 Then Nebuchadnezzar came near to the mouth of the burning fiery furnace, and spoke and said, “Shadrach, Meshach, and Abednego, ye servants of the Most High God, come forth and come hither.” Then Shadrach, Meshach, and Abednego came forth from the midst of the fire.

27 And the princes, governors, and captains, and the king’s counselors, being gathered together, saw these men upon whose bodies the fire had no power, nor was a hair of their head singed, neither were their coats changed nor had the smell of fire passed onto them.

— and the princes, governors and captains, the representative rulers of his entire empire, and the king’s counselors, the members of his own privy council; being gathered together, saw these men, upon whose bodies the fire had no power, having had not the slightest effect upon them, nor was an hair of their head singed, this being ordinarily the first result of fire;

— neither were their coats changed, their undergarments touched by fire, nor the smell of fire had passed on them, in other words, one could not even notice that they had been anywhere near fire.

28 Then Nebuchadnezzar spoke and said, “Blessed be the God of Shadrach, Meshach, and Abednego, who hath sent His angel and delivered His servants who trusted in Him, and have changed the king’s word, and yielded their bodies, that they might not serve nor worship any god except their own God.

— then Nebuchadnezzar spoke and said, Blessed be the God of Shadrach, Meshach and Abednego, whose superiority to his own gods the king thus recognized, who hath sent his angel and delivered his servants, that trusted in him and have changed the king’s word, boldly transgressing his commands;

— and yielded their bodies, offering them without flinching in the interest of their loyalty to their God, that they might not serve nor worship any god except their own God.

29 Therefore I make a decree that every people, nation, and language which speak any thing amiss against the God of Shadrach, Meshach, and Abednego shall be cut in pieces and their houses shall be made a dunghill, because there is no other God who can deliver in this way.”

— therefore I make a decree, literally, “And from me is set forth a decree,” that every people, nation and language which speak anything amiss against the God of Shadrach, Meshach and Abednego shall be cut in pieces and their houses shall be made a dunghill, Cf. Daniel 2:5;

— because there is no other god that can deliver after this sort. While this confession does not imply faith in the one true God, it decreed toleration to the worshipers of Yehovah throughout the Babylonian empire.

30 Then the king promoted Shadrach, Meshach, and Abednego in the province of Babylon. — then the king promoted Shadrach, Meshach and Abednego in the province of Babylon;

— Nebuchadnezzar restored them to their places of trust and responsibility and increased their honours: or “made them to prosper” they flourished in court and became great and famous. The Septuagint version adds, “and he counted them worthy to preside as governors over all the Jews that were in his kingdom.”

Daniel 4

This chapter was written by Nebuchadnezzar himself, who under divine inspiration inserted it into this work of Daniel’s; and a very useful instruction it contains, showing the sovereignty of God over the greatest kings of the earth and this acknowledged by one of the proudest monarchs that ever lived. It begins with a preface, saluting all nations, and declaring the greatness and power of God.

Nebuchadnezzar Praises God: How great are His signs! And how mighty are His wonders!

4: Nebuchadnezzar’s madness (3:31/98–4:34/4:1-37 – Babylonian era; Aramaic)

1 “Nebuchadnezzar the king, unto all people, nations, and languages that dwell in all the earth: Peace be multiplied unto you. — God has described Nebuchadnezzar as “My servant” three times in the book of Jeremiah (25:9, 27:6, 43:10), so here he was given a privilege to address all nations and tongues;

— for he was now humbled under the mighty hand of God; whether his conversion was real is not evident; but he at least outwardly proposed a public proclamation to celebrate the praise of the Lord, on account of the wonderful deliverance of the three Jews from the fiery furnace;

— peace be multiplied unto you: a wish for all kind of outward happiness and prosperity; thus it becomes a prince to wish peace for all his subjects, and even for all the world; for there cannot be a greater blessing than peace nor a greater judgement than war.

2 I thought it good to show the signs and wonders that the High God hath wrought toward me. — Nebuchadnezzar thought it good, it pleased the king, he regarded it as the right and seemly thing,

— to show the signs and wonders that the high God hath brought toward me, the reference here being to the true God of whose omnipotent power Nebuchadnezzar had received unmistakable evidence as he relates in this edict.

3 How great are His signs! And how mighty are His wonders! His Kingdom is an everlasting kingdom, and His dominion is from generation to generation.

— how great are his signs and how mighty are his wonders! exceeding those of any so-called gods of the nations. His kingdom is an everlasting kingdom, and his dominion is from generation to generation. It is a doxology which gives due honor to the true God even though it does not confess faith in Yehovah.

Now follows the account of the happenings which caused this outburst of praise:

4 “I, Nebuchadnezzar, was at rest in mine house and flourishing in my palace. — Nebuchadnezzar was at rest in his house, his wars victoriously concluded, his kingdom at peace, and flourishing in his palace, enjoying wonderful prosperity.

5 I saw a dream which made me afraid, and the thoughts upon my bed and the visions of my head troubled me. — Nebuchadnezzar saw a dream which made him afraid,

— the suddenness of whose coming filled him with alarm and the thoughts upon his bed which exercised him in connection with his dream, and the visions of his head, those which were presented to the eyes of his mind, troubled him, their fancies and images filling him with apprehensive omen of approaching evil.

6 Therefore made I a decree to bring in all the wise men of Babylon before me, that they might make known unto me the interpretation of the dream.

— therefore Nebuchadnezzar made a decree; he issued the command to bring in all the wise men of Babylon before him that they might make known unto him the interpretation of another dream, the dream itself with all its details in this instance being very clear in the recollection of the king so that he desired an explanation only.

7 Then came in the magicians, the astrologers, the Chaldeans, and the soothsayers; and I told the dream before them, but they did not make known unto me the interpretation thereof.

— then came in the magicians, the astrologers and the soothsayers, Cf. Daniel 2:2, and Nebuchadnezzar told the dream before them; but they did not make known to him the interpretation, their merely human wisdom was unable to penetrate into the depths of the mysteries which God wanted to make known in this instance.

8 But at the last Daniel came in before me, whose name was Belteshazzar, according to the name of my god, and in whom is the spirit of the holy gods; and before him I told the dream, saying,

— but at the last Daniel came in before him, whose name, given that when he entered the king’s service was Belteshazzar, according to the name of his god, “the foremost of Bel,” the chief god of Babylon and in whom is the spirit of the holy gods, of whose eminent prophetic gifts the king had been given evidence on previous occasions, although he was in this case, for some unexplained reason, reserved to the last; and before him I told the dream, saying,

9 ‘O Belteshazzar, master of the magicians, because I know that the spirit of the holy gods is in thee and no secret troubleth thee, tell me the visions of my dream that I have seen and the interpretation thereof.

— O Belteshazzar, master of the magicians, whose position as the chief of all the wise men at Babylon made it possible for him to be absent from a large assembly of the officials of the royal court on this occasion because I know that the spirit of the holy gods is in thee and no secret troubleth thee, no secret being too difficult for him to explain, tell me the visions of my dream that I have seen and the interpretation thereof.

10 Thus were the visions of mine head in my bed: I saw, and behold, a tree in the midst of the earth, and the height thereof was great.

— thus were the visions of mine head in my bed, literally, “And regarding the visions of my head upon my bed,” Nebuchadnezzar saw and behold a tree in the midst of the earth, therefore evidently possessing great importance for the whole earth and the height thereof was great, it was of conspicuous size to begin with.

11 The tree grew and was strong, and the height thereof reached unto heaven, and the sight thereof to the end of all the earth. — the tree grew strongly, became great and mighty, and the height thereof reached unto heaven and the sight thereof to the end of the earth, so that it extended far enough to be seen from the very ends of the world;

12 The leaves thereof were fair, and the fruit thereof much, and in it was meat for all. The beasts of the field had shadow under it, and the fowls of the heaven dwelt in the boughs thereof, and all flesh was fed from it.

— the leaves thereof were fair, its branching, forming the crown was very beautiful, and the fruit thereof much, growing in large quantities and in it was meat for all, food for all who lived under its shelter being found on it;

— the beasts of the field had shadow under it, and the fowls of the heaven dwelt in the boughs thereof and all flesh was fed of it, the image being that of the entire human race united under the reign of Nebuchadnezzar and enjoying prosperity under his beneficent government.

13 “‘I saw in the visions of my head upon my bed, and behold, a watcher and a holy one came down from heaven. — Nebuchadnezzar saw in the visions of his head upon his bed, and, behold, a watcher and an holy one, that is, a holy watchman, an angel delegated by God to watch over the affairs of men came down from heaven.

14 He cried aloud and said thus: “Hew down the tree and cut off his branches, shake off his leaves and scatter his fruit; let the beasts get away from under it, and the fowls from his branches.

— he cried aloud and said thus, making announcement with a mighty voice, as the herald of almighty God, hew down the tree and cut off his branches, shake off his leaves, causing them to fall quickly;

— and scatter his fruit, in a contemptuous manner, as though possessing no value; let the beasts get away from under it, as no longer safe within his shelter, and the fowls from his branches, which no longer offered them a safe refuge;

15 Nevertheless leave the stump of his roots in the earth, even with a band of iron and brass, in the tender grass of the field; and let it be wet with the dew of heaven, and let his portion be with the beasts in the grass of the earth.

— nevertheless, leave the stump of his roots in the earth even with a band of iron and brass in the tender grass of the field, this description already indicating that the application must be made to an animate being, whose fetters were those of the mental and spiritual darkness brought on as the result of the loss of reason;

— and let it be wet with the dew of heaven, there being no shelter to keep the weather away from him, and let his portion be with the beasts in the grass of the earth so that he would partake of their food;

16 Let his heart be changed from man’s, and let a beast’s heart be given unto him; and let seven times pass over him. — let his heart be changed from man’s so that this center of intellectual life would lose its human aspect

— and let a beast’s heart be given unto him so that he would fully descend to the level of a beast; and let seven times pass over him; seven times, a time is a year, hence seven times is seven years, the exact length of these periods is henceforth being given.

17 This matter is by the decree of the watchers, and the demand by the word of the holy ones, with the intent that the living may know that the Most High ruleth in the kingdom of men, and giveth it to whomsoever He will, and setteth up over it the basest of men.”

— this matter is by the decree of the watchers, according to their judgement and the demand by the word of the holy ones, the angels of God having reminded Him, as it were, of the requirements of his holiness and justice upon so flagrant a transgressor;

— to the intent that the living, all human beings on earth, may know that the Most High rule in the kingdom of men, dispensing authority and power according to his will, and give it to whomsoever he will and set up over it the basest of men, a man from the humblest rank of life, if God so chose, assuming the reins of government according to his disposition.

18 This dream I, King Nebuchadnezzar, have seen. Now thou, O Belteshazzar, declare the interpretation thereof, inasmuch as all the wise men of my kingdom are not able to make known unto me the interpretation; but thou art able, for the spirit of the holy gods is in thee.’”

— this dream that Nebuchadnezzar have seen, all its details being clear before his eyes and set forth in the same manner. Now, thou, O Belteshazzar, declare the interpretation thereof, setting forth its meaning;

— forasmuch as all the wise men of my kingdom are not able to make known the interpretation; but thou art able for the spirit of the holy gods is in thee. The affairs of the whole world and of every nation on earth are in the hands of God, who directs them according to His good pleasure in the interest of His Kingdom.

19 Then Daniel, whose name was Belteshazzar, was stunned for one hour, and his thoughts troubled him. The king spoke and said, “Belteshazzar, let not the dream or the interpretation thereof trouble thee.” Belteshazzar answered and said, “My lord, the dream is for those who hate thee, and the interpretation thereof for thine enemies.

— then Daniel whose name was Belteshazzar was astonied, he stood aghast at the dream and its meaning for one hour, for a long period of time, and his thoughts troubled him, for he was overwhelmed with awe.

— the king, concluding from the appearance of his face that he had found the interpretation, spoke and said, Belteshazzar, let not the dream or the interpretation thereof trouble thee, fill him with apprehension for his safety if he revealed its meaning;

— Belteshazzar answered and said, speaking as a loyal subject of the king in whose empire he now lived, my lord, the dream be to them that hate thee and the interpretation thereof to thine enemies! that is, Would that the dream concerned the enemies of the king and that its meaning related to his foes rather than to him! After this introductory remark Daniel immediately plunged into his explanation:

20 The tree that thou sawest, which grew and was strong, whose height reached unto the heaven and the sight thereof to all the earth,

— the tree that thou saw, or “of which thou saw,” which grew and was strong, or “that it was great and strong” whose height reached unto the heaven and the sight thereof to all the earth, the power of the empire reaching to the uttermost boundaries of the known world,

21 whose leaves were fair and the fruit thereof much, and in it was meat for all, under which the beasts of the field dwelt and upon whose branches the fowls of the heaven had their habitation—

—whose leaves were fair and much fruit and in it was meat for all, under which the beasts of the field dwelt and upon whose branches the fowls of the heaven had their habitation, just as the king had described it in his account of his dream:

22 it is thou, O king, who art grown and become strong; for thy greatness is grown and reacheth unto heaven, and thy dominion to the end of the earth.

— it is thou, O king, that art grown and become strong; for thy greatness is grown and reacheth unto heaven, exceeding that of any living monarch and thy dominion to the end of the earth. Note that Daniel, while filled with sympathy for the king, speaks with uncompromising straightforwardness. The same calm and dispassionate condemnation of sin should be found for any of the Lord’s shepherds today.

23 And whereas the king saw a watcher and a holy one coming down from heaven and saying, ‘Hew the tree down and destroy it, yet leave the stump of the roots thereof in the earth, even with a band of iron and brass, in the tender grass of the field; and let it be wet with the dew of heaven, and let his portion be with the beasts of the field, till seven times pass over him’

— King Nebuchadnezzar was to have a beast’s heart for a period of seven times be passed over him, that is, seven years, a time is a year, hence seven times is seven years, the exact length of these periods King Nebuchadnezzar is to learn his lesson of humility and be humbled; to learn to give glory to God than to man;

— humility isn’t something that could be learned in a classroom or in a lecture, or in a place of safety which has been aptly called the “place of final training,” for humility couldn’t be taught there. The children of Israel took around 210 years as slaves in Egypt to learn humility; and in Ezekiel 4, the house of Israel will be given 190 years and the house of Judah 40 years; also to learn humility instead of uttering jingoism but be humbled;

— and let it be wet with the dew of heaven; their testimonies would nourish the nations, as the showers upon the grass, the truth about their abominations and captivity would give the nations much need truth in their judgement and a testimony for the Word of God, (more on the remnants from Ezekiel 12 at the end)

— “in Ezekiel 4, the house of Israel will be given 190 years and the house of Judah 40 years.” For more into another Captivity: see Ezekiel Timeline – 190/40 Years

24 this is the interpretation, O king, and this is the decree of the Most High, which has come upon my lord the king: — this is the interpretation, O king, and this is the decree of the Most High which is come upon my lord, the king, being fully decided in God’s counsel,

25 that they shall drive thee from men, and thy dwelling shall be with the beasts of the field, and they shall make thee to eat grass as oxen; and they shall wet thee with the dew of heaven, and seven times shall pass over thee till thou know that the Most High ruleth in the kingdom of men, and giveth it to whomsoever He will.

— that they, the subject being purposely indefinite, shall drive thee from men, casting him out from the society of human beings, and thy dwelling shall be with the beasts of the field, entirely on a level with unreasonable brutes;

— and they shall make thee to eat grass as oxen, and they shall wet thee with the dew of heaven; and seven times, a period of seven years, shall pass over thee, till thou know, recognizing and acknowledging openly and freely; the house of Judah also faced a period of seven years, but times ten; that is, 70 years, to be humbled in Babylon;

— that the Most High rules in the kingdom of men as the real Sovereign of the several nations of the earth and gives it to whomsoever he will. Nebuchadnezzar would in other words be seized with madness, which would exclude him from human society for seven years, the purpose of the Lord in thus punishing him being to bring him to a realization of his utter helplessness before the true Ruler of the universe.

26 And whereas they commanded to leave the stump of the tree roots, thy kingdom shall be sure unto thee after thou shalt have known that the heavens do rule.

— and whereas they commanded, namely, the council of watchers speaking in the name of God to leave the stump of the tree-roots: thy kingdom shall be sure unto thee; it would be preserved for him so that he could reassume his rule after the interval after that he shall have known that the heavens do rule, and after he would gladly make this confession, thereby yielding all honor and glory to God alone.

27 Therefore, O king, let my counsel be acceptable unto thee; and break off thy sins by righteousness and thine iniquities by showing mercy to the poor, that it may be a lengthening of thy tranquility.”

— wherefore, O king, let my counsel be acceptable unto thee, for Daniel honestly had the welfare of his sovereign in mind and break off thy sins by righteousness, repudiating all the transgressions for which monarchs were noted in favor of the exercise of true righteousness and justice;

— and thine iniquities by showing mercy to the poor, to those in any kind of tribulation, if it may be a lengthening of thy tranquillity, or “if thy present good fortune is to endure.” A complete change of heart was necessary on the part of the king together with a consistent practice of the highest virtues as a proof of his regeneration in order to avert the threatened punishment on the part of the Lord.

28 All this came upon King Nebuchadnezzar.

29 At the end of twelve months he walked in the palace of the kingdom of Babylon. — at the end of twelve months, so soon after he had received his warning, he walked in the palace of the kingdom of Babylon, perhaps upon its flat roof garden from which he could look over the entire city and get a fitting impression of its splendor.

30 The king spoke and said, “Is not this great Babylon that I have built for the house of the kingdom, by the might of my power and for the honor of my majesty?”

— the king said to himself, Is not this great Babylon that I have built for the house of the kingdom, to be the seat or capital of his entire empire, by the might of his power and for the honor of his majesty? It was a statement of inordinate pride, by which Nebuchadnezzar made himself the creator of the size and glory of his kingdom, thereby robbing God of the honor which fitly should be given to him alone.

31 While the word was in the king’s mouth, there fell a voice from heaven, saying, “O king Nebuchadnezzar, to thee it is spoken: The kingdom has departed from thee.

— while the word was in the king’s mouth, before he had finished his blasphemous utterance, there fell a voice from heaven, with great suddenness, which made the consequences stand out all the more by way of contrast;

— saying, O King Nebuchadnezzar, to thee it is spoken, the emphasis being upon the pronoun: Thy kingdom is departed from thee, that is, he was to be deprived of his position and office as ruler.

32 And they shall drive thee from men, and thy dwelling shall be with the beasts of the field; they shall make thee to eat grass as oxen. And seven times shall pass over thee, until thou know that the Most High ruleth in the kingdom of men, and giveth it to whomsoever He will.”

— and they shall drive thee from man, away from the society of human beings and thy dwelling shall be with the beasts of the field, with the irrational brutes; they, the subject again impersonal;

— shall make thee to eat grass as oxen and seven times shall pass over thee until he knows, being fully aware of, and accepting the fact that the Most High rules in the kingdom of men and gives it to whomsoever he will.

33 The same hour was the thing fulfilled upon Nebuchadnezzar; and he was driven from men, and ate grass as oxen, and his body was wet with the dew of heaven, till his hairs had grown like eagles’ feathers, and his nails like birds’ claws.

— the same hour was the thing fulfilled upon Nebuchadnezzar, so that there could be no doubt as to cause and effect; and he was driven from men and did eat grass and his body was wet with the dew of heaven, till his hairs were grown like eagles’ feathers and his nails like birds’ claws;

— this form of insanity is well known to medical science, a few cases having been found from time to time which exactly agree with the description of the symptoms here given, even to the eating of grass and the living outdoors without clothing; since people in this condition often believe themselves to be wolves, it is known as lycanthropy.

34 “And at the end of the days I, Nebuchadnezzar, lifted up mine eyes unto heaven, and mine understanding returned unto me. And I blessed the Most High, and I praised and honored Him that liveth for ever, whose dominion is an everlasting dominion, and His Kingdom is from generation to generation.

— and at the end of the days, after seven years appointed for this punishment, Nebuchadnezzar, lifted up his eyes unto heaven in the gesture of one seeking help from there alone and his understanding returned unto him so that he once again had the full use of his reason;

— and I blessed the Most High, thereby acknowledging him as the one true God; and Nebuchadnezzar praised and honored Him that liveth forever, whose dominion is an everlasting dominion and His kingdom is from generation to generation as the king had said in the introduction of this edict;

35 And all the inhabitants of the earth are reputed as nothing; and He doeth according to His will in the army of heaven, and among the inhabitants of the earth. And none can stay His hand or say unto Him, ‘What doest Thou?’

— and all the inhabitants of the earth are reputed as nothing, they are helpless in comparison with his almighty majesty, and he doeth according to his will in the army of heaven, so that the companies of even the highest angels bow to his will;

— and among the inhabitants of the earth; and none can stay his hand or say unto him, What doest Thou? God is the supreme, the absolute Sovereign of all created things.

36 At the same time my reason returned unto me; and for the glory of my kingdom, mine honor and brightness returned unto me. And my counselors and my lords sought unto me; and I was established in my kingdom, and excellent majesty was added unto me.

— at the same time, namely, when Nebuchadnezzar thus gave all honor and glory to God alone, his reason returned unto him; and for the glory of his kingdom, his honor and brightness returned unto him so that his former dignity and power were restored to him;

— and my counselors and my lords, who had repudiated and deserted him when madness seized upon him, sought unto him, so that he was officially requested to resume his position at the head of the empire; and he was established in his empire, and excellent majesty was added unto him, so that the authority of his position was even greater than before the strange madness seized upon him.

37 Now I, Nebuchadnezzar, praise and extol and honor the King of heaven, all of whose works are truth, and His ways judgement. And those that walk in pride He is able to abase.”

— now Nebuchadnezzar, in issuing this decree with its frank confession, praise and extol and honor the King of heaven, the heaping of synonyms showing the intensity of Nebuchadnezzar’s convictions;

— all whose works are truth, and his ways judgement, so that Nebuchadnezzar freely acknowledged his punishment to have been well deserved; and those that walk in pride, uttering jingoistic exultations in any form, exalting themselves at the expense of God’s honor, he is able to abase;

— Nebuchadnezzar finally recognized the humiliation which he had suffered as a just punishment of his pride, and it is safe to assume, however, that his experience was a step in the right direction and that this great heathen king finally died with some knowledge of the God of heaven; certainly better than most of the kings of either Israel or Judah.

~~~

Ref: Daniel 4:23 “and let it be wet with the dew of heaven” or in Micah 5: 7 “as a dew from the Lord,” and more on the Remnants from Ezekiel 12

16 But I will leave a few men of them from the sword, from the famine and from the pestilence, that they may declare all their abominations among the nations whither they come; and they shall know that I am the Lord.”

— “that they may declare all their abominations among the nations;” this explains why a few are left to survive; and they shall be as dew from the Lord;

— if they have hidden in some secret hideouts, they won’t be able to “declare all their abominations among the nations” who, observing their calamities, and distresses, could deserve and a need to know, and hear those who are well-versed to explain their sins, abominations and judgement to the nations. From God’s viewpoint, this gift is “as a dew from the Lord.”

France Buys LNG Using Yuan

•April 3, 2023 • Leave a Comment

France Buys 65,000 Tons Of LNG From China In First Ever Yuan-Denominated Trade

ZeroHedge by Tyler Durden ~ March 30, 2023

China has just completed its first trade of liquefied natural gas (LNG) settled in yuan, the Shanghai Petroleum and Natural Gas Exchange said on Tuesday. As OilPrice notes, the Chinese state oil and gas giant CNOOC and TotalEnergies completed the first LNG trade on the exchange with settlement in the Chinese currency, the exchange said in a statement carried by Reuters.

The trade involved around 65,000 tons of LNG imported from the United Arab Emirates (because China will never admit that it is re-exporting Russian LNG even though it now does it all the time) the Shanghai Petroleum and Natural Gas Exchange added.

The French supermajor, one of the world’s top LNG traders, confirmed to Reuters that the trade involved LNG imported from the UAE, but declined to comment further on the deal. 

China has been looking for years to establish more trade deals in yuan to increase the relevance of the petroyuan (or LNG-yuan as the case may be) on the global markets and challenge the US dollar’s dominance in international trade, including in energy trade. During a landmark visit to Riyadh in December, Chinese President Xi Jinping said that China and the Arab Gulf nations should use the Shanghai Petroleum and National Gas Exchange as a platform to carry out yuan settlement of oil and gas trades.

France Buys 65,000 Tons Of LNG From China In their First Ever Yuan-Trade

“China will continue to import large quantities of crude oil from GCC countries, expand imports of liquefied natural gas, strengthen cooperation in upstream oil and gas development, engineering services, storage, transportation and refining, and make full use of the Shanghai Petroleum and National Gas Exchange as a platform to carry out yuan settlement of oil and gas trade,” Xi said in December, as carried by Reuters

Still, Beijing has a ways to go before it dethrones the greenback as the global reserves: while the Chinese currency has made inroads in global trade, the yuan accounts for just 2.7% of the market, compared to the US dollar’s share of 41%. 

On the other hand, China’s currency has lots of momentum: over the past year, Russia has turned to trade in yuan in the wake of the Western sanctions on its exports, imports, and energy trade, as the Chinese currency has become Putin’s only alternative to reduce exposure to the US dollar and the euro.

“Shall a trumpet be blown in the city, and the people not be afraid? Shall there be evil in a city, and the LORD hath not done it?” Amos 3:6

“I create darkness; I create evil; I, the LORD, do all these things” Isaiah 45:7

Daniel (Ch 1-2)

•April 2, 2023 • Leave a Comment

The Prophecy of Daniel the Prophet; this Daniel was of the tribe of Judah that were carried captive into Babylon with Jehoiakim; and was of princely blood if not of the royal seed as appears from Daniel 1:3. Josephus says that he was of the kindred and family of Zedekiah and so fulfilled the prophecy in II Kings 20:18. And it was established from Daniel 7:1 that Daniel is the writer of this book.

And although Jewish authority acknowledges that this book was a Sacred Text, it isn’t a prophecy; that this book is among the holy writings but not among the Prophets. The reasons they give are without much foundation; what seems to have induced them to degrade Daniel is the manifest prophecy of the time of the Messiah’s coming in this book, which sometimes they are obliged to justify their own perception.

And according to Daniel 12:4 “but thou, O Daniel, shut up the words, and seal the book “that I may tell you that which shall befall you in the last days,” and so, we are trying to understand this prophecy in the last days.

The Book of Daniel is divided into two parts: a set of six court tales in chapters 1–6, written mostly in Aramaic, and four apocalyptic visions in chapters 7–12, written mostly in Hebrew (Book of Daniel Wikipedia)

Daniel, Hananiah, Mishael and Azariah: taken to Babylon as captives

Daniel 1

1: Introduction (1:1–21 – set in the Babylonian era, written in Hebrew)

1 In the third year of the reign of Jehoiakim king of Judah, came Nebuchadnezzar king of Babylon unto Jerusalem and besieged it. — in the third year of the reign of Jehoiakim, at the close of it, and at the beginning of the fourth, which was the first of Nebuchadnezzar, Jeremiah 25:1;

— Jerusalem seems to have been taken twice in his time, and two captivities in it: the first was in the third or fourth year of his reign; when humbling himself, Jehoiakim was restored to his kingdom, though he became a tributary to the king of Babylon;

— Daniel and his companions, who were carried captive with him were retained as hostages; but after three years Jehoiakim rebelled and it was not until his eleventh year that Nebuchadnezzar came against him again, took him and bound him in order to carry him to Babylon where he died there;

2 And the Lord gave Jehoiakim king of Judah into his hand, with part of the vessels of the house of God, which he carried into the land of Shinar to the house of his god; and he brought the vessels into the treasure house of his god.

— and the Lord delivered the vessels into his hands, and Jehoiakim this was from the Lord because of his sins and the sins of his ancestors and of his people or otherwise the king of Babylon could not have taken the city nor him;

— with part of the vessels of the house of God; not all of them; for some were hidden by Josiah and Jeremiah (like the Ark); however, now the vessels of gold, and probably silver, but certainly not all were carried away because we read of some of the vessels of the Temple being carried away at latter dates in Jeconiah’s time, II Kings 24:13, and still there were some left, as the pillars, sea, bases and other vessels which were carried away to Babylon in Zedekiah’s time, Jeremiah 27:19;

— these vessels that were taken out of the temple were carried to where Babylon stood, the land of Shinar and where the tower of Babel was built; to the house of his god, the temple of Bel or Jupiter Belus, one of the chief deities of Babylon, see Isaiah 46:1; besides these there were Merodach, Nebo; and with whom were the goddesses Juno and Rhea;

— in the times of Herodotus, who gives an account as this:

“the temple of Jupiter Belus had gates of brass; it was four hundred and forty yards on every side, and was foursquare. In the midst of the temple was a solid tower, two hundred and twenty yards in length and breadth; upon which another temple was placed, and so on to eight. The going up them was without, in a winding about each tower; as you went up, in the middle, there was a room, and seats to rest on. In the last tower was a large temple, in which was a large bed splendidly furnished, and a table of gold set by it.”

3 And the king spoke unto Ashpenaz, the master of his eunuchs, that he should bring certain of the children of Israel and of the king’s seed and of the princes,

— that he should bring certain of the children of Israel; whom he had taken and brought captive to Babylon and were disposed of in other part of the city or country; and out of these it was his will that some should be selected and brought to his court;

— and of the king’s seed, and of the princes: or “even of the king’s seed, and of the princes” not any of the children of Israel but such as were of royal blood or of the king of Judah’s family; or however that of princely birth, the children of persons of first rank; or of nobles.

4 youths in whom was no blemish, but well favored, and skillful in all wisdom, and cunning in knowledge, and understanding science, and such as had ability in them to stand in the king’s palace, and whom they might teach the learning and the tongue of the Chaldeans.

— young men of the middle adolescent period, between the ages of sixteen and twenty, in whom was no blemish, that is, no physical defect so that they would be faultlessly handsome;

— but well favored, this being considered essential among Oriental nations in the case of those destined for court service, and skilful in all wisdom, with the evident talent to acquire knowledge and ability rapidly and cunning in knowledge and understanding science, that is, with good sound judgement and common sense in applying the knowledge which they possessed and gained;

— and such as had ability in them to stand in the king’s palace to become accustomed to the ways and manners of a king’s court and whom they might teach the learning and the tongue of the Chaldeans, that of the learned classes of the Babylonian people; hence it was necessary they should learn the Chaldean language; their course of study would thus comprise all that was taught in the elite schools and their training would be that of the noblest youths of the empire.

5 And the king appointed them a daily provision of the king’s meat and of the wine which he drank, so nourishing them three years, that at the end thereof they might stand before the king.

— and the king appointed them, namely, for those who were to be selected, a daily provision of the king’s meat from the king’s table, of the richest delicacies he himself ate; of the food which was served on his own tables;

— and of the wine which he drank, literally, “of the wine of his drinking” or “banqueting” so nourishing them three years, this was the time fixed for their acquiring the learning and language of the Chaldeans; their education and their physical development going hand in hand and in which time it might be thought they would forget their own country, customs, religion and language;

— that at the end thereof they might stand before the king, that is, at the end of three years they might be presented to the king for his examination and approbation and be appointed to what service he should think fit; and particularly that they might be in his court and minister to him in what post it should be his pleasure to place them; now fully equipped for his service as courtiers and advisers or in whatever capacity the king might choose to use them.

6 Now among these of the children of Judah were: Daniel, Hananiah, Mishael, and Azariah, — among the youths selected in accordance with this royal order, were of the children of Judah, of the most prominent tribe of the Jewish people, Daniel, Hananiah, Mishael and Azariah;

7 unto whom the prince of the eunuchs gave names: for he gave unto Daniel the name of Belteshazzar; and to Hananiah, Shadrach; and to Mishael, Meshach; and to Azariah, Abednego.

— in changing their names, it was a mark of dominion and authority over them, gave them such as had an affinity with the names of the gods of the Chaldees; Belteshazzar, the name given to Daniel, being derived from Bel, or Baal, the chief idol of Babylon, and signifying the treasurer of Baal, or, the depositary of the secrets, or treasure of Baal;

— Shadrach, according to some, means the inspiration of the sun; being derived from shada, to pour out, and rach, a king, a name given to the sun by the Babylonians;

— Meshach, derived from a Babylonian deity called Shach, or from a goddess called Sheshach, is thought to signify “he who belongs to Shach,”

— or Sheshach, Abednego, that is the servant of the shining light; or of the sun; or the morning star, unless the word should be written Abednebo, referring to the idol so called. It is certain from Herodotus that the Chaldeans worshipped Jupiter Belus, Venus and other idols or the same under other names; and from these it is probable that the names were given according to Chaldee usage to these young men.

8 But Daniel purposed in his heart that he would not defile himself with the portion of the king’s meat, nor with the wine which he drank. Therefore he requested of the prince of the eunuchs that he might not defile himself.

— but Daniel purposed in his heart, made up his mind that he would not defile himself with the portion of the king’s meat nor with the wine which he drank, chiefly because the heathen had the custom of consecrating their food and in fact their entire meals by offering a portion to their gods, Cf 1 Corinthians 10:18-20;

— therefore he requested of the prince of the eunuchs that he might not defile himself; Daniel’s resolution to refrain from the king’s food thus was due to the fact that he had the proper spiritual understanding of the food Law, that he desired to be obedient to its spirit as well as to its letter.

— so instead of the king’s meat, composing meats, pork, lobsters, crabs, rice, millet and all luxuries, their food are all kinds of roots, fruits and vegetables; and instead of wine, water; it may be thought that persons of such birth and education had not been used to; and yet they preferred these to the king’s delicacies.

9 Now God had brought Daniel into favor and tender love with the prince of the eunuchs. — even before this request was made, as God had given to Joseph favour in the sight of Potiphar; for though Daniel’s ingenuity the goodness of his temper and his modest behaviour his excellence and other accomplishments might be a means of ingratiating him into the favour of this officer.

10 And the prince of the eunuchs said unto Daniel, “I fear my lord the king, who hath appointed your meat and your drink. For why should he see your faces sadder than the youths who are of your sort? Then shall ye make me endanger my head before the king.”

— and the prince of the eunuchs, to whom Daniel promptly presented his petition, said unto Daniel as he gave evidence of the favorable mental attitude which he had toward the Jewish youth;

— I fear my lord, the king, who hath appointed your meat and your drink by a definite command; for why should he see your faces worse liking of a meager and emaciated appearance in a worse condition than the children which are of your sort? The question has the meaning of a most emphatic denial: he must not see you in that condition;

— then shall ye make me endanger my head to the king, I shall commit a trespass of which I shall be found guilty and be condemned to die and lose my head for it; that is, the king held his life as a pledge for the faithful fulfillment of his commandment concerning the training of the Jewish youths.

11 Then said Daniel to Melzar, whom the prince of the eunuchs had set over Daniel, Hananiah, Mishael, and Azariah, — to Melzar, the prince of the eunuchs, having put off Daniel with the above answer seems to have left him; or however Daniel finding he could not obtain from him what he sought for applies to Melzar, a subordinate officer.

12 “Test thy servants, I beseech thee, ten days, and let them give us pulse (vegetables) to eat and water to drink. — and let them give us beans (Chabad Bible) to eat, and water to drink;

13 Then let our countenances be looked upon before thee, and the countenance of the youths who eat of the portion of the king’s meat. And as thou seest, deal with thy servants.”

— then let our countenances be looked upon before thee, in a careful examination of their physical condition, and the countenance of the children that eat of the portion of the king’s meat, making a comparison between these four and the youths who complied with the king’s order concerning their diet;

— and as thou seest, according to the result of the observations made after the period, deal with thy servants, the test determining the matter once for all.

14 So he consented to them in this matter, and tested them ten days. — ten, in the decimal system the number of completeness or conclusion, may, according to circumstances, mean a long time or only a proportionally short time.

15 And at the end of ten days their countenances appeared fairer and fatter in flesh than all the youths who ate the portion of the king’s meat;

— and at the end of ten days their countenances appeared fairer and fatter in flesh, they were of a better complexion and a more healthful look: clearer-eyed and in better condition in every way, than all the other youths which did eat the portion of the king’s meat.

16 Thus Melzar took away the portion of their meat and the wine that they should drink, and gave them pulse. — Daniel and his friends ate only beans and vegetables; and drink water instead of wine.

17 As for these four youths, God gave them knowledge and skill in all learning and wisdom; and Daniel had understanding in all visions and dreams.

— as for these four youths of God, who thus rewarded their faithfulness, gave them knowledge and skill in all learning and wisdom, so that they mastered the Chaldean literature and scientific knowledge;

— and Daniel, in addition to these accomplishments, had understanding in all visions and dreams, this being clearly a miraculous gift granted by God for a special purpose and not identical with the gift of prophecy.

18 Now at the end of the days that the king had said he should bring them in, then the prince of the eunuchs brought them in before Nebuchadnezzar.

— now, at the end of the days that the king had said he should bring them in, that is, at the end of the three-year period originally fixed, then the prince of the eunuchs brought them in before Nebuchadnezzar, so that all the Jewish youths were presented for inspection and examination.

19 And the king communed with them, and among them all was found none like Daniel, Hananiah, Mishael, and Azariah. Therefore stood they before the king.

20 And in all matters of wisdom and understanding that the king inquired of them, he found them ten times better than all the magicians and astrologers who were in all his realm.

— and in all matters of wisdom and understanding that the king enquired of them, namely, at the general examination, he found them ten times better than all the magicians and astrologers, the most learned men and those who practiced occult arts, that were in all his realm.

21 And Daniel continued even unto the first year of King Cyrus. — and Daniel continued in Babylon and at court there and in the favour of Nebuchadnezzar and his successors:

— even unto the first year of King Cyrus: by whom Babylon was taken, and when the seventy years’ captivity of the Jews were at an end; which time Daniel was there, for the sake of observing which this is mentioned: not that Daniel died in the first year of Cyrus but at least he lived through Cyrus’s first year.

Daniel 2

2: Nebuchadnezzar’s dream of four kingdoms (2:1–49 – Babylonian era; Aramaic)

1 And in the second year of the reign of Nebuchadnezzar, Nebuchadnezzar dreamed dreams, wherewith his spirit was troubled and his sleep departed from him.

— and in the second year of the reign of Nebuchadnezzar when he had advanced from the position of coregent to that of sole regent of the Babylonian Empire which must have been shortly after he had examined the Jewish youths brought before him;

— Nebuchadnezzar dreamed dreams; that is, the one dream consisted of several parts, a vision of the future in the form of symbols, wherewith his spirit was troubled, very strongly agitated and his sleep brake from him so that he was unable to regain the tranquility of mind necessary for quiet sleep.

2 Then the king commanded to call the magicians, and the astrologers, and the sorcerers, and the Chaldeans to show the king his dreams. So they came and stood before the king.

— then the king commanded to call the magicians, the men who were learned in the Chaldean language and literature; and the astrologers, those who were masters of incantation; and the sorcerers, the men who employed witchcraft;

— and the Chaldeans, the noblest and most exalted among the highest class of influential men in the kingdom, for to show the king his dreams to tell him the contents of his dream which he could not remember. So they came, in obedience to his summons and stood before the king.

3 And the king said unto them, “I have dreamed a dream, and my spirit was troubled to know the dream.” — and my spirit was troubled to know the dream; for he had only a vague impression of the importance of his dream, whence he was all the more anxious to have it presented to him in all its details, together with its explanation.

4 Then spoke the Chaldeans to the king in Syriac, “O king, live for ever! Tell thy servants the dream, and we will show the interpretation.” — then spake the Chaldeans, as the foremost representatives of the wise men of the realm, to the king in Syriac, in the East Aramaic dialect in which this section of the book is also written;

— O king, live forever! This was the usual form of salutation at the courts of the Chaldean and the Persian monarchs. Tell thy servants the dream and we will show the interpretation; it was necessary for them to know the contents of the dream before they would even venture an interpretation.

5 The king answered and said to the Chaldeans, “The thing is gone from me. If ye will not make known unto me the dream with the interpretation thereof, ye shall be cut in pieces, and your houses shall be made a dunghill.

— the king answered and said to the Chaldeans: the thing is gone from me, that is, the statement of what he required from them had gone forth from him, he had stated his purpose of having called them; if ye will not make known unto me the dream, giving its contents, with the interpretation thereof, both of which he now clearly demanded;

— ye shall be cut in pieces, such hewing to pieces being a punishment in vogue among the Chaldeans, and your houses shall be made a dunghill, that is, razed to the ground and covered with refuse and dung.

6 But if ye show the dream and the interpretation thereof, ye shall receive from me gifts and rewards and great honor. Therefore show me the dream and the interpretation thereof.”

— but if ye show the dream and the interpretation thereof, what it consisted in and what it meant, ye shall receive of me gifts and rewards and great honor, both in money and in advancement;

— therefore show me the dream and the interpretation thereof. The insistence of the king was that of a true despot, who demanded without a reason, simply because it suited his fancy.

7 They answered again and said, “Let the king tell his servants the dream, and we will show the interpretation of it.” — they answered again and said, in an effort to bring home to the king the unreasonableness of his request, Let the king tell his servants the dream and we will show the interpretation of it.

8 The king answered and said, “I know with certainty that ye would gain the time, because ye see the thing is gone from me. — the king answered and said, I know of certainty, most assuredly, that ye would gain the time,

— because ye see that the thing is gone from me, as he insisted upon a speedy answer to his demand. He declared that they were merely trying to put off the matter to postpone it indefinitely in the hope that he would sufficiently relent to tell them the contents of his dream.

9 But if ye will not make known unto me the dream, there is but one decree for you; for ye have prepared lying and corrupt words to speak before me, till the time is changed. Therefore tell me the dream, and I shall know that ye can show me the interpretation thereof.”

— but if ye will not make known unto me the dream, there is but one decree for you; one and the same sentence of condemnation would strike them all: for ye have prepared lying and corrupt words to speak before me, base misrepresentations, by which they kept him for a fool;

— till the time be changed; until by some lucky chance they might get into possession of the secret, or until the king would withdraw his demand. Therefore tell me the dream, which he would immediately recognize;

— and I shall know that ye can show me the interpretation thereof; it was clear to Nebuchadnezzar that the wise men were unable to reveal hidden things and therefore he concluded that the interpretation which they would offer in case they would find out the contents of the dream would, at best, be mere guesswork.

10 The Chaldeans answered before the king and said, “There is not a man upon the earth who can show the king’s matter. Therefore there is no king, lord, or ruler who asked such things of any magician, or astrologer, or Chaldean.

— the Chaldeans answered before the king, in an attempt to establish the impossibility for mere human beings to satisfy the king’s demand, and said, there is not a man upon the earth that can show the king’s matter, revealing this secret thing;

— therefore there is no king, lord nor ruler that asked such things at any magician or astrologer or Chaldean. The fact that no ruler on earth no matter how great and mighty he was had ever made such a demand, was to them a proof that the fulfillment of his command transcended the highest human wisdom.

11 And it is a rare thing that the king requireth, and there is no other who can show it before the king except the gods, whose dwelling is not with flesh.”

— and it is a rare thing that the king requireth the like of which was not known in history, and there is none other that can show it before the king except the gods whose dwelling is not with flesh.

12 For this cause the king was angry and very furious, and commanded to destroy all the wise men of Babylon. — for this cause the king was angry and very furious and commanded to destroy all the wise men of Babylon, both of this city and the province.

13 And the decree went forth that the wise men should be slain, and they sought Daniel and his fellows to be slain. — and the decree went forth that the wise men should be slain, the slaughter being apparently begun;

— and they sought Daniel and his fellows who had not been summoned with the older members of the Chaldeans but belonged to their class to be slain.

14 Then Daniel answered with counsel and wisdom to Arioch, the captain of the king’s guard, who had gone forth to slay the wise men of Babylon. — then Daniel answered with counsel and wisdom with sound and prudent advice to Arioch, the captain of the king’s guard, who was also in charge of the sentence of execution, which was gone forth to slay the wise men of Babylon.

15 He answered and said to Arioch the king’s captain, “Why is the decree from the king so hasty?” Then Arioch made the thing known to Daniel.

— and Daniel answered and said to Arioch, the king’s captain, Why is the decree so hasty from the king? Why the furious and sharp command, which came upon the people concerned like a bolt out of the blue sky? Then Arioch made the thing known to Daniel, giving him the information which he sought.

16 Then Daniel went in and desired of the king that he would give him time, and that he would show the king the interpretation. — then Daniel went in, naturally after being properly announced, and desired of the king that he would give him time, postponing the execution of the cruel decree for some days and that he would show the king the interpretation, thereby giving the king a definite promise.

17 Then Daniel went to his house, and made the thing known to Hananiah, Mishael, and Azariah, his companions,

— his companions; who either dwelt in the same house with him or not far off; whom he sent for and acquainted with all that had passed both between the king and the wise men and the consequence of that; and between him and the king and what promise he had made, relying on his God and theirs.

18 that they would desire mercies from the God of heaven concerning this secret, that Daniel and his fellows should not perish with the rest of the wise men of Babylon.

— that they would desire mercies of the God of heaven, the fulfillment of their united prayers being represented as a taking of gifts from before the throne of God, concerning this secret, that Daniel and his Jewish companions, should not perish with the rest of the wise men of Babylon, whose death, according to the king’s decree, seemed inevitable.

19 Then was the secret revealed unto Daniel in a night vision. Then Daniel blessed the God of heaven.

20 Daniel answered and said, “Blessed be the name of God for ever and ever, for wisdom and might are His. — Daniel answered and said, responding as it were, to the goodness of God with his hymn of praise, Blessed be the name of God forever and ever, this name including his entire essence and attributes; for wisdom and might are his, the two qualities coming into consideration here.

21 And He changeth the times and the seasons; He removeth kings and setteth up kings. He giveth wisdom unto the wise, and knowledge to them that know understanding.

— and he changes the times and the seasons as would appear in the carrying out of the king’s prophetic vision; he removes kings and set up kings, all the events in the history of nations being determined by him; he gives wisdom unto the wise and knowledge to them that know understanding, Daniel thus tracing his own accomplishments entirely to the gift of God.

22 He revealeth the deep and secret things; He knoweth what is in the darkness, and the light dwelleth with Him. — he reveals the deep and secret things, which are hidden before the eyes of such as are mere human beings;

— he knows what is in the darkness, what is covered before human eyes, and the light dwelleth with him, abiding with him as his possession, so that he is the Source of all light, physical and spiritual.

23 I thank Thee and praise Thee, O Thou God of my fathers, who hast given me wisdom and might, and hast made known unto me now what we desired of Thee; for Thou hast now made known unto us the king’s matter.”

— I thank thee and praise thee, O thou God of my fathers, of the patriarchs of the Jewish nation who hast given me wisdom and might and hast made known unto me now what we desired of thee, that for which they had so eagerly implored him; for thou hast now made known unto us the king’s matter, the very thing which the Chaldeans had declared to be an impossibility.

24 Therefore Daniel went in unto Arioch, whom the king had appointed to destroy the wise men of Babylon. He went and said thus unto him: “Destroy not the wise men of Babylon. Bring me in before the king, and I will show unto the king the interpretation.”

— therefore Daniel went in unto Arioch; Daniel was desirous to save the lives of the wise men of Babylon, who were unjustly condemned, as well as his own; and he goes immediately to Arioch and asked the reversing of the sentence against them; though there might be some among them, perhaps, who deserved to die as magicians by the law of God.

25 Then Arioch brought in Daniel before the king in haste and said thus unto him, “I have found a man of the captives of Judah, who will make known unto the king the interpretation.”

26 The king answered and said to Daniel, whose name was Belteshazzar, “Art thou able to make known unto me the dream which I have seen, and the interpretation thereof?”

27 Daniel answered in the presence of the king and said, “The secret which the king hath demanded, the wise men, the astrologers, the magicians, and the soothsayers cannot show unto the king.

28 But there is a God in heaven who revealeth secrets, and maketh known to King Nebuchadnezzar what shall be in the latter days. Thy dream and the visions of thy head upon thy bed are these:

— but there is a God in heaven that reveals secrets, possessing the attribute of omniscience; thy dream and the visions of thy head, those which he saw in his mind, upon thy bed are these:

29 As for thee, O king, thy thoughts came into thy mind upon thy bed, what should come to pass hereafter; and He that revealeth secrets maketh known to thee what shall come to pass.

— as for thee, O king, thy thoughts came into thy mind upon thy bed, he was engaged with these problems, what should come to pass hereafter; and he that reveals secrets, the one true God, whom the Jews worshiped, makes known to thee what shall come to pass.

30 But as for me, this secret is not revealed to me for any wisdom that I have more than anyone living, but for their sakes who shall make known the interpretation to the king, and that thou mightest know the thoughts of thy heart.

— but as for me, this secret is not revealed to me for any wisdom that I have more than any living, because he possessed such an extraordinary measure of wisdom by virtue of his own efforts or natural abilities, but for their sakes that shall make known the interpretation to the king and that thou might know the thoughts of thy heart.

31 “Thou, O king, sawest; and behold, a great image! This great image, whose brightness was excellent, stood before thee; and the form thereof was terrible.

— thou, O king, sawest, that is, he beheld before his eyes, he had his gave fixed upon the vision and behold a great image, a statute in human form. This great image, whose brightness was excellent stood before thee, over against him in full view; and the form thereof was terrible on account of its colossal proportions and its terrifying aspect.

32 This image’s head was of fine gold, his breast and his arms of silver, his belly and his thighs of brass, — this image’s head was of fine gold, or “as far as the image was concerned, its head was of pure gold,” his breast and his arms of silver, his belly and his thighs, or “his hips with the upper thighs,” of brass;

33 his legs of iron, his feet part of iron and part of clay. — his legs of iron, his feet part of iron and part of clay. “Only the first part, the head, constitutes a unity; the second, in the arms, shows evidence of division;

— the third has the same feature in the thighs: the fourth while proceeding from a common source, is entirely divided, although it also possesses ability of motion; the fifth is divided from the start and is finally subdivided still further in the ten toes. The material becomes less precious as we proceed, until it reaches common clay.”

34 Thou sawest until a stone was cut out without hands, which smote the image upon his feet that were of iron and clay, and broke them to pieces.

— thou sawest, that is, the king’s gaze was still directed toward this image, till that a stone was cut out, being torn loose from a mountain above, without hands, without human agency by a special act of God, which, in rolling down from the mountainside, smote the image upon his feet that were of iron and clay and brake them to pieces.

35 Then were the iron, the clay, the brass, the silver, and the gold broken to pieces together, and became like the chaff of the summer threshing floors; and the wind carried them away, that no place was found for them. And the stone that smote the image became a great mountain and filled the whole earth.

— then, as a result of this smashing blow, was the iron, the clay, the brass, the silver and the gold all the perishable materials of the image named in reverse order, broken to pieces together and became like the chaff of the summer threshing-floors, reduced to the finest dust to be carried away by the wind, totally demolished;

— and the wind carried them away that no place was found for them, that not a vestige remained; and the stone that smote the image became a great mountain and filled the whole earth, the image and all it represented sinking into insignificance beside it.

36 “This is the dream, and we will tell the interpretation thereof before the king.

37 Thou, O king, art a king of kings; for the God of heaven hath given thee a kingdom, power, and strength, and glory. — thou, O king, art a king of kings, a great sovereign, ruler of a world-power; for the God of heaven hath given thee a kingdom, or dominion, power and strength and glory, the attention of the king being here directed to the one Lord, the Dispenser of all good gifts.

38 And wheresoever the children of men dwell, the beasts of the field and the fowls of the heaven hath He given into thine hand, and hath made thee ruler over them all. Thou art this head of gold.

— and wheresoever the children of men dwell, even in the most remote parts of the habitable world, the beasts of the field and the fowls of the heaven hath he given into thine hand, in an absolute dominion such as man possessed at the beginning;

— and hath made thee ruler over them all, his power extended over practically the entire world then known, at least to all parts which might be termed civilized. Thou art this head of gold, this being all the more appropriate since Babylon possessed an immense wealth, also precious metals.

39 And after thee shall arise another kingdom inferior to thee, and another third kingdom of brass, which shall bear rule over all the earth.

— and after thee shall arise another kingdom inferior to thee, with a lower standard of political morals, lacking in internal strength, although still possessing a world sovereignty, and another third kingdom of brass, which shall bear rule over all the earth, by virtue of its unyielding hardness, though also inferior in quality.

40 And the fourth kingdom shall be strong as iron, inasmuch as iron breaketh in pieces and subdueth all things; and as iron that breaketh all these, shall it break in pieces and bruise.

— and the fourth kingdom shall be strong as iron, forasmuch as, or “just as” iron breaketh in pieces and subdue all things, crushing them and utterly destroying them; and as iron that breaketh all these shall it break in pieces and bruise, its destructive power being the point of comparison.

41 And whereas thou sawest the feet and toes, part of potter’s clay and part of iron, the kingdom shall be divided; but there shall be in it the strength of the iron, inasmuch as thou sawest the iron mixed with miry clay.

— and whereas thou sawest the feet and toes, part of potters’ clay and part of iron, total weakness and lack of power being implied in the terms, the kingdom shall be divided; but there shall be in it of the strength of the iron, this being retained in spite of the internal division, forasmuch as thou sawest the iron mixed with miry clay, in its sticky form, just as it came from the pits.

42 And as the toes of the feet were part of iron and part of clay, so the kingdom shall be partly strong and partly broken. — and as the toes of the feet were part of iron and part of clay, indicating the weakness of the feet supporting the great colossus, so the kingdom shall be partly strong and partly broken, that is, chiefly brittle and therefore always on the verge of disintegration.

43 And whereas thou sawest iron mixed with miry clay, they shall mingle themselves with the seed of men; but they shall not cleave one to another, even as iron is not mixed with clay.

— and whereas thou sawest iron mixed with miry clay, they, the rulers and the various ruling elements making up the fourth kingdom, shall mingle themselves with the seed of men, making an effort to establish harmony;

— but they shall not cleave one to another, in a firmly coherent mass, even as iron is not mixed with clay, namely, in a solid and permanent union. The meaning is clear; the world-power in its totality appears as a colossal human form: Babylon, the head of gold; Medo-Persia, the breast and the two arms of silver;

— the Greco-Macedonian Empire, as the belly and the two thighs of brass; and Rome with its various branches and dependent kingdoms, as the legs of iron and the feet of iron and clay. “Those kingdoms only are mentioned which stand in some relation to the Lord’s people.”

44 And in the days of these kings shall the God of heaven set up a Kingdom which shall never be destroyed; and the Kingdom shall not be left to other people, but it shall break in pieces and consume all these kingdoms, and it shall stand for ever.

— and in the days of these kings, while the various minor rulers were in power under the general sovereignty of Rome shall the God of heaven set up a kingdom which shall never be destroyed, its divine and eternal character being evident throughout; and the kingdom shall not be left to other people, its dominion taken over by a new power which might arise;

— but it shall break in pieces and consume all these kingdoms, bringing all world powers to an end, and it shall stand forever. The kingdom of the Messiah, of Christ is not of this world, and yet its power is such as to overcome all human might and authority and to establish instead the glorious reign of the Kingdom of God; for the Son of God is the King of kings and the Lord of lords.

45 Inasmuch as thou sawest that the stone was cut out of the mountain without hands, and that it broke in pieces the iron, the brass, the clay, the silver, and the gold, the great God hath made known to the king what shall come to pass hereafter. And the dream is certain and the interpretation thereof sure.”

— forasmuch as thou sawest that the stone was cut out of the mountain without hands, without human agency and influence and that it brake in pieces the iron, the brass, the clay, the silver, and the gold, all these materials being equally powerless to stand before its impetuous rush;

— the great God hath made known to the king what shall come to pass hereafter, the one and only true God having might not only to make such wonderful revelations, but also to bring his promises to pass. And the dream is certain and the interpretation thereof sure, a fact which Daniel’s emphatic statement properly brought to the foreground in conclusion.

46 Then King Nebuchadnezzar fell upon his face and worshiped Daniel, and commanded that they should offer an oblation and sweet incense unto him.

— then the King Nebuchadnezzar fell upon his face, overcome by the wisdom contained in this straightforward declaration and worshiped Daniel, giving him adoration as a prophet of the true God, worshiping the Lord in the person of Daniel, and commanded that they should offer an oblation and sweet odors unto him;

— then the king made Daniel a great man, exalting him to a position of great dignity and power, and gave him many great gifts, rewarding him after the manner of Oriental rulers; Observation: Daniel didn’t refused the king’s offer of gifts; nor stopped him from worshipping him;

47 The king answered unto Daniel and said, “In truth it is, that your God is a God of gods and a Lord of kings, and a revealer of secrets, seeing thou could reveal this secret.”

— the king answered unto Daniel and said, Of a truth it is that your God is a God of gods, in the eyes of Nebuchadnezzar the mightiest of all gods, and a King of kings, and a Revealer of secrets, seeing thou could reveal this secret, which was so obviously beyond mere human ability.

48 Then the king made Daniel a great man and gave him many great gifts, and made him ruler over the whole province of Babylon and chief of the governors over all the wise men of Babylon.

— and made him ruler over the whole province of Babylon, a civil appointment which gave him the administration in the most important province of the empire, and chief of the governors over all the wise men of Babylon, a position of influence as well as of honor.

49 Then Daniel requested of the king, and he set Shadrach, Meshach, and Abednego over the affairs of the province of Babylon; but Daniel sat in the gate of the king.

— then at Daniel’s request to the king, Nebuchadnezzar set Shadrach, Meshach and Abednego over the affairs of the province of Babylon, as those immediately in charge of the business of administration; but Daniel sat in the gate of the king, as his chief counselor over the various orders into which the wise men of the empire were divided.

Saudi Arabia joins China-led bloc

•April 1, 2023 • Leave a Comment

Saudi Arabia takes step to join China-led security bloc, the SCO, as ties with Beijing strengthen

“Behold, therefore I will gather all thy lovers with whom thou hast taken pleasure, and all them that thou hast loved, with all them that thou hast hated. I will even gather them round about against thee and will uncover thy nakedness unto them, that they may see all thy nakedness” Ezekiel 16:37

The symbol of the Shanghai Cooperation Organisation and the flags of its member states and observer states

CNBNC by Ruxandra Iordache ~ March 29, 2023

Saudi Arabia’s cabinet approved a decision to join a China-led security bloc, strengthening Riyadh’s eastern ties in a further step away from US interests.

The state-owned Saudi Press Agency said that, in a session presided by King Salman bin Abdulaziz, the Saudi cabinet on Tuesday approved a memorandum awarding Riyadh the status of dialogue partner in the Shanghai Cooperation Organization — a political, security and trade alliance that lists China, Russia, India, Pakistan and four other central Asian nations as full members.

The organization further tallies four observer states — including Iran — and nine dialogue partners, counting in Saudi Arabia, Qatar and Turkey. It is headquartered is in Beijing and served by China’s Zhang Ming as secretary-general.

Saudi Arabia’s decision to join the SCO, while falling short of full membership, takes Riyadh’s interests further east, at a time when Beijing is testing out its sway in the Middle East in a potential hit to US influence.

Headquarters Beijing, China; Membership: China India Kazakhstan Kyrgyzstan Pakistan Russia Tajikistan Uzbekistan Observers Afghanistan Belarus Iran Mongolia Dialogue partners: Armenia Azerbaijan Cambodia Egypt Nepal Qatar Saudi Arabia Sri Lanka Turkey

In early March, China brokered a deal for long-time Mideast rivals Saudi Arabia and Iran to resume diplomatic relations and reopen embassies in each other’s countries.

Deeper in Europe, Beijing just as ambitiously, if so far less successfully, submitted a 12-point plan to achieve peace between Russia and Ukraine.

The White House did not immediately respond to a CNBC request to comment on Saudi Arabia’s new dialogue partner status in the SCO.

Saudi interests have long been intertwined with those of leading SCO members China and Russia. Beijing is Riyadh’s largest trading partner, with bilateral trade worth $87.3 billion in 2021, according to Reuters.

China is a major consumer of hydrocarbon-reliant Saudi Arabia’s oil exports, with the two countries making significant inroads in each other’s petrochemical sectors — including the recent announcement by Saudi state-controlled oil giant Aramco of a joint venture that will build a refinery and petrochemical complex in Panjin in northeast China, alongside partners Norinco and the Panjin Xincheng Industrial Group.

Separately, Riyadh is a close ally of Russia in the crude oil production policies of the OPEC+ coalition.

“For the day of the Lord is near upon all the nations. As you have done, it shall be done to you; your dealings will return upon your own head” Obadiah 1:15

“Behold, therefore I will gather all thy lovers with whom thou hast taken pleasure, and all them that thou hast loved, with all them that thou hast hated. I will even gather them round about against thee and will uncover thy nakedness unto them, that they may see all thy nakedness” Ezekiel 16:37

For I will be unto Ephraim as a lion, and as a young lion to the house of Judah; I, even I, will tear and go away; I will take away, and none shall rescue him. Hosea 5:14

Micah (Ch 5-7)

•March 31, 2023 • Leave a Comment

The Prophecy of Micah, the word of the Lord that came to Micah during the reigns of kings: Jehoram, Ahaziah, Joash, Amaziah and Uzziah. He is thought to have prophesied thirty or forty years, which places him in the years 713 to 750 BC; thus contemporary with Isaiah, Hosea and Amos but had started earlier.

Micah 5

1 Now gather thyself in troops, O daughter of troops; he hath laid siege against us; they shall smite the judge of Israel with a rod upon the cheek. — it seems this verse ought to be joined to the foregoing chapter, as it evidently belongs to it, and not to this, which is upon a quite different subject

— the “daughter of troops” is still the same who was before addressed, Judah; the word is almost always used of “bands of men employed in irregular, marauding, in-roads.” Judah is entitled “daughter of troops,” on account of her violence, the robbery and bloodshed within her.

2 “But thou, Bethlehem Ephrathah, though thou be little among the thousands of Judah, yet out of thee shall come forth unto Me He that is to be ruler in Israel, whose goings forth have been from of old, from everlasting.”

— but thou, Bethlehem; but though Jerusalem should be besieged and taken and the land of Judea laid waste, yet before all this should be the Messiah should be born in Bethlehem of which this is a prophecy as is evident from Matthew 2:4;

— though thou be little among the thousands of Judah, the town being of little importance over against the mighty Jerusalem nearby, yet out of thee shall he come forth unto me that is to be Ruler in Israel, out of thee shall come forth unto me a Judge, that is to be ruler in Israel, and this is the King; for because he is to be of the seed of David, that is, the selection of the Messiah as the true King of Israel;

— whose goings forth have been from of old, from everlasting; thus the Father’s will and purpose from eternity was made manifest in the coming of the Prince of Peace. And even as his outgoings were from eternity, since he is the Son of the Father.

— but you, Bethlehem, David’s county where the Lamb would be born wouldn’t be given up; from you will come the leader who will be the Messiah-rule Israel. He’ll be no upstart, no pretender, his family tree is ancient and distinguished;

3 Therefore will He give them up, until the time that she who travaileth hath brought forth; then the remnant of His brethren shall return unto the children of Israel.

— meanwhile, Bethlehem will be in foster homes until the birth pangs are over and the child is born then the scattered brothers come back home to the land of Jacob. He will stand tall in his Messiah-rule with God’s strength, centered in the Kingdom of God. And the people will have a good and safe home, his Greatness shall reach the ends of the earth; the Peacemaker of the world!

4 And He shall stand and feed them in the strength of the Lord, in the majesty of the name of the Lord His God. And they shall abide; for now shall He be great unto the ends of the earth.

— and he shall stand and feed, both ruling and nourishing as the King and Shepherd of his people, in the strength of the Lord, he himself being the mighty God, Isaiah 9:6;

— in the majesty of the name of the Lord, Yehovah, which was communicated to him even in his state of humiliation; and they shall abide, namely, the true spiritual children of Israel; for now shall he be great unto the ends of the earth, his kingdom, the Kingdom of God, extending over the entire earth.

5 And this Man shall be the peace when the Assyrian shall come into our land; and when he shall tread in our palaces, then shall we raise against him seven shepherds and eight princes of men.

— the Assyrian may be here put for any powerful enemy of the people of God in later times; then shall we raise against him seven shepherds and eight princes of men; we, the Israel of God shall be enabled to repel the enemy.

— “Shepherds,” that is, princes, “seven” is the perfect number, representing completeness and rest; and eight principal men; or princes among men, appointed by the Ruler as his subordinates and representatives. These are said to be “eight” to imply a great number.

6 And they shall waste the land of Assyria with the sword, and the land of Nimrod at the entrances thereof; thus shall He deliver us from the Assyrian when he cometh into our land, and when he treadeth within our borders. — and they; the seven shepherds and eight principal men; or the rulers and princes of men, mentioned in the preceding verse;

7 And the remnant of Jacob shall be in the midst of many nations, as a dew from the Lord, as the showers upon the grass that tarrieth not for man, nor waiteth for the sons of men.

— in the Messianic Age, the remnant of Jacob, those that survived the fire, famine, pestilences and the sword, shall be in the midst of many people as captives, “in the midst of the abundance of the nations,”

— they shall be as a dew from the Lord, their testimonies would nourish the nations, as the showers upon the grass, the truth about their abominations and captivity would give the nations much need truth in their judgement and a testimony for the Word of God, (more on the remnants from Ezekiel 12 at the end)

8 And the remnant of Jacob shall be among the Gentiles, in the midst of many people, as a lion among the beasts of the forest, as a young lion among the flocks of sheep, who, if he go through, both treadeth down and teareth in pieces, and none can deliver.

— and the remnant of Jacob shall be among the nations in the midst of many people; the same persons are meant here as before; who are compared to dew and showers of rain; because numerous and full of blessings in themselves and useful and beneficial to others;

— as a lion among the beasts of the forest; strong, mighty, powerful, courageous and superior to their enemies as the lion is strongest among beasts and keeps all others in awe of him;

— as a young lion among the flocks of sheep; in the great Millennium or the Messianic Age, their enemies shall be no more able to oppose them than a flock of sheep are to a young lion to resist him; the design of the metaphor is not to signify the harmlessness and innocence of their enemies but their weakness and the strength and courage of them.

9 Thine hand shall be lifted up upon thine adversaries, and all thine enemies shall be cut off. — in the great Millennium or the Messianic Age thine hand shall be lifted up upon thine adversaries; O remnant of Jacob or Israel, as the Targum says; the remnant of Jacob, and destroy their enemies with the sword that proceeds out of his mouth.

10 “And it shall come to pass in that day,” saith the Lord, “that I will cut off thy horses out of the midst of thee, and I will destroy thy chariots.

— and it shall come to pass in that day, saith the Lord, at the time of Messiah’s reign that he will cut off thy horses out of the midst of thee, ordinarily, the confidence of men, and he will destroy thy chariots.

11 And I will cut off the cities of thy land, and throw down all thy strongholds. — the Targum says, “I will cut off the cities of the people out of thy land and destroy all their strong fortresses” these shall dwell no more there and be no more offensive and troublesome.

12 And I will cut off witchcrafts out of thine hand, and thou shalt have no more soothsayers. — and God will cut off witchcrafts out of thine hand;

— in the Messianic Age, all unlawful arts, cheating and juggling in religious matters will cease and be no more; every religious building of any kind (churches, cathedrals, temples, shrines, monuments, mosques) will all be totally demolished, so that no vestige of any false religion remains.

13 Thy graven images also will I cut off, and thy standing images out of the midst of thee; and thou shalt no more worship the work of thine hands. — thy graven images; which were for the matter of them made of wood or stone, and fashioned to the images, which the blind idolaters thought well to represent their god.

14 And I will pluck up thine Asherah poles out of the midst of thee: so will I destroy thy cities. — I will pluck up thy groves; that is, either the statues, pillars, or trees connected with the worship of Baal and Astarte.

15 And I will execute vengeance in anger and fury upon the nations, such as they have not heard.” — such as they have not heard; such terrible judgements, and dreadful expressions of divine wrath and fury,

— by earthquakes, hailstones, as were never known or heard before of in the world before see Revelation 16:18; or “which have not heard” the people that have not heard and hearkened to the word of God or the voice of the Messiah, but have turned a deaf ear to it, and despised it. So the Targum says, “who have not received the doctrine of the law.”

~~~

Ref: Micah 5: 7 “as a dew from the Lord,” more on the Remnants from Ezekiel 12

16 But I will leave a few men of them from the sword, from the famine and from the pestilence, that they may declare all their abominations among the nations whither they come; and they shall know that I am the Lord.” — “that they may declare all their abominations among the nations;” this explains why a few are left to survive;

— if they have hidden in some secret hideouts, they won’t be able to “declare all their abominations among the nations” whither they come; who, observing their calamities, and distresses, could deserve and a need to know, and hear those who are well-versed to explain their sins, abominations and judgement to the nations. From God’s viewpoint, this gift is “as a dew from the Lord.”

Micah 6

1 Hear ye now what the Lord saith: “Arise, contend thou before the mountains, and let the hills hear thy voice. — hear ye now what the Lord saith; the third portion of Micah’s prophecy opens with a solemn appeal to Nature to hear the Lord pleading before the mountains and the hills to hear his voice;

— hear ye now what the Lord saith; here begins a new discourse and with an address of the prophet to contend before the mountains; a parallel Scripture in Ezekiel 6 against the mountains and hills of Israel.

2 Hear ye, O mountains, the Lord’S controversy, and ye strong foundations of the earth; for the Lord hath a controversy with His people, and He will plead with Israel. — a detailed parallel Scripture in Ezekiel 6 on the mountains and hills of Israel;

— the “mountains of Israel” refer to the United States, UK and France – “and to the hills, to the rivers and to the valleys;” the hills: Ireland, Switzerland and the Scandinavian countries: Denmark, Norway and Sweden, Finland and Iceland; and the valleys, the low countries: Belgium, the Netherlands and Luxembourg;

— and to the rivers; where during the nineteenth century, the British Royal Navy were known to “Rule the Waves;” their colonies, their new territories; and the United States having been plowing up and down the five oceans with her Seven Fleets since the British left the scene.

3 O My people, what have I done unto thee? And wherein have I wearied thee? Testify against Me! — then addressing his people, what have I done unto thee?

— namely, in inflicting any kind of wrong unto them. And wherein have I wearied thee? is my requirements too rigorous or too hard to follow? Testify against me! God challenges his people, ready to entertain any reply which they might want to make concerning any charges.

4 For I brought thee up out of the land of Egypt, and redeemed thee out of the house of servitude; and I sent before thee Moses, Aaron, and Miriam.

— for I brought thee up out of the land of Egypt; instead of doing them any wrong, God had done them much good; of which this is one instance and he was able to produce more: this a notorious, plain and full proof of his goodness to them which could not be denied;

— and redeemed thee out of the house of slaves; or “out of the house of bondage” as the same words are rendered, Exodus 20:2; that is, out of hard service in which their lives were made bitter; out of cruel bondage and slavery which made them cry to the Lord for help and deliverance; and he heard them and sent them a deliverer;

— and I sent before thee Moses, Aaron and Miriam; Moses was their lawgiver, leader and commander; Aaron was their priest to offer sacrifice for them and to intercede on their behalf; and Miriam was a prophetess; the Targum says, “I sent before thee three prophets, Moses to teach the tradition of judgements; Aaron to make atonement for the people; and Miriam to instruct the women.”

5 O My people, remember now what Balak king of Moab counseled, and what Balaam the son of Beor answered him, from Shittim unto Gilgal, that ye may know the righteousness of the Lord.” — O My people, remember now what Balak, king of Moab, consulted, the counsel he took in trying to bring about their downfall;

— and what Balaam, the son of Beor, answered him from Shittim unto Gilgal, between the first station after Balaam’s blessing and the first station on the soil of the Holy Land, Cf Numbers 25:1; Joshua 4:19.

6 With what shall I come before the Lord, and bow myself before the high God? Shall I come before Him with burnt offerings, with calves of a year old?

— wherewith shall I come before the Lord and bow myself before the high God? the prophet asks in the name of the people in order to restore the relationship which had been so rudely disturbed by their transgressions. Shall I come before Him with burnt offerings, with calves of a year old? these being considered the choicest sacrifices.

7 Will the Lord be pleased with thousands of rams, or with ten thousands of rivers of oil? Shall I give my firstborn for my transgression, the fruit of my body for the sin of my soul? — will the Lord be pleased with thousands of rams; if single burnt offerings of bullocks and heifers will not do, will thousands of rams be acceptable to him?

— or with ten thousands of rivers of oil? for meat offerings, in which oil was used: if he could but gain his point and get the God of Israel on his side;

— shall I give my firstborn for my transgression, the fruit of my body for the sin of my soul? It is well known that the Phenicians and others in the land of Canaan sacrificed their children to Saturn or Molech, and some of the idolatrous Israelites imitated this horrid practice: see note on Leviticus 18:21, where God in a solemn manner prohibits it;

— these two verses give us an exact description of the character of hypocrites and habitual sinners who hope to obtain God’s favour by performing certain external ceremonies and are willing to purchase their own pardon upon any terms, except that of reforming their lives.

8 He hath shown thee, O man, what is good: and what doth the Lord require of thee but to do justly and to love mercy, and to walk humbly with thy God? — and to do justly; to do private and personal justice between man and man; to hurt no man’s property and character; which as it is agreeable to the law of God;

— and to love mercy; not only to show mercy to miserable objects, to persons in distress; to relieve the poor, to clothe the naked and feed the hungry, but to delight in such exercises and which a king especially should do;

— and to walk humbly with thy God? acknowledging his distance from him and the obligations he lay under to him; and even though a king yet his God and Creator was above him, King of kings, and Lord of lords, to whom he owed his crown, sceptre and kingdom and was accountable to him for all his administrations:

— and this “walking humbly” as opposed to “walking in pride” or compare to “come boldly before the throne of grace (Hebrews 4:16)” which kings are apt to do; but God can humble them and bring them low as kings have been obliged to learn; see Daniel 2:21

“And He changeth the times and the seasons; He removeth kings and setteth up kings. He giveth wisdom unto the wise, and knowledge to them that know understanding,” Daniel 2:21

9 The Lord’S voice crieth unto the city (and the man of wisdom shall see Thy name): “Hear ye the rod and who hath appointed it! — the Targum of the whole says, “with the voice the prophets of the Lord Cry to the city; and teachers fear the name (of the Lord); hear, O king and rulers, and the rest of the people of the land.”

10 Are there yet the treasures of wickedness in the house of the wicked, and the scant measure that is abominable? — are there yet the treasures of wickedness in the house of the wicked? namely, such as had been gained by wickedness, by oppression and cheating;

— and the scant measure that is abominable? or for such practices as they were abominable and detestable to God; they stirred up his wrath, and brought destruction on those that used them. The Targum says, “false measures that bring a curse.”

11 Shall I count them pure with the wicked balances, and with the bag of deceitful weights? — and with the bag of deceitful weights? or “stones” which were used in weighing goods and which were deceitful when a heavier was used in buying and a lighter in selling;

— so the Targum says, “and with the bag, in which are weights greater and lesser” condemned in Deuteronomy 25:13.

The Targum is another source of the Bible, much like the Masoretic Text and the Septuagint; and to dismiss it as another testimony for spiritual inspiration and understanding, as virtually all the endtime Churches do, is an absolute disgrace.

12 For the rich men thereof are full of violence, and the inhabitants thereof have spoken lies, and their tongue is deceitful in their mouth. — greedy men like Rupert Murdoch, Bill Gates, Charles Schwab and George Soros;

— for the rich men (read rich nations like the United States and United kingdom) thereof are full of violence; that is, the rich men of the city, to whom the voice of the Lord cried, ancient Samaria, but more likely modern nations like the United States and United Kingdom, are full of violence, invading Iraq under the false pretext of WMD (weapons of mass destruction);

— or any or all the cities of Israel and Judah; the rich men of these cities, who had enough of the world and were under no temptation to do an ill thing, to get money; and yet their hands and their houses and their treasuries,

— as the Targum says, were full of goods gotten by violent measures, by the oppression of the poor and needy. for more, see (1) Britain stole $45 trillion from India; (2) The $144 Billion Art Robbery

13 Therefore also will I make thee sick by smiting thee, in making thee desolate because of thy sins. — therefore also will I make thee sick in smiting thee; with the rod to be heard by some of his sore judgments:

— as famine, pestilence, the sword of the enemy, civil disorders and the like which should cause their kingdom and state and families to decline and waste away as a sickly and diseased body. So the Targum says “and I brought upon thee illness and a stroke.”

14 Thou shalt eat, but not be satisfied, and thy casting down shall be in the midst of thee. And thou shalt take hold, but shalt not deliver; and that which thou deliverest will I give up to the sword.

— thou shalt eat, but not be satisfied; either not having enough to eat, for the refreshing and satisfying of nature; or else a blessing being withheld from food, though eaten, and so not nourishing; or a voracious and insatiable appetite being given as a curse; the first sense seems best;

— and you shall be overtaken: and your enemies who lead your sons and daughters away into captivity; but you shall not rescue them and if you rescue them their end will be to the sword.

15 Thou shalt sow, but thou shalt not reap; thou shalt tread the olives, but thou shalt not anoint thyself with oil; and sweet wine, but shalt not drink wine.

— thou shalt sow, but thou shalt not reap, the enemy either destroying or robbing the crop; thou shalt tread the olives but thou shalt not anoint thee with oil since the enemy would plunder the stores; and sweet wine, these must as pressed from the grapes, but shalt not drink wine, the finished product.

16 For the statutes of Omri are kept, and all the works of the house of Ahab; and ye walk in their counsels, that I should make thee a desolation and the inhabitants thereof a hissing: Therefore ye shall bear the reproach of My people.”

— statutes of Omri; the founder of Samaria (Hebrew name “Shomron” שֹׁומְרוֹן) and of Ahab’s wicked house; Ahab was the son of Omri, and exceeded his father and all his predecessors in impiety. He did more, it is said in 1 Kings 16:33; to provoke the Lord God than all the kings of Israel that were before him;

— God would make thee a desolation, an object of astonishment and horror, and the inhabitants thereof an hissing, to be jeered by the nations at on every side; therefore ye shall bear the reproach of my people, the disgrace which is ordinarily heaped upon the people of God if it is delivered into the hands of its enemies.

Micah 7

1 Woe is me! For I am as when they have gathered the summer fruits, as the grape gleanings of the vintage: There is no cluster to eat; my soul desired the first ripe fruit. — Woe is me! alas for an unhappy man that I am to live in such an age and among such a people as I do! this the prophet laments;

— for I am as when they have gathered the summer fruits as the grape gleanings of the vintage; when there are only an apple or a pear or two leftover, or such sort of fruit, and such a quantity of it left on the top of the tree, signifying either that he was like Elijah left alone or however that the number of good men were very few;

— there is no cluster to eat; my soul desired the first ripe fruit; there are few or none that are so truly and consistently pious as to delight in doing good to others or making them as happy as lies in their power.

2 The good man is perished out of the earth, and there is none upright among men. They all lie in wait for blood; they hunt every man his brother with a net. — the good man is perished out of the earth; here the complaint is that there are few of this character in the earth in the land of Israel;

— and there is none upright among men; that are upright in heart and life; that have right spirits renewed in them are Israelites indeed, in whom there is no guile; and walk uprightly according to the rule of the divine word, truly honest, faithful men; very few such were to be found, scarce;

— they hunt every man his brother with a net as men lay nets for fish, fowl, beasts and hunt them till they have got them into them; so these men laid snares not for strangers only but for their own brethren to entangle them in and cheat and defraud them of their substance; and this they would do even to their destruction, so the Targum says, “betray or deliver his brother to destruction.”

— there are very few left because the majority in our society have succumbed to four great deceptions in our modern era (Easter, Christmas, Sundays, holy ghost) more at the end

3 That they may do evil with both hands earnestly, the prince asketh, and the judge asketh for a reward; and the great man uttereth his wicked desire; so they wrap it up.

— that they may do evil with both hands earnestly; or “well” strenuously, diligently to the utmost of their power, labouring at it with all their might and main; as wicked men generally are more industrious and exert themselves more to do evil than good men do to do good; and even weary themselves to commit iniquity:

— the prince asketh and the judge asketh for a reward; and if they do it must be bribed and have a reward for it even persons of such high character; and the great man he uttereth his mischievous desire; the depravity, corruption and perverseness of his soul;

— who is either some great man at court, that being encouraged by the example of the prince and judge, openly and publicly requires a bribe also to do an ill thing; and without any shame or blushing promises to do it on that consideration; or a counsellor at the bar who openly declares that he will speak in such a cause.

4 The best of them is as a brier; the most upright is sharper than a thorn hedge. The day of thy watchmen and thy visitation cometh; now shall be their perplexity. — the day of thy watchmen; literally taken for such as on the watchtowers observe whether enemies approach;

— thy watchmen; either the true prophets of the Lord, foretold to come but were discredited and despised will now most assuredly come; and now it should be seen whether it would be the day of their punishment for their false prophecies promised only good times ahead;

— and thy visitation cometh; the time that God would punish the people in general for their iniquities, as well as their false prophets, princes, judges and great men; who also may be designed by watchmen.

5 Trust ye not in a friend, put ye not confidence in a guide; keep the doors of thy mouth from her that lieth in thy bosom. — put ye not confidence in any guide; in spiritual matters, in civil affairs as civil magistrates, judges, counsellors or in domestic matters.

6 For the son dishonoreth the father, the daughter riseth up against her mother, the daughter-in-law against her mother-in-law: a man’s enemies are the men of his own house. — for the son dishonoreth the father, openly despising him, the daughter riseth up against her mother, refusing her the love and honor which she owes;

— the daughter-in-law against her mother-in-law, all the most sacred relationships being utterly broken down; a man’s enemies are the men of his own house. Similar conditions preceded the fall of Jerusalem and will precede the end of the world.

7 Therefore I will look unto the Lord; I will wait for the God of my salvation; my God will hear me. — my God will hear me; this is the language of faith, both to say that God was his God, and that he would hear and answer him;

8 Rejoice not over me, O mine enemy; when I fall, I shall arise; when I sit in darkness, the Lord shall be a light unto me.

— rejoice not against me, O mine enemy; these are the words of the prophet in the house of Israel continued in an address to his and their enemy; literally the Chaldeans or Edomites or both who rejoiced at the destruction of Jerusalem and the calamities the people of the Jews were brought into at it.

9 I will bear the indignation of the Lord because I have sinned against Him, until He plead my cause and execute judgement for me. He will bring me forth to the light, and I shall behold His righteousness.

— I will bear the indignation of the Lord; the Targum prefaces these words with “Jerusalem saith” and they are the words of the prophet in the name of Jerusalem; with the humble submission which characterizes the repentant heart, because I have sinned against him, such a free and unequivocal confession being essential if the sorrow is genuine;

— until he plead my cause, taking the part of his people against the enemies and execute judgement for me, maintaining and establishing his Kingdom in spite of all hostility;

— he will bring me forth to the light, namely, out of the darkness of captivity and oppression and I shall behold his righteousness for the deliverance of his people was in agreement with the Lord’s ancient promises.

10 Then she that is mine enemy shall see it, and shame shall cover her that said unto me, “Where is the Lord thy God?” Mine eyes shall behold her; now shall she be trodden down as the mire of the streets.

— then she that is mine enemy shall see it, this being the confident expectation of the Lord’s people and shame shall cover her which said unto me, Where is the Lord, thy God? in the scornful question usually asked by the enemies of the Kingdom;

— God’s eyes shall behold her, with quiet satisfaction; now shall she be trodden down as the mire of the streets.

11 In that day thy walls are to be built; in that day shall the decree be far removed. — when Jerusalem is to be rebuilt in the Millennium, then it will be larger than it was previously; “far removed” refers to being extended outwards and implied these extended walls are the city limits of Jerusalem.

12 In that day also he shall come even to thee from Assyria, and from the fortified cities, and from the fortress even to the river, and from sea to sea and from mountain to mountain.

— in that day also God shall come even to thee, the restored Zion, from Assyria and from the fortified cities where many of the ten tribes were, whither they were carried captives and from the fortress, namely, Assyria, even beyond the river, the Euphrates, to indicate all the countries lying between;

— and from sea to sea and from mountain to mountain, from all the regions and countries of the earth, all those whom the Lord had chosen from the various countries of the world;

— here is a parallel and contrast from Ezekiel 6:3

and say: ‘Ye mountains of Israel, hear the word of the Lord God. Thus saith the Lord God to the mountains and to the hills, to the rivers and to the valleys: Behold I, even I, will bring a sword upon you, and I will destroy your high places. — this message to the “mountains of Israel;” these mountains refer to the United States, UK and France. . . .

“and to the hills, to the rivers and to the valleys;” the hills: Ireland, Switzerland and the Scandinavian countries: Denmark, Norway, and Sweden, Finland, and Iceland; and the valleys, the low countries: Belgium, the Netherlands, and Luxembourg;

— and to the rivers; where during the nineteenth century, the British Royal Navy were known to “Rule the Waves;” and the United States having been plowing up and down the five oceans with her Seven Fleets since the British left the scene.

13 Notwithstanding, the land shall be desolate because of them that dwell therein, because of the fruit of their doings. — notwithstanding the land shall be desolate,

— the reference to the land of Israel; possessed by the ten tribes and at the latter days shall be desolate; because of them that dwell therein, for the fruit of their doings; the fruit of their doings are the fruits of their wickedness, which is desolation: by fire, pestilence and famine, and if they still survive, to be smitten by a Sword.

14 Rule Thy people with Thy rod, the flock of Thine heritage, who dwell solitarily in the wood, in the midst of Carmel; let them feed in Bashan and Gilead, as in the days of old.

— led thy people withGod’s rod, with her true shepherd’s care, the staff being the mark of the shepherd; the Targum says, “feed thy people with thy word, the people of thine inheritance, in the age which is to be renewed.”

15 “As in the days of thy coming out of the land of Egypt, will I show unto them marvelous things.” — according to the days of thy coming out of the land of Egypt when he overthrew their enemies with a mighty hand and revealed his goodness to Israel, will I show unto him marvelous things, his Kingdom being given the wonders of his rule.

16 The nations shall see and be confounded at all their might; they shall lay their hand upon their mouth; their ears shall be deaf. — the nations will be stunned with it and scarce know what they hear;

— become deaf with the continual noise of it, they shall lay their hand upon their mouth in token that they were reduced to silence; and will choose to hear no more; they shall stand astounded so as not to hear what shall be said and will stop their ears at what is being told.

17 They shall lick the dust like a serpent; they shall move out of their holes like worms of the earth. They shall be afraid of the Lord our God, and shall fear because of Thee.

— they shall lick the dust like a serpent, in deepest humiliation; they shall move out of their holes like worms of the earth, literally, “as those things that creep on the earth” they shall tremble forth out of their hiding-places;

— they shall be afraid of the Lord, our God, approaching to him with terror, and shall fear because of thee. With these words the prophet once more turns directly to Yehovah, addressing him in words of praise.

18 Who is a God like unto Thee, who pardoneth iniquity, and passeth by the transgression of the remnant of His heritage? He retaineth not His anger for ever, because He delighteth in mercy.

19 He will turn again; He will have compassion upon us; He will subdue our iniquities. And Thou wilt cast all their sins into the depths of the sea. — he will turn again, so the prophet assures the believers;

— God will have compassion upon us, he will subdue our iniquities, treading them down like enemies that rise up against the believers; and Thou wilt cast all their sins into the depths of the sea, so that they are covered over and can no more rise to condemn the Lord’s people.

20 Thou wilt perform the truth to Jacob and the mercy to Abraham, which Thou hast sworn unto our fathers from the days of old. — thou wilt perform the truth to Jacob; that is, the promise made to Jacob; unfortunately there is very little truth in the house of Jacob today!

— and the mercy to Abraham; the gracious promises made to him, which sprung from mere grace and mercy the Lord would faithfully perform and make good to his posterity, natural and spiritual, especially to those who are Israelites indeed;

— all respecting his natural and spiritual seed; and especially the promise of the coming of the Millenium and the Messianic Age, that seed of his in which all nations of the earth were to be blessed; and which is the eminent instance of the mercy and grace of God to all nations of the world that walk in the steps of Abraham.

~~~

Four Great Deceptions:

(a) Easters, a celebration of the Queen of heaven: Ishtar, the Assyrian and Babylonian goddess of fertility and sex. Her symbols (like the egg and bunny) were and still are fertility and sex symbols; and to those who actually think eggs and bunnies have something to do with the resurrection; Jeremiah 7:18 the women knead their dough to make cakes to the Queen of heaven; in Egypt, Jeremiah 44:17-19, 25, this is Ishtar: pronounced ‘Easter.’

(b) Christmas; Ezekiel 8:16 five and twenty men with their backs toward the temple; their faces toward the east; and they worshiped the sun toward the east; Christmas, which honor the Mithraism, birthday on December 25th – a form of nature worship based on the Sun-Goddess Mithra who on the darkest night of the year (December 20/21), gives birth to “Light” causing each day thereafter to grow longer until the Summer solstice;

(c) Sundays; her sabbaths which is Sundays, where the original keepers were the Samaritans, brought from Assyria: And the king of Assyria brought men from Babylon, and from Cuthah, and from Ava, and from Hamath, and from Sepharvaim, and placed them in the cities of Samaria instead of the children of Israel; and they possessed Samaria and dwelt in the cities thereof, II Kings 17:24.

— today, more than 98.5 percent of Christians are honoring the SUN by observing SUNday worship. Ezekiel 8:16 They have “their backs toward the temple of the Lord and their faces toward the east; and they worshiped the SUN toward the east; whose penalty is to be stoned to death, Deuteronomy 17:3-5 – ’till they die.

— also, following the SUN-worshipping Samaritans, most Church of God Communities are showing their contempt for God by having their “wavesheaf offering” and Pentecost on a SUNday; always on a SUNday. And these are supposedly in God’s Sanctuary, but God says He is a jealous God, so these pretentious Christians could be spewed out of His mouth! A death penalty – ’till they die!

(4) Holy Ghosts – Revelation 4:5 And out of the throne proceeded lightnings and thunderings and voices. And there were seven lamps of fire burning before the throne, which are the seven Spirits of God; if the Spirit is a Being or an independent Personage; there would be seven Holy Spirits;

— and with these we would add Jesus Christ the Son, and God the Father, then there would be nine Personage; we should have a Polygon or a Nonagon; so surely the Godhead would be a Polyty or a Nonaty; nine heads, that would be more like an Indian goddess more than a Trinity?

— more about the missing Holy Ghost; indeed he’s real and around; he was created full of wisdom and beauty, his head swelled up so much that he wanted to be like the Most High: these clues are giving in the book of Ezekiel 28 and Isaiah 14.

India’s Sikh separatist Movement

•March 30, 2023 • Leave a Comment

India can’t find a Sikh separatist leader, but its manhunt has got the world’s attention

Authorities have pulled out all the stops in their search for Amritpal Singh, cutting off internet service and setting off protests in the US and elsewhere.

Amritpal Singh, center, in Amritsar, India. Authorities in the state of Punjab have been searching for the Sikh separatist leader for more than a week

NBC News By Yashraj Sharma ~ March 28, 2023

NEW DELHI — A massive manhunt in India for a Sikh separatist leader has failed to find its target for more than a week. But authorities’ no-holds-barred search — including the deployment of thousands of paramilitary soldiers, a statewide internet blackout and a high-speed chase — has captured the attention of the nation and the world.

Police accuse Amritpal Singh, a 30-year-old self-styled preacher who seeks a sovereign Sikh homeland, of disrupting communal harmony, among other mounting charges. Officials say they are worried he could stir violence in his home state of Punjab, where thousands of people were killed in the 1980s as the Indian government fought an bloody insurgency for an independent Sikh state known as Khalistan.

The crackdown has unnerved the public, said Sukanya Singh, a university student in Amritsar, Punjab’s second-biggest city. 

“There is panic buying because we don’t know how long it will go,” the 20-year-old, whose last name is common among Sikhs and who is unrelated to Amritpal Singh, told NBC News last week. “Half of my dormitory is empty; everybody just wanted to reach a safe space.”

As the search for the preacher began March 18, authorities blocked mobile internet and SMS services, restricting communication for Punjab’s 27 million residents — almost the population of Texas. Service was gradually restored over several days, though it is still out in some parts of the state. 

“There seems to be no sense of control of the situation,” Sukanya Singh said of the government’s actions.

In their effort to apprehend Singh, Indian authorities have arrested more than 200 people and enforced heightened security measures in Punjab, a state in northwestern India that borders Pakistan.

Journalists and activists who have been commenting on the situation in Punjab, including prominent Sikh figures abroad, say their Twitter accounts have been blocked in India at the government’s request. The Twitter account for the Punjabi-language version of BBC News was also blocked in India on Tuesday.

India’s Ministry of Electronics and Information Technology did not immediately reply to a request for comment. Twitter, which previously reported that India had made more requests to take down journalists’ tweets than any other country, also did not immediately reply to a request for comment.

The search for Singh has reverberated internationally, with Sikh activists protesting outside Indian embassies and consulates in the US, Britain, Canada and Australia. Beyond the disruptions caused by the manhunt, protesters say they are calling attention to broader human rights issues in Hindu-majority India, the world’s largest democracy, and the treatment of religious minorities by Prime Minister Narendra Modi and his Hindu nationalist government. Sikhs make up about 1.7% of India’s population of 1.4 billion [about 28 million].

Khalistan protesters rallied outside of India’s High Commission in London

In Britain, where Sikhs are the fourth-largest religious group, a security review is underway after protesters pulled down the Indian flag and smashed a window at India’s High Commission in London on March 19.

India summoned Britain’s most senior diplomat over the incident and has since removed some temporary security barricades outside the British High Commission in New Delhi.

Not much is known about Singh, who spent years living in the United Arab Emirates and did not come to prominence until recently. Upon his return to India last year, he abandoned his clean-shaven look and began wearing the traditional robes of his avowed hero, Jarnail Singh Bhindranwale, a Sikh separatist leader who was killed by the Indian army in 1984.

Since then, Singh has been at the forefront of the Khalistan movement, using social media to spread his message and garner support. His speeches and videos have gone viral on platforms such as YouTube, Facebook and Instagram, not just in India but also among the large Sikh diaspora in the US and elsewhere, where the movement still has whispers of support.

In February, Singh and hundreds of his supporters, some of them armed, stormed a police station in Punjab demanding the release of one of his aides. Afterward, India’s governing Bharatiya Janata Party demanded Singh’s arrest.

Jarnail Singh Bhindranwale, Khalistan Movement: 1947 to 1984

The search for Singh has had a severe impact on businesses, schools and tourism, with many people canceling visits to Punjab. While police say the internet blackout was an attempt to prevent unrest and curb “fake news,” rights groups criticized it as a violation of fundamental rights.

“Indian authorities must stop using overbroad reasons like those of ‘public safety’ to impose internet shutdowns over millions of people,” Amnesty India said in a statement last week.

India orders more internet shutdowns than any other country — including 84 last year, or almost half the global total, according to Access Now, an advocacy group based in New York.

Tanmay Singh, senior litigation counsel at the Internet Freedom Foundation, said the internet blackout in Punjab was “disproportionate and prima facie illegal” and a tactic used too often by the Indian government.

“This internet suspension order followed a fill-in-the-blanks method on the same template because there is no application of mind,” he said.

The closest police appear to have come to apprehending Singh was on March 18, when they intercepted his convoy at a checkpoint outside a village in rural Punjab. The Mercedes carrying him managed to speed away, India’s Tribune News Service reported, citing a police affidavit. Livestreams and videos of the ensuing police chase were uploaded to Facebook and Twitter by Singh’s associates until internet service was disrupted.

Singh was later seen on CCTV footage having changed clothes before escaping on a motorcycle, Punjab Inspector General Sukhchain Singh Gill said at a news conference last week. Authorities have arrested multiple people accused of helping Singh elude police.

After the violence and extremism of the 1980s, “there is no popular support in Punjab for the Khalistan movement,” said Ronki Ram, a professor of history at Panjab University in Chandigarh, India, who specializes in identity politics. But Singh’s ideas resonate with young Sikhs who are struggling economically and feel marginalized by the government, he said.

Ram said Singh had filled a “huge political vacuum” in Punjab, whose challenges include drug addiction and a growing water shortage. Singh is also the head of Waris Punjab De, or Punjab’s Heirs, a group that participated in mass protests by Indian farmers — who are disproportionately Sikhs from Punjab — against proposed agricultural reforms that were withdrawn by the Modi government in 2021.

The “spectacle” created by the manhunt has divided the public and left Punjab’s problems unsolved, Ram said.

“There needs to be constructive dialogue with the people,” he said, “not a crackdown.”

“Shall a trumpet be blown in the city, and the people not be afraid? Shall there be evil in a city, and the LORD hath not done it?” Amos 3:6

“I create darkness; I create evil; I, the LORD, do all these things” Isaiah 45:7

Micah (Ch 3-4)

•March 29, 2023 • Leave a Comment

The Prophecy of Micah, whose word of the Lord was meant for the heads of Jacob, the princes of the house of Israel; but then who is of the house of Israel today? Are they not of the United States today?

More on (1) Ephraim / The United States; (2) Ephraim and Manasseh

For more on the Ox without the Unicorn

The Prophecy of Micah, whose Word of the Lord is meant for the house of Jacob

Micah 3

The Targum is another source of the Bible, much like the Masoretic Text and the Septuagint; and to dismiss it as another testimony for spiritual inspiration and understanding, as virtually all the endtime Churches do, is an absolute disgrace.

The Targum was started by Ezra for those returning from the Babylon exile and for these returnees they could only understand the Scriptures in Aramaic. That is, the Targum is as if Ezra is speaking to us today from the Hebrew Bible quoted.

1 And I said: “Hear, I pray you, O heads of Jacob, and ye princes of the house of Israel: Is it not for you to know judgement” — and God said, Hear, I pray you, O heads of Jacob; the whole head of Jacob,

— the leading men and particularly those princes of the house of Israel, the ten tribes, being ringleaders in sin, who ought to have set good examples to others; and these are not to be spared because of their grandeur and dignity;

— is it not for you to know judgement? not the house of Israel to pass judgement, especially of (1) when and where to hold the feasts and (2) how to determine the Sacred Calendar, which were administered by the house of Judah (who has the Scepter) and the Sanhedrin; and set rules and pass judgement; to give heed to that which is just and unjust.

2 you who hate the good and love the evil, who pluck off their skin from off them and their flesh from off their bones, — who hate good and love evil, doing just the opposite of that which their leaders required of them;

— who pluck off their skin from off them, like wild beasts that tear off skin and flesh from the bones, and then devour them; or like cruel shepherds that not content to fleece their flocks, skin them; and their flesh from off their bones and take their flesh also and feed themselves and not the flock; or like butchers that first take off the skin off a beast and then cut up its flesh;

— the design of the expressions is to show what rigour, cruelty and oppressions these rulers exercised on the people and by their heavy taxes and levies, pillaged and plundered them of all they had in the world and left them quite bare as bones stripped of their skin and flesh.robbing them of their most precious possessions;

— so the Targum says, “seizing on their substance by violence, and their precious mammon they take away.”

3 who also eat the flesh of My people and flay their skin from off them; and they break their bones and chop them in pieces, as for the pot and as flesh within the cauldron?”

— who also eat the flesh of my people and flay their skins from off them; like cannibals, flay them alive and then eat their flesh, devouring their substance, only expressed in terms which still more set forth their savageness, barbarity, and cruelty; sound like those who operates Unit 731 during World War II; would God also intended this to mean those Vietnamese who had their skin sprayed with Agent Orange?

— and they break their bones and chop them in pieces as for the pot and as flesh within the cauldron; with emphasis of detail: did with them as cooks do who not only cut flesh off the bones and into slices but break the bones themselves; pictures the excess of cruelty which the rulers of the people were practicing.

4 Then shall they cry unto the Lord, but He will not hear them; He will even hide His face from them at that time, as they have behaved themselves ill in their doings. — then shall they, the guilty ones, cry unto the Lord but He will not hear them namely at the time of the revelation of His wrath;

— the Targum says in the time of their distress but he will not hear their prayer so as to answer it according to their desire; that is, he will not save them from danger but deliver them up and all that belong unto them into the hands of such that shall use them as they have done others;

— he will even hide his face from them at that time, refusing to pay the slightest attention to their distress as they have behaved themselves ill in their doings and were thus fully ripe for judgement.

5 Thus saith the Lord concerning the prophets that make my people err, that bite with their teeth and cry “Peace”; and he that putteth not into their mouths, they even prepare war against him:

— thus saith the Lord concerning the prophets, namely the false shepherds and false prophets, who presumed to speak in the name of the Lord without being sent that make my people to err, leading them astray, they led them into mistakes about matters of religion and civil government;

— that bite with their teeth and cry, Peace! that is, who prophesy smooth things, promise all kind of prosperity and plenty when they receive a sufficient amount of tithe money, proclaim peace; may even get a “Nobel Peace Prize” for so doing; do not keep a good table for them and cram and pamper them, but neglect them and do not provide well for them;

— they even declare war against him; these they threaten with one calamity or another that shall befall them; and endeavour to set their neighbours against them and even the government itself and do them all the mischief they can by defamation and slander, solemnly declaring warfare as for the honor of God.

6 “Therefore night shall be unto you, that ye shall not have a vision; and it shall be dark unto you, that ye shall not divine. And the sun shall go down over the prophets, and the day shall be dark over them.

— therefore night shall be unto you that ye shall not have a vision, being excluded from the light granted by the Spirit of God; and it shall be dark unto you that ye shall not divine; they have no understanding and granted no revelation of the future;

— and the sun shall go down and the day shall be dark over the prophets; their time of prosperity will be over and they shall no more be in favour with the people, or courted and feasted by them; but shall be held in the utmost contempt and abhorrence with darkness as in the Day of Judgement;

— the Targum of the whole says, “therefore ye shall blush at prophesying, and be ashamed of teaching; and tribulation as darkness shall cover the false prophets, and the time shall be darkened upon them.”

7 Then shall the seers be ashamed, and the diviners confounded; yea, they shall all cover their lips; for there is no answer from God.” — then shall the seers be ashamed, be disgraced on account of the fact that their predictions are not fulfilled and the diviners confounded, blushing with shame on account of their miserable failures in trying to uncover the future;

— yea, they shall all cover their lips, literally “their beard” their face up to the nostrils as a sign of shame; for there is no answer of God, not that they shall be ashamed and silenced because they shall now have no answer of God for they never had any; the Targum says, “for there is not in them a spirit of prophecy from the Lord.”

8 But truly I am full of power by the Spirit of the Lord, and of judgement and of might, to declare unto Jacob his transgression and to Israel his sin. — declare unto Jacob; the whole head of Jacob, the leading men of the nation and particularly those princes of the house of Israel, the ten tribes, those northern kingdom that followed Jeroboam;

— to declare unto Jacob his transgression and to Israel his sin; especially of (1) when and where to hold the feasts and (2) how to determine the calendar which were administered by the house of Judah (who has the Scepter) and the Sanhedrin; and set rules and pass judgement; to give heed to that which is just and unjust.

9 Hear this, I pray you, ye heads of the house of Jacob and princes of the house of Israel, that abhor judgement and pervert all equity: — hear this, I pray you, ye heads of the house of Jacob and princes of the house of Israel, the very leaders whose wickedness had been described in the first part of the Chapter;

— that abhor judgement, the law and ordinances; everything that was right or just, making crooked paths that which should have been kept straight; hate to do that which was right and just; and pervert all the rules and laws of justice and equity, clearing the guilty and condemning the innocent.

10 They build up Zion with blood, and Jerusalem with iniquity.

11 The heads thereof judge for reward, and the priests thereof teach for hire, and the prophets thereof divine for money. Yet will they lean upon the Lord and say, “Is not the Lord among us? No evil can come upon us.” — the heads thereof judge for reward being influenced in their decisions by bribe money and the priests, who were first hired by king Jeroboam after payment of bribes and fees from the lowest of people, people who were not qualified but for money;

— and the prophets thereof hired for money, their oracles being fashioned according to the presents which men gave them; yet will they lean upon the Lord, insisting that they were performing the work of their office by authority the God living in the midst of His people;

— and say, Is not the Lord among us? namely, with His power and protection. No evil can come upon us: namely pestilence, famine, sword and captivity that the prophets of the Lord had threatened them with.

12 Therefore shall Zion for your sake be plowed as a field, and Jerusalem shall become heaps, and the mountain of the house as the high places of the forest. — therefore shall Zion for your sake on account of their wickedness in making the Lord’s Temple a den of murderers, be plowed as a field, the king’s quarter turned into tillable soil;

— Jerusalem and the rest of the city shall become heaps, piles of broken stones and the mountain of the house, that is, of the Temple, as the high places of the forest, being overgrown with brush and trees. It is a vivid description of the ruin which comes upon the enemies of the Lord.

Micah 4

1 But in the last days it shall come to pass, that the mountain of the house of the Lord shall be established in the top of the mountains; and it shall be exalted above the hills, and people shall flow unto it.

— but in the last days, in the great Millennium or the Messianic Age, it shall come to pass that the mountain of the house of the Lord, of the Kingdom of God, shall be established in the top of the mountains which also mean a new Ezekiel Temple built on Mount Moriah where the divine Majesty would reside; the ideal Zion being elevated above all else in the world;

— and it shall be exalted above the hills, visible before all nations and before the eyes of all men; and people shall flow unto it, members of all the nations of the world come come to keep the feasts; should they refuse, there would be no rain, but plagues:

“And if the family of Egypt go not up, and come not, that have no rain; there shall be the plague, wherewith the LORD will smite the nations that come not up to keep the feast of tabernacles” Zechariah 14:18 (more at end of this chapter)

2 And many nations shall come and say, “Come, and let us go up to the mountain of the Lord, and to the house of the God of Jacob. And He will teach us of His ways, and we will walk in His paths.” For the law shall go forth from Zion, and the word of the Lord from Jerusalem.

— and many nations shall come, namely, the Elects whom the Lord would choose and say, Come and let us go up to the mountain of the Lord, the place where salvation is proclaimed, and to the house of the God of Jacob, the Kingdom of the Messiah;

— and he will teach us of his ways and we will walk in his paths; no longer paying homage to the Queen of heaven of Egypt: Astarte, but dub it Easter, the day of Christ resurrection; neither would they pay homage to Mithras of Babylon, whose birthday is on December 25th, by dubbing it Christmas; nor they be Sunworshippers, whose services are always on Sundays; and Pentecost on Whitsundays;

— for the Law, as the revelation of the holy and righteous will of God, shall go forth of Zion and the Word of the Lord, particularly in the revelation of the way of salvation, from Jerusalem, where the house of Judah has dominion: for the proclamation of the Word, in speaking of the law, statutes and ordinances, of sin, justice and judgement, of redemption and grace, all in the hands of the Elects.

— and they shall beat their swords into plowshares and their spears into pruning-hooks, both in an earthly, temporal Millennial peace of which men are dreaming from time to time, but also in the spiritual peace in Him where heretic doctrines are beaten into plowshares and their hatred among men into pruning-hooks, in whom there is truly peace on earth;

— nation shall not lift up a sword against nation neither shall they learn war any more, this being said of the inner peace and harmony of the Kingdom of God.

3 And He shall judge among many people, and rebuke strong nations afar off. And they shall beat their swords into plowshares, and their spears into pruning hooks; nation shall not lift up a sword against nation, neither shall they learn war any more.

— and he, the God of the covenant, shall judge among many people, between Ishmaelites and the sons of Isaac; between Esau and Jacob; between the house of Israel and the house of Judah; teaching them true justice in accordance with his spoken and unspoken will, and rebuke strong nations afar off, to make them cease their enmity against him;

— and God will gather her that is driven out; out of the land of Israel, and scattered among the nations of the world; even driven out by the Lord himself, because of their transgressions against him; Jeremiah 16:15;

— and that God have afflicted; with various calamities, pestilence, famine and sword and in captivity and deaths; the Targum adds, “for the sins of my people” the Israelites for their Sun worshipping (Mithras) and idolatry to the Queen of heaven, Astarte; and the Jews for the rejection of the Messiah and other sins.

4 But they shall sit every man under his vine and under his fig tree, and none shall make them afraid; for the mouth of the Lord of hosts hath spoken it.

— but they shall sit every man under his vine and under his fig tree; a proverbial phrase, expressive of the greatest tranquillity, security and enjoyment of prosperity; 1 Kings 4:25; when persons need not keep within their walled towns and cities and lack themselves up in their houses but may sit down in their gardens, fields and vineyards and enjoy the fruit thereof;

— as the Targum interprets it, “under the fruit of his vine and under the fruit of his fig tree.”

5 For all people will walk every one in the name of his god, and we will walk in the name of the Lord our God for ever and ever. — for all people, all those concerned in this prophecy,

— will walk every one in the name of his God in the power of the one true God in whom he believes whose essence is thus made known and we will walk in the name of the Lord our God forever and ever with a full trust in His supporting strength and powerful protection, which turns aside all the efforts of the enemies to disturb the inner peace of the Kingdom.

6 “In that day,” saith the Lord, “will I assemble her that is halt, and I will gather her that is driven out and her that I have afflicted. — in that day, in the great Millennium or the Messianic Age, saith the Lord, will I assemble the lame and gather those who were dispersed, along with those I afflicted, all worshipping the God of Abraham.

7 And I will make her that is halt (or lame) a remnant, and her that was cast far off a strong nation; and the Lord shall reign over them in Mount Zion from hence forth, even for ever.

— “The people of that ‘crippled’ city will be the only ones left alive (ERV); but I will make them into a strong nation; the Lord will be their king who will rule from Mount Zion forever.

8 And thou, O tower of the flock, the stronghold of the daughter of Zion, unto thee shall it come, even the first dominion; the kingdom shall come to the daughter of Jerusalem.”

— and thou, O tower of the flock, the term being applied to a tower of refuge for flocks in time of danger, here as a fort from which the great King and Shepherd, the Messiah Himself, observes and guards His flock, the stronghold of the daughter of Zion, the impregnable palace of the Kingdom of God;

— unto thee shall it come, even the first dominion, the glory of the earliest OT Elects: Enoch, Noah, Abraham and to the Patriarchs, Job? compared with that of the kingdom of Israel, when established, which are the latter OT Elects, under its mightiest king; King David; andt before that Moses, Joshua, Samuel;

— the kingdom shall come to the daughter of Jerusalem: King Hezekiah, King Josiah; Daniel and his three friends, Ezra and Nehemiah; since the earthly Jerusalem is always at the foundation of the kingdom, the afflictions of the Jewish capital are made typical of the experiences of the Lord’s people.

9 Now why dost thou cry out aloud? Is there no king in thee? Is thy counselor perished? For pangs have taken thee as a woman in travail. — now, why dost thou cry out aloud? at the approach of the Chaldean invasion; Nebuchadnezzar was described as “my servant” or at other times, the Sword;

— is there no king in thee? is there no visible representative of the capable king to keep and protect them? Is thy counselor perished? to counsel, instruct and comfort them and at last to deliver and save them this name also being applied to the reigning member of the house of David?

— for pangs have taken thee as a woman in travail, the true believers in Israel feeling the deepest grief and sorrow over the desolation of the kingdom; and in modern times a time of Jacob’s trouble.

10 Be in pain and labor to bring forth, O daughter of Zion, like a woman in travail; for now shalt thou go forth out of the city, and thou shalt dwell in the field. And thou shalt go even to Babylon; there shalt thou be delivered; there the Lord shall redeem thee from the hand of thine enemies.

— be in pain and labor to bring forth, O daughter of Zion like a woman in travail, the catastrophe of the destruction of Jerusalem and of the exile of the people being imminent; that was for ancient Judah which were for a period of 70 years; but for Ezekiel’s Israel and Judah it could be 190/40 years; for more into another Captivity: see Ezekiel Timeline – 190/40 Years

— for now shalt thou go forth out of the city, after it had been taken by the enemies, their houses taken away from them; and thou shalt dwell in the field if they could survive and thou shalt go even to Babylon, being dragged into captivity again;

— there shalt thou be delivered, namely, when a modern Cyrus issued the decree setting the captives free and thus laid the foundation upon which later arose the Messianic Age or the great Millennium there the Lord shall redeem thee from the hand of thine enemies so that the people of the covenant would be restored to the Promise Land, the land where the Messiah was to reign.

11 Now also many nations are gathered against thee, that say, “Let her be defiled, and let our eye look upon Zion!” — now also, namely, at the time of Jacob’s deepest humiliation, a time known as Jacob’s trouble;

— that say, Let her be defiled, and let our eye look upon Zion, namely, in malicious joy over her downfall; and many nations are gathered against thee, in bold hostility, starting with those of the South and spread to the North; for more on the enemy from the South, see A Sword from the South!

12 But they know not the thoughts of the Lord, neither understand they His counsel; for He shall gather them as the sheaves onto the threshing floor. — but they know not the thoughts of the Lord, the object which He has in mind in thus dealing with His people; one example is the slaughtering of his people spreading from the South to the North (for more see notes from Ezekiel 20:45-21:5)

— neither do they understand God’s unspoken will:

“Thus saith the LORD of hosts: ‘The fast of the fourth month, and the fast of the fifth, and the fast of the seventh, and the fast of the tenth, shall be to the house of Judah joy and gladness and cheerful feasts. Therefore love the truth and peace.’ Zechariah 8:19

But surprisingly, there were the unspoken Word of God! Like parents, they have their secret wishes for their children. So is God. But how do we know God’s unspoken will if they were unspoken? To be unspoken would also mean unwritten. More on the unspoken will of God here.

13 Arise and thresh, O daughter of Zion; for I will make thine horn iron, and I will make thy hoofs brass. And thou shalt beat in pieces many people, and I will consecrate their gain unto the Lord, and their substance unto the Lord of the whole earth.

— arise and thresh, O daughter of Zion, all the Elects that will gathered in Jerusalem, who live according to His commands; for he will make thine horn iron and he will make thy hoofs brass, giving to his Elects a new and unconquerable strength;

— and thou shall beat in pieces many people, not by victories of the flesh, but by those of the spirit; and he will consecrate their gain, what the enemies had gotten by robbery and plunder;

— unto the Lord, as devoted to him, and their substance, all their possessions, unto the Lord of the whole earth, the Elects who will now have a dominion, kingdom and cities given him by the Ancient of Days that so all people, nations and languages shall serve him, Daniel 7:14.

~~~

More from Zachariah 14: the great Millennium or the Messianic Age

16 And it shall come to pass that every one who is left of all the nations which came against Jerusalem, shall even go up from year to year to worship the King, the Lord of hosts, and to keep the Feast of Tabernacles.

17 And it shall be, that whoso will not come up of all the families of the earth unto Jerusalem to worship the King, the Lord of hosts, even upon them shall be no rain.

18 And if the family of Egypt go not up and come not, upon whom there is no rain, there shall be the plague wherewith the Lord will smite the heathen who come not up to keep the Feast of Tabernacles.

19 This shall be the punishment of Egypt and the punishment of all nations that come not up to keep the Feast of Tabernacles.

20 In that day shall there be upon the bells of the horses: “Holiness Unto The Lord.” And the pots in the Lord’S house shall be like the bowls before the altar;

21 yea, every pot in Jerusalem and in Judah shall be holiness unto the Lord of hosts, and all those who sacrifice shall come and take of them and boil therein. And in that day there shall be no more the Canaanite in the house of the Lord of hosts.

~~~~

For more about the South, a prophecy of Esau or Edom, see Obadiah

For more on the enemy from the South, see A Sword from the South!

For more into another Captivity: see Ezekiel Timeline – 190/40 Years

Depleted uranium ammo to Kyiv raises nuke strikes

•March 28, 2023 • Leave a Comment

US’s and UK’s determinations to deliver controversial armor-piercing ammunition to Kyiv may be met with Russian tactical nuke strikes

Armor-piercing shells destined for Ukraine contain depleted uranium

AsiaTimes by Stephen Bryen ~ March 23, 2023

The British announcement that it will supply depleted uranium (DU) ammunition to Ukraine for its Challenger 2 tanks is not a one-off. It was arranged with the United States and for good reason. The US has found a way to speed up delivery of Abrams M-1 tanks to Russia by using older models.

The Abrams 120mm smoothbore gun, like the Challenger’s, uses depleted uranium ammunition when it fires armor-piercing rounds. Abrams tanks sent to Ukraine will be armed with depleted uranium ammunition “tank busting” rounds.

The ammunition in question is technically called armor-piercing fin-stabilized discarding sabot (APFSDS), long dart penetrator ammunition. APFSDS uses a special penetrating rod made of DU with the addition of titanium and molybdenum.

It is highly valued by the military because the DU penetrator is self-sharpening (meaning it does not deform) and pyrophoric. It is highly effective against enemy tanks struck on the side, rear or top, but less so frontally where it can be deflected by sloped armor.

APFSDS penetrators can be made out of materials other than DU, such as titanium. The Russians call DU ammunition “dirty” weapons.

The US’s Abrams M-1 might be met with a Russian tactical nuke!

Depleted uranium is a very heavy, dense metal that is made from uranium hexafluoride. Uranium hexafluoride is the gaseous feedstock for centrifuges making weapon’s grade fissile U-235 for nuclear weapons.

Those who promote the use of DU in weapons argue that DU weapons actually contain less fissile material than natural uranium (but not much less). However, they fail to account for the fact that DU is used in a highly compact form, generally to help penetrate armor and other hardened structures.

While field studies are inconclusive, opponents of ammunition say that DU metal fragments in the soil and DU dust in the air can cause numerous health problems, including cancer. Even naturally occurring uranium is a toxic material.

One scientific study says “The aerosol produced during impact and combustion of depleted uranium munitions can potentially contaminate wide areas around the impact sites or can be inhaled by civilians and military personnel.”

There is some evidence that DU ammunition played a role in so-called Gulf War syndrome and also impacts bone marrow density in soldiers hit by DU fragments.

The US is the world’s heavyweight champion in using DU ammunition in  IraqSyriaAfghanistanBosnia and Kosovo. 782,414 DU rounds were fired during the 1991 war in Iraq. More than 300,000 DU rounds were fired during the 2003 Iraq war, the vast majority by US troops.

Both the US and UK have rejected calls to ban depleted uranium weapons.

Aside from armor-penetrating tank rounds, the US uses DU ammunition for its 30mm GAU-8 Avenger Gatling gun on the A-10 Warthog ground attack jet fighter. The A-10s figured prominently in the Iraq wars and in Afghanistan.

Ukraine last winter requested 100 A-10 jets from the United States and have been secretly training to use the aircraft in combat. If a Crimea offensive takes place, the A-10 may be moved into Ukraine and flown by a combination of Ukrainian pilots and possibly by volunteer former US Air Force pilots.

The USAF has been trying to get rid of the A-10 for some time, which it considers a relic of the Cold War and unlikely to survive in a dense air defense environment. In the latest development, the USAF said it wants to dump all its A-10s as soon as possible. From a USAF perspective, shifting them to Ukraine relieves them of an unwanted burden.

An MQ-9 Reaper drone

The US is also seeking to offset Russia’s advantage in artillery by shipping in new 155mm howitzers to replace artillery lost to Russian air and artillery strikes.

The Ukrainian army is currently fighting battles in BakhmutAvdiivkaVuhledar and around Zaporizhzhia. Bakhmut is getting considerable attention because a large number of Ukrainian troops, some elite units, are bottled up there.

Estimates say there are as many as five Ukrainian brigades involved, representing perhaps as many as 15,000 soldiers, although these brigades have taken high casualties and some of the troops, but not equipment, have been exfiltrated from the city. Russia’s Wagner Group paramilitary forces now claim they control around 70% of the city and have resumed fighting after a brief pause.

The US lost an MQ-9 Reaper drone on March 14, operating only 37 miles from Crimea in a Russian restricted zone. The Reaper is not only a hunter-killer drone, but it has sophisticated sensors that no doubt were being used to gather targeting information, but also to collect ELINT (electronic intercepts) of Russian military units.

Caught in the act by two Russian Su-27s, the drone crashed into the sea. Since then, the US has resumed operations, but at a greater distance away from Crimea, using the high-flying RQ-4 Global Hawk, an all-weather, day or night intelligence, surveillance and reconnaissance drone. The Global Hawk uses imagery intelligence (IMINT), signals intelligence (SIGINT) and moving target indicator (MTI) sensors. 

The fact that the US is willing to send its drones so close to Crimea suggests that preparations for a Ukrainian-NATO offensive are well underway.

A UK-made Challenger 2 Main Battle Tank using depleted uranium shells

Ukraine is being asked by the US and NATO to launch its offensive against Crimea, starting when sufficient equipment arrives and when the weather is right for a land offensive. Currently Ukraine is receiving a lot of rain and the ability to move heavy equipment and armor is restricted to paved roadways as open fields for armor maneuvers are too muddy.

The planned offensive, already telegraphed by US Under Secretary of State Victoria Nuland, will involve a projected 50,000 Ukrainian troops. This is a very large force for Ukraine to commit to a single battle, but the US thinks that Ukraine can win against Russia in Crimea, which Russia regards as strategic, and force Moscow to leave Ukraine.

Behind US strategic thinking is that defeating Russia in Crimea would force regime change in Moscow.

The hatred in Washington for Vladimir Putin appears to have no limits. The latest ICC arrest warrant for Putin for alleged war crimes was endorsed by President Joe Biden, and comes as no surprise. The rash court action effectively eliminates any possibility of negotiations between Biden and Putin.

How will Russia answer these latest developments? Putin has already sent a warning to Britain about DU ammunition, although what he actually has in mind is not clear. If Russia is watching US activity in rushing the Abrams tanks to the battlefield, including the possibility of the A-10, the situation will get more heated.

Russia is also beefing up its already thick air defense belt around Moscow, preparing perhaps for an expanded conflict in Europe.

By introducing DU in Ukraine, NATO increases the risk that Russia’s response could be tactical nuclear weapons. NATO, as the Russians see it, is opening the nuclear Pandora’s box. Pandora’s box was described in Hesiod’s 700 BC poem, Works and Days wherein the opening the box releases curses on mankind, including sickness and death.

“Woe to them that devise iniquity, and work evil upon their beds! When the morning is light they practice it, because it is in the power of their hand” Micah 2:1

“For the day of the Lord is near upon all the nations. As you have done, it shall be done to you; your dealings will return upon your own head” Obadiah 1:15

“In all your dwelling places the cities shall be laid waste, and the high places shall be desolate, that your altars may be laid waste and made desolate, and your idols may be broken and cease, and your images may be cut down, and your works may be abolished,” Ezekiel 6:6

“Changes not seen in 100 years”

•March 27, 2023 • Leave a Comment

China’s Xi tells Putin of ‘changes the likes of which we haven’t seen for 100 years!’ Perhaps he means changes that will affect the world for the next hundred years!

Now the G2: “Changes not seen for 100 years!” Perhaps it means changes that will affect the world during the next hundred years!

Al Jazeera ~ March 23, 2023

President Xi Jinping and his Russian counterpart Vladimir Putin were filmed saying warm goodbyes as their two-day meeting ended with China’s leader saying they were driving geopolitical change around the world.

The two leaders called for “responsible dialogue” to resolve the Ukraine crisis, with Xi acknowledging Beijing and Moscow had signed an agreement bringing their ties into a “new era” of cooperation.

“Right now there are changes – the likes of which we haven’t seen for 100 years – and we are the ones driving these changes together,” Xi told Putin as he stood at the door of the Kremlin to bid him farewell.

The Russian president responded: “I agree.”

Xi then put out his hand to shake Putin’s and said: “Take care please, dear friend.” Putin responded by holding Xi’s hand with both of his and saying, “Have a safe trip.”

The Chinese leader’s visit to Moscow comes days after the International Criminal Court (ICC) issued an arrest warrant for Putin for war crimes allegedly committed in Ukraine, where Russian forces have made little progress in recent months despite suffering heavy losses.

The talks were intended to cement the “no limits” partnership the two leaders announced last February, less than three weeks before Russia invaded Ukraine.

Putin said a Chinese proposal to end the conflict could be used as the basis of a peace settlement, but the West and Kyiv were not yet ready.

The United States has been dismissive of China’s peace plan and said a ceasefire would lock in Russian territorial gains and give Putin’s army more time to regroup.

Future events are encrypted in Prophecies:

For more into another Captivity: see Ezekiel Timeline – 190/40 Years

For more about the South, a prophecy of Esau or Edom, see Obadiah

For more on the enemy from the South, see A Sword from the South!

Micah (Ch 1-2)

•March 27, 2023 • Leave a Comment

The Prophecy of Micah, the word of the Lord that came to Micah of Moresheth during the reigns of kings, as Jehoram, Ahaziah, Joash, Amaziah and Uzziah. He is thought to have prophesied thirty or forty years, which places him in the years 713 to 750 BC; thus contemporary with Isaiah, Hosea and Amos but had started earlier.

“Hearken, O earth,” although Micah was from Judah, his prophecies were for “Samaria and Jerusalem.” Yet the message is ” Hear, all ye people! Hearken, O earth, and all that is therein! That is, the warning of such message is to the whole earth!

Micah 1

1 The word of the Lord that came to Micah of Moresheth in the days of Jotham, Ahaz, and Hezekiah, kings of Judah, which he saw concerning Samaria and Jerusalem. — in the days of Jotham, Ahaz and Hezekiah, kings of Judah; Micah is thought to have prophesied about sixteen years in Jotham’s time, as many under Ahaz and fourteen under Hezekiah;

— by which it appears that he was contemporary with Isaiah, Hosea and Amos though they began to prophesy somewhat sooner than he even in the days of Uzziah; very probably he conversed with these prophets especially Isaiah with whom he agrees in many things; his style is like his and sometimes the same phrases;

— which he saw concerning Samaria and Jerusalem; in the vision of prophecy, Samaria the capital of the northern kingdom of Israel; assigned to the tribe of Joseph; its southern part of Samaria was then known as Mount Ephraim;

— and is put for them representing the ten-tribes, as Jerusalem was of the tribes of Judah and Benjamin and Samaria is mentioned first because it was the head of the greatest body of tribes; and as it was the first in transgression it was the first to face judgement.

2 Hear, all ye people! Hearken, O earth, and all that is therein! And let the Lord God be a witness against you, the Lord from His holy temple. — hear, all ye people; or “the people, all of them” all the nations of the world, not just the nations of Israel or only from several tribes of Judah;

— hearken, O earth, and all that therein is; or “its fullness” the land of Israel and Judah and the whole earth and all the inhabitants of it; reinforcing what was said above;

— and let the Lord God be witness against you; or “in you” the Word of the Lord as the Targum says; let him who is the omniscient God, who knows all hearts, thoughts, words and actions, let him bear witness in your consciences that what he is about to say; and if you disregard it and repent not let him be a witness against you as he had prophesied in his name; and warned us of our danger.

3 For behold, the Lord cometh forth out of His place, and will come down and tread upon the high places of the earth. — for, behold, the Lord cometh out of his place; out of heaven;

— the place of the house of his Shekinah as the Targum says; where his throne is, where he keeps his court and displays his glory; from whence he removes not by local motion since he is everywhere but by some manifest exertion of his power, either on the behalf of his people or in taking vengeance on his and their enemies;

— and will come down and tread upon the high places of the earth; which are his footstool; Samaria and Jerusalem, built on mountains and all other high towers and fortified places together with men of high looks and haughty countenances who exalt themselves like mountains and swell with pride:

— these the Lord can easily subdue and humble, bring low and tread down like the mire of the street; perhaps there may be an allusion to the high places where idols were worshipped; and which were the cause of the Lord’s wrath and vengeance and of his coming forth in this unusual way in his providences.

4 And the mountains shall be molten under Him, and the valleys shall be cleft, as wax before the fire, and as waters that are poured down a steep place.

— and the mountains shall be molten under him, dissolving before his almighty power, and the valleys shall be cleft, cleaving asunder before his majesty as wax before the fire and as the waters that are poured down a steep place, tearing down the abysses and causing a general dissolution of the entire surface of the earth.

5 For the transgression of Jacob is all this, and for the sins of the house of Israel. What is the transgression of Jacob? Is it not Samaria? And what are the high places of Judah? Are they not Jerusalem?

— for the transgression of Jacob is all this, and for the sins of the house of Israel; all this evil, all these calamities and judgements, signified by the above metaphorical phrases; these did not come by chance nor without reason; but were or would be inflicted according to the judgement of God, upon the people of Israel and Judah for their lies and idolatries;

— is it not Samaria? the wickedness of Samaria, the calf of Samaria? as in Hosea 7:1; that is, the worship of the calf of Samaria; is not that idolatry the transgression of Jacob or which the ten tribes have given into? Or the altering of the Sacred Calendar? where they shifted the feast days a month later? that is; are these not enough reasons for all this wrath to come upon them: or “who is the transgression of Jacob?”

— are they not the kings that have reigned in Samaria with their nobles, princes and great men, who, by their edicts influence encouraged the worship of the golden calves? they caused the people to sin: or as the Targum says “where have they of the house of Jacob sinned? is it not in Samaria?”

— and what are the high places of Judah? or “who are they?” are they not Jerusalem? are they not the king, the princes and priests that dwell at Jerusalem? certainly they are; such as Ahaz and others in whose times this prophet lived; see II Kings 16:4;

— or as the Targum says, “where did they of the house of Judah commit sin? was it not in Jerusalem?” truly it was and even in the Temple; here Ahaz built an altar like that at Damascus and sacrificed on it and spoiled the templev and several of the vessels in it, II Kings 16:10.

6 “Therefore I will make Samaria as a heap of the field, and as plantings of a vineyard; and I will pour down the stones thereof into the valley, and I will uncover the foundations thereof. — therefore God will make Samaria as an heap of the field, as ruins that fall into dust and finally become a part of the soil and as plantings of a vineyard, that is, places where vineyards may be planted;

— and he will pour down the stones thereof, those which King Omri had used in building the city, into the valley, and he will discover, lay bare, the foundations thereof, destroying it to the very ground.

7 And all the graven images thereof shall be beaten to pieces, and all the hires thereof shall be burned with fire, and all the idols thereof will I lay desolate; for she gathered it from the hire of a harlot, and they shall return to the hire of a harlot.”

— and all the graven images thereof shall be beaten to pieces and all the hires thereof, namely, those of spiritual harlotry, the consecrated offerings placed on the idol altars, shall be burned with the fire, and all the idols thereof will God lay desolate, making them a wilderness;

— for she gathered it of the hire of an harlot, by her spiritual adultery, and they shall return to the hire of an harlot, for the rich treasures were taken away by the enemies and devoted to their own idols. The vanity of false worship also in this respect seems rarely to strike the consciousness of idolaters.

8 Therefore I will wail and howl; I will go stripped and naked; I will make a wailing like the dragons and mourning as the owls. — therefore, on account of the calamity which would strike Samaria and Judah, I, Micah, will wail and howl, in a most bitter and mournful cry,

— I will rent my garments, will go stripped and naked as Isaiah did, Isaiah 20:3; he went about like a madman, one disturbed in his mind, bereft of his senses because of the desolation coming upon Israel;

— I will make a wailing like the dragons like the jackals of the desert, and mourning as the owls like ostriches crying in pain; so the Targum says, “for this they shall wail and howl, and go naked among the spoilers;”

“And the Lord said, “As My servant Isaiah hath walked naked and barefoot three years for a sign and wonder upon Egypt and upon Ethiopia,” Isaiah 20:3

9 For her wound is incurable; for it has come unto Judah; he has come unto the gate of My people, even to Jerusalem. — for her wound is incurable; or her “stroke is desperate” the ruin of Samaria and the ten tribes are inevitable; the decree being gone forth and they hardened in their sins and continuing in their impenitence;

— and their destructions are irrevocable; till the time comes that all Israel shall be saved; “she is grievously sick of her wounds” just ready to die upon the brink of ruin and no hope of saving her; this is the cause and reason of the above lamentation of the prophet, and increased his grief and sorrow;

— for the calamity has reached the land of Judah; it stopped not with Israel but spread itself into the two tribes of Judah and Benjamin; for the Assyrian army, having taken Samaria and carried Israel captive in a short time, about seven or eight years, invaded Judea and took the fenced cities of Judah in Hezekiah’s time in which Micah prophesied;

— he, Sennacherib, king of Assyria, having taken the fenced cities came up to the very gates of Jerusalem and besieged it where the courts of judicature were kept and the people resorted to, to have justice done them; and Micah, being of the tribe of Judah calls them his people and was the more affected with their distress.

10 Declare ye it not at Gath, weep ye not at all; in the house of Aphrah roll thyself in the dust. — declare ye it not in Gath, one of the chief cities of the Philistines,

— weep ye not at all lest the message cause these enemies to rejoice; in the house of Aphrah roll thyself in the dust, literally “in Beth-leaphra I wallow in the dust,” for such scattering of dust was a sign of deep grief. Throughout this paragraph the prophet in the Hebrew uses puns (a joke exploiting different possible meanings), for Gath means “announcement” and Ophra “dust-house.”

11 Pass ye away, thou inhabitant of Shaphir, having thy shame naked. The inhabitant of Zaanan came not forth in the mourning of Bethezel; he shall receive from you his standing.

12 For the inhabitant of Maroth waited anxiously for good, but evil came down from the Lord unto the gate of Jerusalem. — for the inhabitants of Maroth (bitterness) waited carefully for good, being anxiously and bitterly concerned about it,

— writhing in grief and pain on account of her lost prosperity; but evil came down from the Lord unto the gate of Jerusalem. But while all these towns were in the neighborhood of Jerusalem the prophet next shows that the punishment would not be confined to the immediate neighborhood of the capital.

13 O thou inhabitant of Lachish, bind the chariot to the swift beast (she is the beginning of the sin to the daughter of Zion), for the transgressions of Israel were found in thee.

— O thou inhabitant of Lachish, a fortified city in the plain toward the southwest, bind the chariot to the swift beast, to the fastest horses, namely, to escape the impending punishment; she is the beginning of the sin to the daughter of Zion, for the transgressions of Israel were found in thee, she was the first city of Judah to introduce the idol-worship of the northern kingdom.

14 Therefore shalt thou give presents to Moreshethgath; the houses of Achzib shall be a lie to the kings of Israel. — therefore shalt thou give presents to Moresheth-gath (the betrothed of Gath), the daughter of Zion being obliged to dismiss or release this city to the enemy, like the gift of a marriage portion;

— the houses of Achzib (deception); shall be a lie to the kings of Israel, a deceitful brook which offers no refreshment to the thirsty wanderer; just so the city would slip from the grasp of the kings of Judah (the southern kingdom being meant in this instance) so that it would no longer be in their possession.

15 Yet I will bring an heir unto thee, O inhabitant of Mareshah: he shall come unto Adullam, the glory of Israel. — yet will God bring an heir unto thee, O inhabitant of Mareshah (town of inheritance), for Israel had been the heir obtaining it from the Canaanites and the enemy would now be the heir receiving it from the people of Judah;

— he shall come unto Adullam, the glory of Israel, rather “even unto Adullam will the nobility of Israel come,” to hide themselves in the cave in which David once sought refuge from Saul, 1 Samuel 22:1.

16 Make thyself bald, and shear thy beard because of thy pleasant children; enlarge thy baldness as the eagle, for they are gone into captivity from thee.

— Micah asked to make himself bald, Zion as the mother of the nation being addressed, and poll thee, shearing her head, for thy delicate children in deep grief and sorrowful lamentation;

— enlarge thy baldness as the eagle, the griffin vulture of the Orient, the entire forepart of whose head is without feathers; for they are gone into captivity from thee. The entire chapter is a powerful and vivid description of the overthrow of the land by the armies of the invaders, which would be sent to punish the transgression of Judah.

Micah 2

1 Woe to them that devise iniquity, and work evil upon their beds! When the morning is light they practice it, because it is in the power of their hand. — woe to them that devise iniquity; which were premeditated and done deliberately; any kind of iniquity, idolatry or worshipping of idols for the word is used sometimes for an idol,

— or the sin of uncleanness on which the thoughts too often dwell in the night; or coveting of neighbours’ goods and oppressing the poor, sins which are instanced in Micah 2:2; and every thing that is vain, foolish, wicked and in the issue brings trouble and distress: now a woe is denounced against such that think on such things and please themselves with them in their imaginations and contrive ways and means to commit them;

— and work evil upon their beds; when the senses being less engaged the thoughts are more free; but, instead of this the persons here threatened are said to “work evil on their beds” when they should be asleep and at rest or engaged in good things; that is, they plot and contrive how to accomplish the evil they meditate; Psalms 36:4;

— when the morning is light, they practise it; they wish and wait for the morning light and as soon as it appears they rise and instead of blessing God for the mercies of the night and going about their lawful business they endeavour to put in practice with all rigour and diligence and as expeditiously as they can, what they have projected and schemed in the night season;

2 They covet fields and take them by violence, and houses, and take them away. So they oppress a man and his house, even a man and his heritage. — and they covet fields and take them by violence; the fields of their poor neighbours which lie near them and convenient for them;

— they wish they were theirs and they contrive ways and means to get them into their possession; and if they cannot get them by fair means, if they cannot persuade them to sell them or at their price they will either use some crafty method to get them from them or they will take them away by force and violence; as Ahab got Naboth’s vineyard from him;

— and houses and take them away; they covet the houses of their neighbours also and take the same course to get them out of their hands and add them to their own estates;

— so they oppress a man and his house, even a man and his heritage; not only dispossess him of his house to dwell in but of his paternal inheritance, what he received from his ancestors and should have transmitted to his posterity being unalienable; and so distressed a man and his family for the present and his posterity after him; which seems to be designed to make it agree with the story of Ahab, 1 Kings 21:13.

3 Therefore thus saith the Lord: “Behold, against this family do I devise an evil, from which ye shall not remove your necks, neither shall ye go haughtily; for this time is evil.

— therefore thus saith the Lord, behold, against this family; against the family of Jacob; do I devise an evil; because of those evils of covetousness, oppression and injustice, secretly devised and deliberately committed; even an invasion of their land by the Assyrians and the carrying of them captive from it into foreign regions;

— from which ye shall not remove your necks; that is, the house of Jacob would not be able to deliver themselves from it; they would not be able to stop the enemy in his progress, having entered their land; nor oblige him to break up the siege of their city and being carried captive they would never be able to free themselves from the yoke of bondage put upon them;

— neither shall ye go haughtily; with necks stretched out and heads lifted up high and looking upon others with scorn and contempt; but hereafter their heads would hang down, their countenances be dejected and their backs bowed with the burdens upon them: for this time is evil; very calamitous, afflictive and distressing; and so not a time for pride and haughtiness but for dejection and humiliation.

4 In that day shall one take up a parable against you, and lament with a doleful lamentation and say, ‘We are utterly despoiled; He hath changed the portion of my people. How hath He removed it from me! Turning away, He hath divided our fields.’”

— in that day shall one take up a parable against you; making use of your name as a byword, a proverb, a taunt and a jeer; mocking at your calamities and miseries: or “concerning you” take up and deliver out a narrative of your troubles in figurative and parabolical expressions;

— and lament with a doleful lamentation for the mocking song of the enemies would be a mournful dirge in the mouths of the house of Israel and say, “We will be utterly spoiled” losing everything we have; or We be utterly spoiled, completely destroyed! He hath changed the portion of my people, God himself permitting one of the nations, an enemy from the South, to take possession of it; (for a more comprehensive and a parallel Ezekiel 20-21 scene is added at the end)

— for more, see The Sword from the South!

5 Therefore thou shalt have none that shall cast a cord by lot in the congregation of the Lord. — therefore thou shalt have none that shall cast a cord by lot, to cast a measuring-line on a lot of ground in the assembly of God,

— for the possessions of the children of Israel belonged to them only as long as they remained faithful to the God of the covenant and would be taken away when they became unfaithful.

6 “Prophesy ye not,” say they to them that prophesy: “They shall not prophesy to them, that they shall not suffer shame.” — like, Amaziah: prophesy not, say they to them that prophesy, literally, “Drop not,” or “drivel (senseless talk or writing; nonsense) not, they drivel,” almost like the American slang (balderdash),

— “Dry up! they drivel,” in speaking to the true prophets in a silly fashion. They shall not prophesy to them that they shall not take shame, that is: If the prophecy which the apostate Jews regarded as drivel would not continue then there would be no chance for them to escape the shame which would come upon the entire nation by the conquest of the enemies;

— the unbelievers to this day refuse to realize that the very preaching which they consider drivel and rot is the one means of saving them from the impending Judgement.

7 Oh thou that art named the house of Jacob: Is the Spirit of the Lord straitened? Are these His doings? Do not My words do good to him that walketh uprightly?

— O thou that art named the house of Jacob; but dost not act suitably to the piety of thy father Jacob and therefore though thou art in name, yet not in truth the genuine seed of Jacob;

— is the Spirit of the Lord straitened. Is God’s hand shortened? are his power, wisdom and kindness less now than formerly? are these his doings; are these severe proceedings the doings your God delights in? are the judgements he brings upon you the genuine effects of his power and goodness? and not rather such acts as your sins do in a manner constrain him to exercise? Thus punishments are called his strange work, Isaiah 28:21;

— do not my words do good to him, that walketh uprightly? Certainly, both God’s laws and the words delivered by his prophets would do you great and lasting good if you would obey them.

8 “Even of late My people have risen up as an enemy; ye pull off the robe with the garment from them that pass by trustingly as men returning from war. — even of late, in fact, yesterday, my people is risen up as an enemy, taking an open stand against Yehovah; and this hostility is openly shown;

— ye pull off the robe with the garment, stripping off the mantle or upper garment from them that pass by securely, considering themselves safe from robbery and violence, as men averse from war, that is, from peaceable people, such as seek no quarrel with any one.

9 The women of My people have ye cast out from their pleasant houses; from their children have ye taken away My glory for ever. — the women of my people, the unprotected widows have ye cast out from their pleasant houses, the houses of their delight to which they were attached by the memory of their wedded love;

— from their children have ye taken away my glory, the ornament or gift which he has given them forever, namely, by depriving them of their dress and of their rightful property. Cf Exodus 22:25.

10 Arise ye and depart, for this is not your rest; because it is polluted it shall destroy you, even with a sore destruction. — arise ye and depart! into the exile which the enemies would force upon them; for this is not your rest,

— they would not be permitted to remain in Canaan; because it is polluted, it shall destroy you, even with a sore destruction, or “on account of the corruption which brings a most powerful destruction.” Such prophecies, setting forth the depth of the nation’s corruption are of course very unwelcome to the wicked leaders.

11 If a man walking in the spirit of falsehood lieth, saying, ‘I will prophesy unto thee of wine and of strong drink,’ he shall even be the prophet of this people!

— if a man walking in the spirit and falsehood, in vanity and falsehood, namely, in preaching his own ideas, do lie, saying, I will prophesy unto thee of wine and of strong drink, that is, of the enjoyment of this present life,

— he shall even be the prophet of this people, possessing “itching ears” referring to: tell me what we want to hear, even if there are little lies, sweet little lies, that they will all go to a place of safety, they would meet with the approval of their leaders for a time of final training, and those who desired a cover for their lives of luxury and dissipation (kill the righteous and the wicked – more at the end).

12 “I will surely assemble, O Jacob, all of thee; I will surely gather the remnant of Israel. I will put them together as the sheep of Bozrah, as the flock in the midst of their fold; and they shall make great noise by reason of the multitude of men.

— God will surely assemble, O Jacob, all of thee all those whom he intended as members of his congregation; he will surely gather the remnant of Israel, collecting the believers from all the nations of the earth;

— he will put them together in one fold, John 10:16, as the sheep of Bozrah, the rich meadowland east of Jordan as the flock in the midst of the fold, secure from the attack of the enemies. They shall make great noise by reason of the multitude of men, surging with their great numbers.

13 The Breaker has come up before them; they have broken forth and have passed through the gate, and are gone out by it; and their king shall pass before them, and the Lord at the head of them.”

— the Saviour is come up before them, rather “There will go up before them He that breaketh through,” their powerful Champion; they have broken up, rather “they break up,”

— and have passed through the gate, passing into the gate of the Lord’s kingdom, and are gone out by it, having free access to the throne of mercy; and their King, the Messiah Himself, shall pass before them and the Lord on the head of them, leading them through all the vicissitudes of this life to the promised life of eternity. While men are clamoring for a kingdom which will suit their fleshly lusts and desires, all true shepherds will continue to proclaim sin and repentance.

~~~

More about an enemy – to kill the righteous and the wicked – from South to North

Ezekiel 20:45 Moreover the word of the Lord came unto me, saying,

46 “Son of man, set thy face toward the south, and drop thy word toward the south, and prophesy against the forest of the southland.

47 And say to the forest of the south: ‘Hear the word of the Lord. Thus saith the Lord God: Behold, I will kindle a fire in thee, and it shall devour every green tree in thee and every dry tree. The flaming flame shall not be quenched, and all faces from the south to the north shall be burned therein.

48 And all flesh shall see that I, the Lord, have kindled it; it shall not be quenched.’”

49 Then said I, “Ah, Lord God! They say of me, ‘Doth he not speak parables?’”

Ezekiel 21:1 And the word of the Lord came unto me, saying,

2 “Son of man, set thy face toward Jerusalem, and drop thy word toward the holy places, and prophesy against the land of Israel;

3 and say to the land of Israel, ‘Thus saith the Lord: Behold, I am against thee, and will draw forth My sword out of his sheath and will cut off from thee the righteous and the wicked.

4 Seeing then that I will cut off from thee the righteous and the wicked, therefore shall My sword go forth out of his sheath against all flesh from the south to the north,

5 that all flesh may know that I, the Lord, have drawn forth My sword out of his sheath. It shall not return any more.

Q: how would such scenarios be played out?

~~~~

For more on the enemy from the South, see A Sword from the South!

For more about the South, a prophecy of Esau or Edom, see Obadiah

For more into another Captivity: see Ezekiel Timeline – 190/40 Years

HMS Royal Calamity! 

•March 26, 2023 • Leave a Comment

Boris Johnson, intoxicated and deprived of a sound mind, purposely flew over to Kyiv to sabotage the Peace Deal between Ukraine and Russia on behalf of Joe Biden way back in April, 2022; and as a result, almost one year on, Ukraine is being ravaged and destroyed!

“Woe to them that devise iniquity, and work evil upon their beds! When the morning is light they practice it, because it is in the power of their hand” Micah 2:1

Now, HMS Calamity! Royal Navy faces multi-million pound bill to aircraft carrier HMS Prince of Wales which broke down moments after leaving harbour as it set sail despite some officers ‘knowing about faulty propeller’

Royal Navy personnel take part in a ceremony to officially name the aircraft carrier HMS Prince of Wales in September 2017

Daily Mail by Mark Nicol ~ March 18, 2023

The Royal Navy is facing a multi-million-pound bill for its bedevilled second aircraft carrier after gambling on its seaworthiness, the Daily Mail can reveal.

Some senior officers knew about HMS Prince of Wales’ faulty propeller before she set off on her landmark voyage last year but kept quiet.

The warship then broke down just after she left Portsmouth Harbour. The Ministry of Defence, rather than the manufacturers, will be picking up the estimated £20million recovery and repair costs.

The hugely embarrassing debacle is now the subject of a Ministry of Defence inquiry. Investigators want to establish who knew what, and when, and who failed to highlight the risks.

The probe is also understood to have uncovered evidence that HMS Prince of Wales was rushed into service, seemingly to serve a political agenda.

According to sources, issues surrounding the starboard propeller shaft were ‘lost in the handover process from one crew to another’.

This meant the officers who set off for the US last August were ‘blissfully unaware’ of the likelihood of HMS Prince of Wales breaking down.

Divers were sent down to inspect the 33-ton starboard propeller which had malfunctioned due to a broken coupling. The Mail understands the root cause was a misalignment of the propeller during the build phase of the carrier.

The propeller was removed before HMS Prince of Wales, escorted by a tug, sailed to a dry dockyard at Rosyth, Scotland, for extensive repairs which are still ongoing.

HMS Prince of Wales parked at a dry dockyard at Rosyth, Scotland, for repairs

The Royal Navy’s Rear Admiral Steve Moorhouse said after the breakdown: ‘Our initial assessment has shown that a coupling that joins the final two sections of the [propeller] shaft has failed. This is an extremely unusual fault.

‘We are committed to getting HMS Prince of Wales back on operations, protecting the nation and our allies, as soon as possible.’ 

The 65,000-ton carrier entered service in 2021, the year after its sister vessel HMS Queen Elizabeth. They cost more than £6billion and have already drained the Royal Navy’s funds to build other warships.

They are the largest and most expensive British warships ever made. Their flight decks are larger than three football pitches and they can embark scores of stealth fighter jets and helicopters. While HMS Queen Elizabeth has proved a strategic asset, HMS Prince of Wales has been beset by problems.

The disparity in performance is raising questions about whether the warships were built to the same standard and whether the Royal Navy can afford the two carriers.

The National Audit Office has found the MoD has been ‘slow’ to develop ships needed to support the carriers, potentially hampering operations until 2028 or later.

Last night ex-Royal Navy commander Tom Sharpe said: ‘Someone in the trials process accepted the risk [surrounding the propeller] that this would pose to the running of HMS Prince of Wales.

‘The Royal Navy must make doubly sure similar shortcuts are not taken in the many other new-build warships. 

Shaft alignment should not be done badly these days. Someone in the build process made a big mistake.’

Defence chiefs signed for HMS Prince of Wales despite Royal Navy officers being aware of the propeller issues. 

This decision has exposed MoD to the costs of recovering and repairing the carrier.

A source close to the investigation said: ‘Someone knew about the problems and didn’t flag them or amplify them as we would have liked. Lessons must be learned as this has proved a very expensive mistake.’

Last night the MoD said: ‘We remain committed to ensuring HMS Prince of Wales commences her operational programme, as planned, in autumn 2023.’

“Woe to them that devise iniquity, and work evil upon their beds! When the morning is light they practice it, because it is in the power of their hand” Micah 2:1

“For the day of the Lord is near upon all the nations. As you have done, it shall be done to you; your dealings will return upon your own head” Obadiah 1:15

“In all your dwelling places the cities shall be laid waste, and the high places shall be desolate, that your altars may be laid waste and made desolate, and your idols may be broken and cease, and your images may be cut down, and your works may be abolished,” Ezekiel 6:6

Depleted Uranium Impacts on Children

•March 25, 2023 • Leave a Comment

New Study Documents Depleted Uranium Impacts on Children in Iraq

Foreign Policy Journal by David Swanson | Sep 21, 2019 |

A new study shows an association between depleted uranium, used by the US during the Iraq war, and the risk of birth defects in Iraqi children.

In the years following 2003, the US military dotted Iraq with over 500 military bases, many of them close to Iraqi cities.

These cities suffered the impacts of bombs, bullets, chemical and other weapons, but also the environmental damage of open burn pits on US bases, abandoned tanks and trucks, and the storage of weapons on US bases, including depleted uranium weapons. Here’s a map of some of the US bases:

Now, the British are said to be planning to send depleted uranium shells to Ukraine to be fired from their Challenger tanks but I’ll end here as I don’t didn’t want those photos from Iraq on this site because they’re too “graphic!” Click the above Foreign Policy Journal by David Swanson only if you have the stomach to see the photos!

“Woe to the crown of pride, to the drunkards of Ephraim, whose glorious beauty is a fading flower, which is on the head of the fat valleys of them that are overcome with wine!” Isaiah 28:1

“For the day of the Lord is near upon all the nations. As you have done, it shall be done to you; your dealings will return upon your own head” Obadiah 1:15

“In all your dwelling places the cities shall be laid waste, and the high places shall be desolate, that your altars may be laid waste and made desolate, and your idols may be broken and cease, and your images may be cut down, and your works may be abolished” Ezekiel 6:6